1P9RA

Crystal structure of vibrio cholerae putative ntpase epse
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
401
structure length
378
Chain Sequence
DFFSLAEEAPIIKLINAMLGEAIKEGASDIHIETFEKTLSIRFRVDGVLREVLAPSRKLSSLLVSRVKVMAKLDIAEKRVPQDGRISLAVDVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTAHNHDNFRRLIKRPHGIILVTGPTGSGKSTTLYAGLQELNSSERNILTVEDPIEFDIDGIGQTQVNPRVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMSTLHTNTAVGAVTRLRDMGIEPFLISSSLLGVLAQRLVRTLCPDCKEPYEADKEQRKLFEPLILYRATGCPKCNHKGYRGRTGIHELLLVDDALQELIHSEAGEQAMEKHIRATTPSIRDDGLDKVRQGITSLEEVMRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General secretion pathway protein E
publication title Crystal structure of the extracellular protein secretion NTPase EpsE of Vibrio cholerae
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein transport
total genus 103
structure length 378
sequence length 401
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1p9rA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p9rA02
3MWKA 1FFHA 5AJWA 2CL6X 1UKEA 2W6ID 2FEMA 1KSFX 4JLMA 4G5QA 1XEWX 2HF8A 5J4KA 2ZVQX 2R2AA 3P32A 1S3GA 3WNBA 3LLUA 1T0JB 3BGWA 2G88A 1ZP6A 4TZ0A 4HLQB 2O5VA 4URXR 2ZSFA 2J9RA 4Q03A 1KO8A 4PSVA 4PPQA 1OB2A 1E9SA 1SVMA 3LLMA 3AKEA 3SZRA 2ZI7A 2ZRLA 4R98A 1QVAA 1D8TA 3AVVA 3VKGA 1PVOA 1R5BA 3AF1A 2Z5FA 5DSZA 1MR3F 4D4LA 3GLGB 3NDPA 1YU9A 2BMJA 1E4YA 3GLGE 2O8CB 1YZQA 3L0PA 4WOPA 3IDQA 1WQ1R 1GUAA 2KBFA 4LHXA 4CDGA 2HT1A 4GL2A 1AK2A 2X1VA 2HEIA 2A5JA 3TUIC 5B30A 3OF5A 1KO7A 5EXPA 5AJVB 1Q1QA 3LW7A 5FPYA 4B3CA 5J4HA 4OI4A 4PR0A 4PZZA 5DLQC 4FCTA 2CCKA 2ZRJA 3B82A 1R6BX 3K8YA 3T15A 1F2TB 2RH5A 2EYUA 2QGNA 4A92A 4U02A 3W3ZB 1Q21A 4PHFA 2NPIA 2NG1A 2OLKA 1JR3A 3K0CA 2OESA 3ZD7A 2A5GA 4YDSA 4NMMA 5ANRB 1N6LA 3MRSA 5FOVA 3SJCA 1TMKA 2ONKA 3AKCA 5J4YA 3EC1A 2CVFA 4MRVA 1N2CE 3PCRB 3IIJA 4RFVA 4V0NA 2IC5A 2ODNA 5FBLB 1NVWQ 2EU8A 3GEEA 2B8WA 3G5UA 1ZD9A 521PA 4OL0A 2ZE7A 2F9MA 4GP7A 2O8BA 1XJCA 1PLJA 1T5IA 3WBKA 2BM0A 1ZINA 4LSGA 5KHOC 1G6HA 3QE0A 4YDHB 3TSZA 4A8JB 1FTNA 2R6AA 1ZM2A 4M0LA 2F43A 4F38A 5C1BA 4DZZA 2X2EA 3QF7A 3CRW1 2OBMA 1D6JA 2ZJBA 3QG1A 2HT6A 2CK3A 2Q6TA 1E0AA 1D2EA 1GITA 4UNPA 4QFMA 3AVPA 2DB3A 4WAUA 3ZS9A 4RZXA 1W36D 5EZ6B 4E09A 4NYJQ 4E22A 1Z2AA 3PEUA 2RHDA 1EX6A 2NO7A 4RKEA 1KO4A 3RS2A 1GVNB 3NBFA 3U4QA 3ZYCA 3WNCA 2IYZA 5BYKA 2XZLA 4Q7JB 1JPJA 3TQCA 3M6AA 2C98A 4PQRA 3X1XA 3V4RA 3WHLA 5JI3E 4FMCF 2JLZA 2C78A 4AG6A 2O0KA 5AJXA 1E2NA 1FPMA 4B3BA 1CJMA 4XSGA 3SHWA 3T5DA 3NH6A 5FR2A 3C5CA 1A5TA 1LW7A 1HQCA 4CT4B 3TR5A 3X1DA 3AVYA 4OBEA 5JZVA 1KI3A 1OH6A 2PZFA 1XEXA 4DB4A 5TY0A 4CEIB 4NDZA 2EFCB 1E9AA 1ZCBA 2J7PA 4MGYR 4BFUA 3MJHA 4O2RA 1ZD8A 4BFVA 1IN6A 1ZU5A 4M1YA 3U3MA 1G8HA 3EZ6A 1XU4A 1T4GA 5EXXA 1UBCA 1KZ7B 1VCNA 1XMJA 3KJIA 5FOUA 5KOYA 1UDWA 1ZBDA 3A4NA 2XB4A 2GJ8A 1EK0A 2WWXA 3A1SA 3CF6R 4R2IA 4RZUA 5FFMA 1II9A 2H92A 1P3JA 1GOTA 2NOAA 2AR7A 3EA5A 2PZGA 5JS7A 4U5XA 3CRQA 2KE5A 5D3MA 1S96A 4Q66C 4FD2A 4LV5B 1OV4A 3ADBA 2QP3A 3I92A 1VECA 1TQ4A 1RC8A 4F93B 1M1YE 2WPDD 3ECCA 1GWNA 2J0UA 4P31A 3SU8A 2EFGA 3CRVA 5JFGA 2JIZA 2XTZA 5LDDC 3BIFA 3UKDA 3JVVA 3D31A 3HYTA 4W9MC 1E2LA 4B47A 4TTPA 1SXJE 3KKOA 2Q9CA 4F91B 3LFUA 3KL4A 2V6JA 2B7CA 3R20A 4KFRA 3RSLA 3VHXA 4RFSA 3UK6A 5JEEA 1U8ZA 2ZREA 1CJUC 5FI0B 1Z6AA 2XNSA 2AD1A 2TMKA 3WRYC 3EIEA 3JZMA 2O52A 4K8OA 3Q9LA 3FMOB 1LVGA 3AGQA 1XPOA 1IHUA 3RWOA 5CM9C 2AHOA 2QPTA 4FCVA 5L3SA 4DC9A 1AM4D 2H8KA 2BWJA 2QRZA 2IUTA 2Q3HA 2VF7A 1E0KA 2DY1A 2R62A 1YZUA 2ANBA 2XTMA 3PFIA 3BORA 4ESVA 1SZPA 1Z07A 4KO8A 2VF8A 1GFIA 2OSBA 2NZ8A 4M1TA 2ZS7A 4DCNA 1CU1A 3FMFA 3Q3JB 2JLYA 1KGDA 2OXRA 1E32A 1GRQA 3BH6A 1P2VA 2J46A 4ZCLA 4Q1AA 1W4RA 3CLVA 1KOFA 1HTWA 4A2QA 4KV9A 4DHEA 4B48A 1OKKA 5DI9A 3TW4A 2FG5A 3I8XA 4EAQA 3VR6A 3CX8A 5AWFC 1VPLA 3WMGA 1UKZA 4AG5A 2QBYB 4JKYA 2A5DA 2ZUBA 3MCAA 1Q3TA 2GESA 5EUMA 4DUGD 2BJVA 1HEIA 2Q9AA 3FPAA 4Q4HB 1OE0A 4BFYA 3NXSA 3GLHB 4O3MA 4GOXA 4TYNA 2BHRA 4TMVA 1OLOA 5FOSA 5CB6A 3I8SA 4LCBA 2OILA 3BB4A 4C0LA 4E03A 4RD3A 3I61A 1CR0A 4D4KA 4OI2A 3PQCA 5FBQB 5HTKA 2UZ3A 5KNDA 3AVXA 3AF0A 3H2YA 1LB1B 2OCYC 5A5GA 4BFWA 5KPJA 1I2MA 3RC3A 4JJZA 3EARA 1OFUX 1VG9B 1J99A 3HR8A 1DOAA 1KI8A 1ZU4A 3K9LA 3DPUA 4C0KA 1YE8A 5F9FA 3AP1A 3CRRA 1SULA 5DGXA 3GJ7A 4G5SA 2G9NA 1NKTA 4LOAA 5CITA 5CLLA 1Z22A 2VP0A 2E87A 2QE7D 4K46A 2ZSAA 3FFAA 2GBLC 2GCOB 3BRWD 3GJXC 4I99A 5KSYA 3LXXA 3U6BA 4D82A 1R5OA 1U0HC 3WYFA 5EP1A 4C0SA 3OFND 1NI3A 5F9HA 5F98A 3E5HA 1UADA 2F3TA 1Z06A 3C4JA 3GLFB 4KODA 2P6NA 2FGJA 4KYUA 5EP2A 5A4JA 4GPTA 1E1QA 4TWZA 3GLIB 1E6CA 4LYAA 2JLUA 3EIHA 2VSXA 4US0R 1BMFA 2JEOA 4A1FA 4AURA 5FL3A 1M7GA 2E1RA 4E07A 2VSFA 1BIFA 3AF4A 3LDAA 3Q7QA 3QNUA 4PPGA 3TMKA 4LJ4A 1YZGA 5L8VA 1ZC3A 1COWA 1MRNA 3KZ1E 4MRNA 2V1UA 3T35A 4RD2A 1N6KA 2N1BA 3QBTA 3W9YA 2YWGA 3N2IA 2A2ZA 1P9WA 1E9FA 3WHKA 5SZKB 1MH1A 5JJKA 4P32A 2J0UB 4ZDKA 2QQEA 3QUSA 2FMXA 2W0SA 4A8JA 1BH2A 1NMYA 4BZXA 5ELXA 1OYWA 4M4SA 5KPDA 1EFRD 1IJEA 1IY0A 3CPJB 2QNRA 2CHVA 2C9CA 2V9PA 3EPLA 5AUPB 4B34A 4Q4JB 4NCNA 1XP8A 4US2R 3SFVA 3IILA 1P4SA 3RANA 3DO6A 4PFSA 1R0XA 2VSOA 2C5LA 2Q3MA 1GILA 5KUTA 2IW3A 2OAQ1 4Z1MA 2IL1A 5CYOA 3TNFA 3BFXA 1RYHA 5CYPA 2R6DA 2ZE5A 2ZR0A 1VKJA 4KI0A 5CIQA 4ZI3A 5D3MB 1BKDR 4A4DA 1E9RA 3L0OA 2BM1A 4TL9A 2O8EA 3T1TA 2WV9A 3OE7D 1OT3A 3DZ8A 5FPSA 3WXMA 4O0MA 1ETUA 2GKSA 2A30A 3K0SA 3AKDA 1K6MA 4TTRA 1NIPA 3K1JA 1Z63A 2C99A 1G18A 2W2XA 2YOFA 3QPVA 3TAHA 4RJLA 2WTUA 1F48A 1KKLA 4D4MA 2XZOA 4NP6A 4DVGA 2ZRMA 4LYFA 4K81B 3NBXX 4XVUA 2IWHA 1SKQA 2WAXA 2YC2C 1XD2A 5CJ2A 4G01B 4C0AC 4HLDA 4H9GA 5KSPA 3ZS8A 3GJ5A 2IYSA 5BN3A 1KNXA 1OFTA 1M2OB 2J87A 3D7MA 3LVRE 4UJ5A 1MOZA 1XXHB 3CWQA 1A82A 4KAXA 1AA9A 4EPWA 2OM2A 3PEVA 2GWHA 4DT1A 1W0JA 1DO0A 5JHGB 1AGPA 4BUJA 4PXAA 1SXJD 3GLIA 4IDHA 1PLLA 1W2HA 2AK3A 1G8YA 4F4IA 1C1YA 3R8FA 2BKUA 3U3JA 3VR1A 1JQLB 3I32A 4A2WA 3GEHA 4NKRA 5DO9A 2WMOB 3CPEA 4OQFA 2OBLA 4FWIB 2MSDB 3KUDA 3M1IA 4C0HA 2WKPA 4BE7B 1OIWA 4L8GA 4NHOA 4TLDA 5JHHB 4IDPA 3U3OA 3PEWA 1NMZA 1N5JA 3THWB 2ERYA 1UPTA 5IRCD 1KAGA 3Q5DA 4CVNA 2ZR7A 1LV7A 2N42A 3BE4A 2ZEJA 1SXJA 1AKYA 4A82A 1KI7A 4C0QC 2CL7X 3PVSA 2FX3A 4MGZR 1Z0IA 3C7KA 4L4UA 3GEIA 1DG3A 3WP0A 2OT3B 4DCUA 3OAAA 3FWYA 4IOMA 1E4VA 1ZNWA 3C15C 1KTVA 1OHHD 4CEHA 1JR3D 1KO1A 1ZUHA 2BVNA 3QXCA 4JLNA 4Q4HA 1G8FA 1R7RA 4TZ6A 1KO5A 1WMSA 4LWZA 2VPPA 2PCJA 4YMSA 3U44A 4AC9A 4HEJA 2W2VA 3AQ4A 2GETA 2YWEA 3MWYW 3RS3A 1FQKA 1RJ9B 2ZROA 3GFPA 2VBCA 2WOOA 1DAIA 4BLPA 2DWPA 4Q01A 1ZCAA 1DAEA 3N70A 2O0JA 1DBSA 3H1TA 5FBWB 3KQKA 4NPHA 4MRSA 4M1WA 3T1OA 1JEEA 2VEDA 1NRJB 4KXFB 2O8FA 4A0GA 3HR7A 4PHTA 1E9DA 1S9HA 2G77B 2OBNA 2PL3A 4JJKA 4QC2A 3UWOA 4QL3A 2BCJQ 3ZQ6A 1N25A 2IYVA 4DSTA 3RC8A 2QUZA 4PQYA 1OHHA 4PHHA 2VH5R 4HYYA 4PPFA 4KITB 4A36A 1JAIA 1VCIA 4URUR 3ZD6A 1CF4A 4BFSA 4FXPA 2O8CA 1UBFA 1BS1A 2Z0MA 1SKYE 3NHBA 3VR3A 4B6FA 3ICEA 4UXJA 2OCAA 4EQ6A 1QHIA 3QJYA 5HCIA 1VCOA 3QXXA 4TYQA 1YR6A 2ORVA 2XJ4A 2IYLD 1T91A 1X8JA 3IBYA 4MYUA 3EC2A 2OXCA 3K9HA 3AVTA 1OF1A 3NKVA 4DSOA 2C9YA 1Q3HA 3KXLA 4TTQA 3HP1A 1KI1A 1NY6A 4P4SB 3UWKA 5HPYB 1WDTA 2VIIA 3GLFE 1NVXQ 5DI3B 4LBYA 2C04A 3KB1A 1G6OA 3UMFA 4Q4AA 3SR0A 3U3RA 3QIAA 5FBRB 1FTSA 1W4CA 3NC0C 2QSZA 2XNDA 1DADA 2YINC 4URZR 2GJAA 3W6NA 2WWWA 2FDCA 4DCSA 4PO8A 5H70A 3DZDA 3RS4A 1PLKA 3ETLA 1XTIA 4BFXA 1XCGB 5JWRA 1U99A 4PO1A 1FW6A 4RD6A 1E94E 1J7KA 4HSEA 3AKYA 1GNPA 2D62A 1DO2A 2DHRA 3CB4A 5HR5A 1G3RA 1YVDA 1U2RA 3P4YA 4D26A 2PX3A 3U61B 2FNAA 3NG1A 5G53C 1TPZA 2HDNB 4CW7A 1P9NA 5FOTA 3DDCA 1KKMA 2ZRPA 2QP9X 4GMXA 4IXNA 4NBSA 1MO3A 2H17A 4OHWA 3I72A 1X1RA 4ZO4A 5JSZB 3M0EA 4I1SA 1R4AA 3FTQA 2IYXA 1EGAA 1SQ5A 3EASA 5KNBA 1ZM3A 4IHQA 2XOKD 4DUGA 2C8VA 2CXXA 1OPXA 1QHHA 1R8QA 4D2IA 1DAFA 3CR8A 1Q1BA 4ACBA 4OK6A 2DWQA 3B7GA 4IVRA 4GRAA 4TYYA 3K70C 4UJ3A 2GJKA 4AIIA 2W00A 4XVRA 5FL7D 5BWMA 3EPJA 2WSSA 4PSKA 3IKJA 4IOKA 5EXSA 3X2SA 3BBPA 1W2GA 5FTNA 4YXWD 4RZ3A 1G19A 2PT5A 2HLDA 1XTJA 4C0JA 1SVLA 1ZM7A 3L0IB 3L8ZA 2P3SA 4FWTA 4UKDA 2JLVA 1Z0JA 2GBLA 4PC1A 2ZI6A 5TDHA 4Q7KA 3ND8A 2ZSEA 3KUCA 2MMCA 3RRNA 4A6XA 4V0ME 1HH4A 2Z83A 3ND9A 1YRBA 1Q44A 3OEED 2CMKA 2BMEA 3KB2A 2J7KA 4D4JA 1LY1A 4HZIA 4YLGA 4CZ2A 4DCTA 2REBA 2X77A 2FZ4A 1VG8A 3U60B 3FB4A 4OJKA 1L8QA 2D4HA 2JDID 1GRNA 3B60A 3UG6A 2AX4A 5DI3A 4JLBA 4P4TA 3RABA 3W90A 5L3SB 2IS6A 4JLJA 2WKQA 3QVVA 4NCKA 1QBKC 5CDFA 4HZUB 3SQXA 4M9QA 3B2EA 1US8A 821PA 4UQOA 2Z6VA 1CULC 2QL6A 2O8DB 4FW9A 2QAJA 1LNZA 2F43B 2PMKA 3LBNA 1VCMA 3B85A 2OFWA 1KI2A 3OHMA 4ARZB 1NBMD 3LV8A 2ZRBA 1UEJA 1BMFD 1E69A 4JYCA 4N0DA 5DHFA 1DAKA 4WW0A 3W8RA 3TE6A 2GZHA 1VG0B 3KJGA 3QPWA 4A8JC 1DARA 4NCJA 4MDFA 2D2FA 621PA 2ZU6A 4I1OA 2VYFA 2OHFA 4MQBA 1COWD 4MUBA 1XFAA 3B9QA 1Z6YA 1NSTA 2CDNA 3R8CA 5FUXA 1DELA 1NBME 2QMHA 4Q1DA 1CIPA 1W44A 1XPRA 1NNEA 1G291 2W58A 4URWR 3REFA 2FU5C 4R71A 1IQPA 1G8PA 4M8NE 3GLHA 4CT5A 2IYRA 3TVDA 2FPMA 2HXSA 2RGXA 2HYDA 2P2LA 5LD2C 2EW1A 1RW4A 3CIOA 1DVRA 3EZ7A 2FH5B 2VHJA 1IN7A 3HYRA 5KSZA 2P65A 2F55A 1XMSA 2WWFA 2A78A 4BGDA 2H7VA 4HB3A 2WBLC 3T5GA 3BB3A 4C7OB 2BBOA 1DAMA 4G1UC 3RS7A 3K70B 1R2QA 1GNQA 4Z8XA 721PA 5EP4A 4Q9KA 4LBWA 1Y63A 1G3QA 2OCBA 4NYMQ 2RMKA 1CTQA 3SE0A 2WIAA 4U00A 2ZIAA 1J90A 2WJJA 3G82C 4HAVA 1ZIPA 2ATXA 2FSHA 3QKRA 4B44A 1N6NA 4QNRA 4PPNA 3QOFA 3RYTC 1FP6A 3KTAB 1AQYA 3ZZ0A 4PC6A 1A4RA 4B43A 4ZV4A 4Z8YA 1H65A 4I1UA 3T61A 2C2HA 4AYXA 4D0NA 2JJ1D 1WCV1 4JLAA 4OI1A 2HV8A 3U7HB 2H57A 1QHYA 3N5CA 2QG6A 1VTKA 4HLCA 4XJXA 4Q00A 3OEHA 4HB0A 1QDEA 3HU2A 4LYHA 2AD5A 2H18A 3QKTA 3B1VA 2GNOA 4POAA 4YXWA 4XVQA 4NL4H 1U8YA 2IEYA 4Q4AB 2ODWA 1X86B 1NVVR 2MSCB 5KTYA 3KQHA 3OFNA 2ZRAA 2AWNA 2DPXA 2J0SA 4LBVA 5FTMA 4XSHA 2QU8A 3HU3A 4WA7A 4C9BA 2ZR9A 1Z29A 4G5RA 3NTUA 4IVPA 2FSFA 3QXHA 4Q7LA 1XZQA 1G41A 2ZJ5A 5EZ5A 1FOEB 1ZNZA 1T3SA 4KJZA 2FFQA 2EQBA 1SVWA 1XTSA 5KDLA 3T34A 1ZVQA 2QORA 4Q9IA 4BFZA 1YHNA 3GCGA 1SVIA 3QBVA 4II7A 2WWIA 3WY9A 1G4AE 1N5KA 1XD9A 5BN5A 5K8LA 4OHYA 2YJTD 3OIUA 1WBBA 1YKSA 1IY2A 4LI0A 4ABYA 3O8DA 3ZIAD 3QKSA 3EPHA 1Z0KA 4HATA 5EE3A 2QAGC 5FR1A 4NH0A 3THXA 1UKYA 1T8TA 2HXYA 1OH7A 1K5DA 4HLUA 2L0XA 1JJ7A 2F6RA 4DRZA 2FPKA 1NLFA 3CX7A 3I3SR 3TJZA 1Z6XA 2B21A 3BXZA 3NWJA 4B35A 4OHXA 1G3UA 1TQ6A 2P5SA 4Q9JA 4B75A 2H5EA 1MV5A 1W0KD 5IF9A 1AGRA 4S2EA 4AY2A 3IGFA 3SS8A 1AKEA 1T3HA 2WPDA 2ATVA 1HE1C 1MO6A 4L5BA 3ADCA 4P4UA 4QGHA 3P4XA 1KHTA 5BYJA 2XX3A 1TQ2A 1XEFA 4IFBA 2QTHA 4B3DA 3UPUA 2HJGA 3W5JA 1GL6A 4LDJA 3GFOA 3HJNA 3TSOA 2O8EB 2VHTA 3PXGA 3QI2A 4UNRA 3I1FA 4LV8B 2KBEA 1YR7A 3VKHA 3LQRA 2Y8EA 3QEJA 4QG7A 4LJYA 5B2ZA 2GVZC 2X2FA 3GLHE 5HKKA 1M7HA 2ZRFA 3M4YA 1W36B 4B3GA 4A2PA 4AKIA 2QN6A 5B64A 1QHSA 1SVKA 1M34E 4LC1A 1DE0A 3B13B 3PR1A 5TB5A 4HLUC 4EFMA 4DLYA 4JSYA 2R8RA 4TL8A 1D9ZA 4PTLA 2CJWB 1S2MA 3TRFA 1PUJA 2Z4SA 2V7QD 4QM6A 1G8GA 4RZ2A 4V0KA 4C7OA 2GDJA 5AJYA 2PLFA 2OCPA 1DG1G 5L3QB 3THXB 2OAP1 5DHAA 2RGDA 4BLSA 4X8MA 5CIWA 1IN5A 1NG1A 3EIQA 3H4MA 4QHSA 2VHUA 5FTKA 3CH5A 4F4JA 3TVTA 3GLIE 4FMBB 4CEJB 2R6CA 1CEEA 1M7BA 4NYMR 1EFCA 4B33A 1E2HA 1GL9B 2PEZA 5H8WA 3TAUA 1K5GA 2ZRNA 4LBZA 2ZJZA 3EX7C 3FOZA 4OK5A 1W0KA 4A15A 1E2PA 3IHWA 3RRMA 3KQNA 3ZZUA 1X8KA 2HCBA 1A7JA 2J41A 2B7BA 4F92B 4DCVA 3E1SA 2W2TA 4QBFA 1U9IC 4M1KA 2JIZD 4OQXA 3EG5A 2PMDA 1P2UA 5AR1A 4A0FA 2WSSD 1OXTA 3J81k 4DSNA 4PQFA 5K8TA 3BH0A 2WM9B 1QHXA 2LWIA 4S35A 1IXZA 3QENA 4XD7D 5C4GB 2PT7A 2IWRA 3NIBA 3RWMB 2FE4A 1UF9A 2AL7A 3NEJA 3LA6A 2RB4A 4Q1EA 4ZIRB 4V02A 1E2JA 2GXQA 3TKLA 4MKHA 1NVVQ 5FTJA 4PO9A 1ZMXA 3R9XA 3OEEA 1ZM9A 3TBKA 2IUUA 1F2TA 4QGAA 3PUZA 4ZPXA 3GFTA 5P21A 4HUQA 4N3NA 1N0VC 2DFTA 1F2UB 1GSIA 4P3YA 4QOSA 1G9XA 1SGWA 1TF2A 2P6UA 4BLTA 1VDZA 5GJCA 4R9UC 4F7WA 3BH7A 4Q4JA 1GAJA 2DR3A 2WJYA 2CL0X 3SI7A 3CO5A 1M6NA 1X3SA 5EP3A 4TSFD 3THWA 4GI7A 2QMOA 3AUXA 1CR1A 1UDXA 2UKDA 2VHQA 3QF4B 1AS3A 5EQTA 1KDRA 3LH5A 3FKSA 1TX4B 3FVQA 3WYAA 2ZYTX 1JECA 4HB4A 3TGPA 5KO2A 1IXRC 1CR2A 5IK2D 2G6BA 3PITA 4GT1A 1Q20A 1I2DA 2IS1A 5EUQB 1ZYUA 5J4LA 3VU9A 2ZE8A 1XF9A 2XEXA 1ZAKA 3AP3A 2VO1A 2IS4A 1QF9A 3A1VA 1XCMA 2N46A 4MRPA 2ZRIA 2V3CC 2JLSA 4KLNA 3R7WA 3TR0A 5DH9A 3PJRA 4AKHA 3R9IA 1GG2A 4ON9A 5CK5A 1E2EA 3D8BA 3K70D 3HWSA 2QQ0A 3GD7A 3T1VA 3W6OA 4BWYA 2QENA 1W36C 5J4VA 2D7DA 1QHNA 4FI3C 5G41A 1CJKC 4TSFA 4JSTA 3GLFA 3NBZC 2F1HA 1GKYA 4JKIA 4JVMA 4TQ9A 3CWZA 2G83A 4O2LA 2C03A 1KI6B 3O47A 1MO5A 4FINA 4Q18A 3SYNA 3ZQJA 5JMTA 2ZRKA 2WWYA 2GEDA 3FKSD 1BYIA 3I4LA 1XBTA 4L9SA 2AN9A 1PV4A 2NO0A 1GM5A 1GKUB 3B5JA 2FSGA 3B78A 2ORWA 3K0FB 4OQMA 4L15A 4IDNA 4EJSA 4B2IA 3FFBA 5HCNA 4LY6A 3KDSE 2ZYUX 2CCGA 3WBJA 4QJ3A 4J0QA 5H1YA 4CEHB 5FH9A 1XEWY 2I4IA 4JYBA 4LJ8A 3A4MA 4G5GA 5FTLA 1EESA 2FN4A 5TARA 4P4SA 2QRNA 3IO3A 3U2QA 3EW9A 1OXSC 3FMIA 4YMUA 4NE2A 2BV3A 3ASZA 1II8A 1MO4A 1P9RA 1G16A 2F7SA 3B1ZA 5IHPA 2PLRA 4I4LA 3A6PC 2FV8A 1US8B 1JEDA 2RGCA 2ZRDA 4AKGA 5BQ5A 3A58B 4FIDA 3UG7A 3QEOA 5B58C 4C2UA 4D25A 1U0JA 3CF0A 2P0EA 4CEJA 2HYIC 1FUUA 1KK0A 2IBMA 1TAGA 2REXB 4XD7A 4FMCB 2YHSA 3O8BA 2F1RA 3PUYA 3CH4B 2OG2A 4Q1BA 3SJAA 2QT1A 2AXPA 3X1ZA 2OLJA 4DWJA 1JR6A 1GTVA 3B9PA 4GBMA 3UANA 4TMTA 4BLRA 3R7WB 1KY2A 3SFZA 3DEFA 1E2DA 2YNMA 1TU4A 4IOLA 3ASYA 1ZD1A 4OI0A 1QG4A 2VA8A 4PAQA 3AEZA 4MKFA 5AK0A 4DT1B 4CF7A 2ONJA 4WZ6A 5SZIA 3OEHD 2GXUA 2ZU0C 2OFOA 1XZPA 2D2EA 3HPRA 2KWIA 4XH9B 1NG9A 3RNLA 1U0LA 3DOFA 2ZRGA 4AK9A 2F9LA 1P60A 5FUWA 3TH5A 3LXRA 4LRWA 5KDDA 3GLGA 1QHHB 5SZJA 4XWKA 2G1KA 5E7IA 5BXQC 4DLZA 2HCJB 2HLDD 1TUIA 4JIMA 2GEUA 5L3QA 2BJWA 4KYIB 3VTKA 3VX4A 2FFBA 4KVGA 4RD1A 1FNMA 1DEKA 4AYTA 2QBYA 2Z43A 4MRRA 4EPYA 3BB1A 1TEXA 1BYUA 3W3AA 5LD2B 2EFHB 4EDHA 3WMFA 1RVDA 2R65A 3WRXC 4C3ZA 1RKBA 1KI4A 1NN0A 2VTKA 2XOKA 1NN1A 4QNMA 1YZLA 5GADl 2J7PD 3IQWA 2FZLA 2QT0A 1HUQA 3Q5EA 2C95A 1MABA 1E2KA 1P2SA 1VYVA 1Z47A 1S0UA 2IYTA 2J45A 2ZSDA 4HAWA 2VP4A 4JLKA 3EZ2A 3P27A 3OE7A 1QG2A 2G1JA 1N6RA 2W6IA 1FMLA 1JR3E 3C41J 1I4TD 2NO9A 4KHZA 4DLTA 3SBDA 5K8IA 2SHKA 4AD8A 4DLWA 2RGGA 4WXPA 1NJGA 3Q8XB 3KQUA 3E2IA 1Z5ZA 1QRAA 4RKFA 1AZTA 2MSEB 2AFIE 5H68A 1G1MA 4EPVA 5J5CA 1ZUNB 2IF2A 2NO6A 3ZVRA 2WAYA 4MYTA 4EPTA 4O25A 2D3WA 1RE0A 2RGAA 4RSGA 3B1WA 3SBEA 4PAOA 4H1VA 1IONA 5E7MA 1KI9A 1KMQA 3O8RA 4ASUA 3MGCA 3VR5A 5GJBA 2YKGA 1IXSB 1CRQA 2CBZA 3FHTA 3FE2A 2PJZA 3BS4A 3OESA 3A1TA 3PEYA 5TXGA 3A36A 4EFLA 3DM9B 4HDQB 3C14C 2D7CA 4LJAA 2LCFA 221PA 2GCOA 2IYQA 1DPFA 1FZQA 2A5FA 4N0EA 2BMDA 2PJRA 1M74A 5E95A 2R44A 1VYUA 3EA0A 1Q0UA 3KX2A 1N3BA 4B2PA 2UZIR 4HUTA 1P72A 4Y0VA 1GDDA 2CK3D 3L82B 3IPYA 4Z1MD 3PUXA 3SNHA 1ZIOA 1KMHA 2Q21A 3ZH9B 2GXAA 1PJRA 1EFHA 1F3OA 1OXVA 1SKYB 5KSOA 2ZRCA 2AKAB 4MUAA 5DYIA 1N6PA 2OZEA 3GJ6A 5FUVA 3EPKA 1CP2A 2V7QA 2ZJAA 4Q47A 4AYWA 4DDVA 4MYHA 2R6FA 4JVSB 4MKIA 2QSYA 1T5LA 3CX6A 5AUQA 2A5YB 1IBRA 2IHBA 1UJ2A 1L7VC 1T6NA 2QM8A 4B74A 1UAAA 3KKNA 5KNCA 4JLPA 1CLUA 2RGBA 2VRWA 3MFYA 4DIEA 2JLXA 1D5CA 2C96A 5JWHA 5LBIA 3G0HA 1E1QD 1SXJB 1TNDA 1U98A 2CLSA 1OJLA 3FYHA 1NJFA 2GRJA 1WP9A 1JNYA 1ZM4A 2ODBA 3IIMA 4UXIA 5EE9A 5BN4A 2PBRA 2BKEA 3CR7A 4ZDWA 4DLVA 2JJ2D 2RGNA 4Q5IA 1E0JA 4CGZA 1UM8A 5AUOB 2GA8A 3KFXA 1XMVA 5GVRA 2FWRA 4JL5A 4UNSA 3SYKA 1QHGA 3RDPA 1G7TA 1KJZA 2ZVPX 3AH8A 4LPSA 2LKCA 3BFVA 5HZHA 1RIFA 2XITA 4YMTA 1NMXA 4KU4A 5K8UA 4QGGA 2AXNA 2WKRA 4NCIA 3K9GA 3KXKA 3MAAC 4GOJA 5UKDA 2J5XA 3OIVA 3NDBB 3ZZTA 1O87A 4F4CA 3IPXA 3QXSA 1KJYA 5JI2E 4I1VA 3CBQA 2DYKA 1VYTA 2ZUDA 5FUYA 3AF2A 2CHQA 4DDTA 2EWVA 4IW3B 5GJVC 4KBFA 3Q72A 2A9KA 1G7RA 2QP4A 2W6JD 4DEYA 5CB8A 3ADDA 1E96A 3QPUA 4RD0A 5JSZA 2PZEA 1KYIA 5SZHB 2ZPTX 3CZPA 1RZ3A 1IM2A 1S4QA 2ZE6A 2R9VA 3MUFA 3RHFA 1YZKA 4A6PA 3ZJYA 4KSBA 2RCNA 4JL8A 3LBIA 4HI0E 3U5ZB 2WICA 4DKXA 1S1CA 1MRSA 1Q12A 5BW8A 3RS0A 4KFTA 5C4MA 1E98A 3RVBA 4M22A 5FI1B 5EE0A 3NH9A 3UMSA 1I4DD 4M9ZA 2BCGY 1LS1A 4MA4A 3MJRA 1L4YA 4PC3A 1XWIA 1XJQA 3MMPA 1XNJA 2E9SA 2R6GA 3KTAA 2QE7A 4CRWB 1LTQA 4GOKA 2C9OA 1KY3A 4KCGA 4NU0A 1HE8B 3U3KA 1AQUA 2V1XA 3CKLA 3QKRB 4G0NA 3PENA 1F5NA 1HURA 2XZPA 1EWQA 1X8LA 1N0UA 2ANCA 4RY2A 1VIYA 5GJWC 2BBSA 2JDIA 4GNKA 2QTVB 1X6VA 3I73A 3NHAA 3S1AA 4DLRA 3C8UA 1OW3B 4ARZA 1GP2A 2ZJOA 2XJ9A 2XTNA 2XGJA 1S1MA 3VNVA 1G4UR 1NN3A 1P73A 4NYIR 2IYYA 3NVAA 5L3RA 1K8RA 1DTSA 1YZNA 2HJVA 2WWGA 2BMFA 4OQLA 1FL9A 4LHWA 1KK2A 3REGA 2RHMA 2GF9A 1OIVA 3NEYA 1P5ZB 4D6PA 4D81A 2QI9C 2J3EA 2H16A 2HF9A 4IDQA 4JT4A 1OXUA 2B6HA 1RRCA 2ZTSA 3D6TB 1N6OA 2GJ9A 2RAPA 2ORIA 1W7AA 3MSXA 2ZYWX 5JCPA 4Q9LA 3KQLA 1TU3A 1UBGA 1CBUA 5AUNB 1HV8A 2QY9A 2FEOA 2FGKA 4M9XA 3FGNA 2CLDX 4M1MA 4HB2A 3P26A 2IT1A 2VP5A 4NONA 5G40A 2ECKA 4D80A 3DKPA 1JXOA 3P1JA 3DVLA 4LJ6A 1AS2A 1OYYA 1YRAA 1S8FA 2BOVA 2GCPA 3SOPA 1U90A 2ZI9A 3EAQA 2J0VA 1G5PA 1Z6GA 4C30A 4PX9A 3A1UA 2W83A 1KI6A 1U8AA 3K0AA 4BASA 2OUKA 1I4LD 1M8PA 4JLOA 3W8NA 2UVQA 1SVOA 1YR8A 3LQQA 5TV2A 3K53A 3GP8A 2PH1A 1EFRA 1E2GA 1JPNA 3K0EA 3MWLA 3DMDA 3TSWA 4WZBE 1XMIA 4TLEA 5C2JB 4M9SA 1Z6TA 4B73A 1BOFA 3ZDQA 2DWOA 1JAHA 4B71A 2KI5A 2NZJA 4XOIA 5JJLA 2BC9A 4NCHA 1ZRHA 1EXMA 1GZSA 2VP2A 2WSMA 2VP6A 2ZETA 4BECA 2O0HA 3AVQA 3MD0A 3W34A 4ACAA 2NGRA 3LBHA 2ASEA 3F3YA 4W5JA 2JLQA 5IDVA 1E2IA 2JJ8A 2WJVA 2ZITA 1RYFA 3VNUA 1F60A 3SN6A 4L16A 3QY0A 5CLQA 3VX3A 1OFHA 2KSQA 4Q48A 3CONA 1Z8FA 3OZXA 3TK1A 5B57C 2NTYC 1ZNXA 3LD9A 3BFKA 4OHZA 2IX3A 2GK6A 3TUJC 1VIAA 3L43A 5J47A 1GRRA 1NN5A 4DEXA 2QZ4A 3U7GA 3LX5A 2XXAB 1AJEA 2PX0A 3AVUA 4BLOA 4QKQA 4B3FX 1T9HA 4HUQB 3H84A 3IIKA 4EKDA 2REOA 5LB2A 1QVRA 5FOXA 4BZQA 3Q85A 3ZGXA 4Z54A 3VAAA 1XD2B 3U7EB 3W6PA 5CDFE 4UNQA 5EE5B 3V4FA 1TL7C 3MG9A 2YWFA 2IA5A 3GMTA 3VFDA 1ZUIA 4PANA 4IRUB 4WXRA 5D3QA 4W5WA 3VR2A 2P5TB 1GL7A 1FUKA 2IEZA 4JLDA 4W5HA 5TVKA 3LRPA 5JJIA 5JBQA 2ZJ2A 1C9KA 4XWAA 2H1LA 4C0BA 4QM7A 4XTCS 4YMWA 3EZ9A 3VKWA 2O8FB 2O8BB 4DLUA 4PZYA 1NKSA 3S1AB 3LVQE 1G7CA 4LHZA 4IJMA 2IXGA 1E2FA 2I1VB 1DAGA 1S9DA 4LPKA 1RRPA 1TF7A 2GVDC 5LB4A 2F3RA 2J1LA 3QXJA 1IN4A 2V6IA 3LW8A 4C4PA 1NLYA 3HPQA 1E9CA 1F2UA 4JBYA 4Z51A 1JALA 3IEUA 3L0SA 2GK7A 2AK2A 3KJEA 5E4FA 1VHLA 3SDZA 1G21E 2EVWX 4EIWA 5J40A 3L8YA 3KXIA 1Q57A 4TMWA 2KJQA 2CNWA 1NLZA 4HDCA 1GNRA 1ZW6A 2JAQA 1TF5A 2XSZD 5HE9A 5A0FA 1J8YF 1T3LA 5E7JA 3RLFA 3O8CA 1LF0A 3HDTA 4B6EA 4B3XA 4GFDA 4JBXA 2F1IA 4OQNA 3CW2A 1D2MA 4ITRC 2B8TA 1Q22A 1XDBA 4IDOA 4TMKA 4TT3A 3TUZC 4P0TA 1N6HA 3AVOA 1KJWA 2DFLA 4FMDB 1U81A 4RCYA 1EG7A 1XXHE 2OE2A 2Q3FA 4BQSA 3ADKA 3SEAA 1WB9A 3EZFA 4V03A 3HU1A 1ESNA 2FJUA 3FHCB 1ELOA 3BD9A 2WZQA 1RRGA 1E79A 1II8B 1LF5A 5JRZA 4IVQA 2QPAA 3SYLA 4P33A 1JI0A 4PHGA 2Z4RA 3NBYC 3SQWA 1E1RD 4QHYA 3E70C 1KIMA 1KZGB 3ZVLA 2YV5A 4TLBA 2JA1A 3QF4A 1R5NA 2XSZA 3EXAA 4DDWA 1W48A 4YMVA 1R0ZA 4IEEA 1WBDA 4MITA 2V8OA 3U4QB 3QVUA 1P75A 4UNNA 4BLQA 3AUYA 4OHVA 5DYGA 4BRWA 4ZCMA 4ZCIA 2W0MA 3FDIA 4FMDF 5AJZA 5EE1A 2XNDD 3PV0A 4TQUS 3RS5A 1CRPA 2YOGA 2JJ2A 2BBWA 5KYKA 3AV0B 5DN6A 4EFNA 5F2EA 1L2TA 2AKYA 3U44B 2JATA 3UATA 1FQJA 4XWOA 1B23P 4EJSC 1P7CA 2JGNA 4ILEA 4EPRA 2YOHA 4BPBA 4WVFA 3V00A 1WF3A 1Z0AA 4V0LA 2CCJA 4ZDIA 4EJSB 1N6IA 1V43A 2WMNB 2ZS9A 2NO1A 3CRMA 1ZC4A 1XTQA 2JCSA 3DOEA 3AP2A 4HAUA 1FNNA 4YC7A 5DIFA 2J0QA 4A0RA 4URVR 4XTRA 1G5TA 2I3BA 1P6XA 1OXXK 2QROA 3IBGA 3P20A 3PUVA 4AWXA 2IS2A 4IFEA 4HDOB 4EUNA 4Q02A 2CEAA 1R10A 3V9PA 2FF7A 2CLCX 3K0CC 1W4BA 1P61B 2QAGA 2RGEA 4LYJA 4B2LA 1J2JA 1IY1A 2QA5A 4ZIRA 3VR4A 3IQXA 1E0SA 4GDFA 4YQFA 1G5RA 1P2TA 1U94A 1XD8A 2ZQ5A 1E9EA 3LWNA 4HZUA 4PC7A 1XPUA 2AFHE 4NTZA 2ZI4A 4NYJR 1JQJC 5DNYB 4M21A 2ZUCA 3H86A 3B6EA 3IEVA 1SXJC 4CEIA 1Z0DA 2OEPA 4H1UA 2BDTA 4JZKA 4TYPA 2ZAOA 4BRUA 1E1RA 5CJPA 5JLJA 3N2EA 3AGPA 3ONWA 5CK4A 1CJVC 5FPTA 4NYIQ 2YZ2A 1H8EA 2IHYA 5JRJA 1KDTA 4G5OA 4MGIR 1OH5A 1G64A 1W4AA 2G0TA 4URYR 3X1YA 2BIFA 1ODFA 3K09C 1ZNYA 2EFDB 2QM7A 4LJ9A 2WJGA 4LC0A 1TTTA 3A37A 4A9AA 1FP7A 4V0MA 5JCZA 4GP6A 2ZAMA 4GSYA 1C4OA 2GILA 2ZJYA 4IKEA 1NIJA 1CS4C 3T1QA 2BEKA 2AWOA 1OIXA 4HAYA 3TLXA 1GKIA 1W47A 2ZANA 2QGZA 2YC4C 4Q1FA 4NZYA 4MDEA 4JVNA 3EWAA 4LV6A 3A8TA 4FCWA 3OIYA 5G3ZA 2NMVA 2XB2A 4TMZA 1E79D 1VMAA 3F0TA 3LAWA 4JBWA 1OB5A 5F3WB 1Z3IX 3U7FB 1W46A 1Z2CA 3FHOA 1XB2A 1Z0FA 2GXSA 1DS6A 4PAMA 2GJSA 4TLCA 3KKQA 1IN8A 4WBSA 2WHXA 4MYCA 4TT3D 2BBTA 5TMPA 4PZLA 1JBKA 2WVJA 1JJVA 2DFKB 3GPLA 4QJ5A 2F1JA 4LX0A 3CNNA 2GCNA 4RD4A 2D06A 1W1WA 1W0JD 3LO5A 3IUYA 4QGFA 1HA3A 3THYA 2K5UA 1N5LA 2GAOA 2ZI5A 4HAXA 1CJTC 1DAHA 2ZXUA 4IOJA 3I5YA 2VL7A 4LHVA 1KDOA 1KMHB 2LKDA 1AS0A 3ICQB 4DDUA 2WWHA 1H8HA 3SC3A 2KB0A 1YR9A 1G20E 3JVUA 2QEQA 3CM0A 1Z28A 2CE2X 2DBYA 2WOJA 1RRFA 4B76A 3UMRA 1KAOA 3RSOA 2XXAA 4E5UA 2RGNC 1KK1A 2Q9BA 3CUEF 3CPHA 4QRHA 2JASA 2W6JA 1B0UA 4JLVA 1TUEA 3AVWA 4WZAE 3AB3A 4GZLA 4X8LA 3BOSA 5DN6D 4Q19A 1N0WA 4U7DA 2HUPA 1PZNA 1KSJA 4OKSA 4RVCA 1OH8A 5M04A 4MKGA 2VLIA 4RCZA 2FA9A 1KSGA 5JWOA 1A1VA 4GZMA 2QMEA 3ZVMA 3DKVA 1LFDB 1SHKA 1Q1ZA 2ZRHA 3GJ0A 3F5FA 4Y0AA 4XIGS 1MT0A 5FL7A 4DLSA 1X1SA 4Q1CA 1II0A 2FSIA 4QJ4A 2P6RA 4UXHA 4US1R 1ESMA 2V4ZA 3H0KA 2XAUA 4KBGA 1J70A 1J8MF 3BC1A 5FOWA 4TQAA 4DJTA 2VP9A 2O8DA 1Z83A 2YYZA 4FN5A 3KKPA 2VQSA 1VHTA 5DISB 4Q9HA 3AF3A 3TIFA 1JXMA 1ANKA 4RFSB 3VHLB 1EWRA 2JJ1A 1KDPA 2NIPA 2FPLA 1IOZA 3A4LA 5IK2A 3L2OB 3THOA 2YVUA 4PC2A 2JLRA 4QHTA 3SJBA 4DLXA 3SJZA 4R7ZA 3WYGA 4G3XA 5DE3A 1E2QA 421PA 4ASUD 4EPXA 2YWHA 1HQYE 2ZYVX 3CNOA 4KFSA 3PIRA 2MMGA 1GIAA 2ERXA 2QTFA 4JMPA 4JS0A 2GAAA 2D74A 2WIBA 3KKMA 1CR4A 1E9BA 4KLZA 4LHYA 1YQTA 1OKKD 4LUCA 1Q1EA 3OAAD 3GJ4A 3DL0A 3UIEA 4ZKDA 5G3YA 2GEVA 4EQ6B 3GJ3A 1G3IA 1W49A 3QG5A 3ZLJA 1A2BA 2ZJ8A 2G0NA 3W5IA 5LPNA 3BJIC 2IYWA 2B92A 4DIDA 3OIWA 3NC1C 2ZSBA 3DM5A 5C18A 5L3VA 1AN0A 1FMJA 1EX7A 3GQBA 4D0LB 3I62A 3D3QA 4DSUA 2WJHA 3R9WA 4TN1A 2GZDA 2X8AA 2ODEA 1XXHA 4QXAA 1OFIA 2PCLA 1JB1A 3QKUA 1UBEA 3UXMA 1HY3A 6Q21A 3ZIAA 4I81A 1KNQA 2EWWA 1NY5A 2ZI3A 3T12A 3FKQA 2IXFA 5HE8A 3TQFA 4ZDJA 5JEDA 2QMUA 1W5SA 3T06B 1UKVY 1T0HB 2J59A 3PG5A 3TW8B 2DCUA 4GMDA 3SHFA 4YONB 1KSHA 5KU1A 5EXTA 3MLEA 1NSFA 2PEYA 3BAFA 1T8UA 4R2HA 1SHZA 1L4UA 2IK8A 1NL3A 1CKEA 3VU9B 1MKYA 3MWJA 3IHLA 3C16C 2EYQA 4V0OA 2IXEA 1Z08A 2OO7A 2X19A 3B1XA 2BEJA 4KFUA 4ERNA 1H8HD 1G7SA 3X1WA 4C2TA 4JVLA 4KSCA 2GHIA 2IF0A 3CF2A 4DBLC 5FBVB 1XRJA 3ZVNA 4DXAA 1MABB 3K9NA 3FMPB 3DMNA 2C77A 3B1YA 4Q4LA 1FX0B 4TL6A 4TYWA 5FPKA 1TQDA 1XTKA 1HYQA 4BZPA 4BFTA 5CM8B 4N1AA 3CZQA 3WNDA 1W5TA 1OSNA 5IT5A 2FFAA 4M1SA 1H8ED 1CXZA 4ESHA 5HKKD 1P62B 3EWSA 1VG1A 3A1WA 3RRZA 1RJ9A 2IYUA 1O3YA 3LX8A 1R0WA 3I5XA 2GF0A 3F8TA 3BWDD 3Q7PA 2DFNA 1TEVA 3KJHA 5HZKA 4QBGB 1XJ0A 1XTRA 1UFQA 1Y3AA 3K0FA 4IEIA 1D2NA 5JECA 3BK7A 3AM1A 3LY5A 1PUIA 4OJQA 2NPFA 2A7QA 4X8OA 3RAPR 4X8HA 1KK3A 2A3RA 1XCPA 4MGKR 4QBIA 2GTPA 3PUWA 5FPHA 8OHMA 4MH0R 1SVSA 5GVSA 1G17A 4A0HA 4BEJA 121PA 1XEXB 3THYB 3QQ5A 1F6BA 1V5WA 1EFUA 1G3MA 2WJIA 2CHGA 5C46F 3IO5A 2CE7A 1NP6A 4TL7A 1WXQA 3QKSB 4M53A 4HAZA 3KFVA 4LJ7A 2G3YA 2Q0HA 1LS6A 4BEBA 1IAQA 1IJFA 1E3MA 4IXMA 2VHCA 1AZSC 2ZS8A 3DHWC 2QPOA 1ZJ6A 3VMFA 4AKEA 4QBHA 5EJEA 4PSAA 4TMXA 4CIDA 3WMEA 2V55B 4Q7MB 4B32A 5E3HA 1TADA 2QAGB 2FFHA 1UEIA 4LJ5A 2FOLA 4M2LA 1RPZA 2JLWA 2GZAA 3CNLA 3QSYA 3LNCA 5KDOA 1U9IA 4M1OA 3C5HA 4ZI2A 3VQTA 1WE2A 2CVHA 3GJ8A 4LGMA 3K09A 3BERA 1AIPA 3U6KA 1NBMA 1NVUQ 2EFEB 2CJWA 1S3SA 1WA5A 2OFXA 1N5IA 2NQ2C 1R0YA 4CYMA 1RFLA 2CNWD 1WRBA 4W7SA 1HT2E 4TLAA 2IUSA 1E2MA 1XX6A 1R8SA 1NF3A 1YJ5A 1YZTA 4JT2A 2OV2A 1D9XA 2RKOA 1EFTA 4L9WA 2I1QA 2P67A 1ONBA 3WP1B 1QZXA 1A2KC 1E99A 1BO6A 4LK2A 4WIAA 3K0AB 3JZAA 4ZKEA 3RRYA 3B8HA 4OK3A 4DB2A 2V54A 4KVAA 1FX0A 1HT1E 4Q21A 4LZZA 4D0GA 5JS8A 4OYHA 2ZM5A 4AI6A 4JL6A
chains in the Genus database with same CATH superfamily
1KH3A 4FDLA 1FFHA 5AJWA 5FAQA 2FPPA 4RPGA 1RYEA 4NE9A 3MJSA 3VE4A 4L2IB 2FEMA 1KSFX 4WE3A 4JLMA 4DL9A 2FRDA 3QI7A 1S6RA 3UN1A 5IBPA 3IOMA 4DR4B 2R2AA 1LJUA 5IXJA 3P32A 1S3GA 3ZHCA 2I1LA 3LLUA 3K73O 1T0JB 2ISSD 3D0RA 1ECLA 3JQDA 3MT7A 2GZ2A 3QVMA 4HLQB 4BP8A 2BCEA 2O5VA 3ISVA 5FFFA 1CETA 3PXAA 5H82A 2ZSFA 5NULA 2V5UA 4RJTA 1OB2A 1PV2A 2ZBPA 5AIBA 3LIBA 5FCDA 1QIFA 5IHXA 4B3JA 1Y0BA 4C3UA 1V4VA 4YV1A 3OCWA 3H65A 4R98A 3RR2A 4L5JA 4U3JB 1PVOA 2Z5FA 4NR0A 4M7OA 2PD6A 5C8XA 1ZMBA 3NDPA 2H7CA 4ZAYA 5KB3A 2BMJA 4IQFA 5DX1A 5BOSA 1KS9A 1XVLA 1YZQA 1MENA 4QPZA 4QTYA 3SIWA 4FSDA 4JUCA 5HFOA 2AI2A 1L6RA 3JX9A 4R40A 1V3VA 1LGYA 5B6JA 1TK9A 4LXQA 1APBA 4A5RA 3PVCA 1WR8A 1W8QA 2HDSA 1KO7A 5G18A 5DM0A 5EXPA 2F64A 1Q1QA 1P0ZA 1TVKB 5LBTA 1TC1A 2JKFA 1U0NA 2WYWA 3MKEA 3B53X 4PR0A 3D6FA 4PZZA 4YK7A 5FIUA 4FCTA 3TLGB 4R9SA 3GZNA 4PAWA 3T15A 4RVDA 5KYVA 1U31A 3J7AC 3PTAA 1OD6A 5AKYA 3H1PA 1PVVA 4YWJA 2OHJA 4G5HA 4C6SA 3RYCA 2NPIA 5K0LA 3K0CA 1NRIA 1DMSA 3PUIA 3SJCA 3GRFA 1DBQA 1MPLA 1U1FA 3LXMA 3GL9A 3MRSA 3DR5A 3AKCA 5IHVA 5EC8A 5FP0A 3EC1A 3SXPA 5ICMA 1N2CE 5A3SA 4DXHA 3N0RA 1NW4A 2QYTA 2VEAA 4MZDA 5H4HA 5KC8A 3NP7A 2W8BB 1BDBA 1XRPA 2EU8A 3GEEA 1ZD9A 2ZE7A 2F9MA 1K4FA 1E5DA 3KU1A 3N8NA 3TRKA 1XJCA 1PLJA 4MDZA 1T5IA 5LN1A 3FYDA 2BM0A 2AMFA 4EBPA 3U1TA 4XDZA 2XZTA 3QE0A 5JJCA 5K05A 4HGRA 4YDHB 5C31A 5LU9A 3I6IA 2REQA 4G8CA 1H0MA 1VB6A 1NM5C 4A8JB 2JJYA 1ZM2A 2R6AA 1ST3A 4PYKA 5C1BA 5CT8A 5JAHA 4J3FA 2X2EA 3M9LA 4R5MA 1T8YA 2WVAA 4XGKA 2JBHA 4DQDA 1D6JA 4W7IA 2ZJBA 1UC4B 2C3YA 1EE9A 1K68A 2B2XA 2CK3A 2HT6A 4KK3A 1N2HA 5DLYA 4F4DA 2AJCA 4NG2A 3E3LA 4M9CA 4EX6A 1KVUA 1DX6A 2EIHA 2YL2A 2ZDHA 2BTQB 3AVPA 1Y6RA 1YQXA 4IVIA 3AHFA 3E3AA 4Q6BA 1E64A 4E09A 3OTOB 4EZIA 2D13A 4RKEA 4MMXB 1IN1A 2FW9A 3SEFA 1GVNB 1LRJA 1HBJA 2Y1OA 4H1TA 1RXCA 2TYSB 3ZYCA 2XZLA 1PRQA 4LXXA 3IF6A 1JPJA 4QUBA 5ISMA 3TQCA 1DG9A 2C98A 3X1XA 4IJVA 5ER9A 1KYQA 4UHKA 4FMCF 3ZZMA 1O4WA 2IV2X 2VSQA 2WHYA 2D59A 4NOKA 3EF1A 3I04M 4AG6A 5K5EA 3K3CA 1CJMA 4BRZA 4GZBA 3G13A 3GDOA 4HQKA 4IF4A 1V9LA 1Z7BA 3PD0A 3PEFA 3HB1A 4RDCA 1XKQA 4NXMB 1NOKA 1HQCA 3F1OB 1OREA 1FFXA 4QXQA 5DJUA 2H51A 3PDIA 5TPZD 3GR6A 1H8YA 4OBEA 1T2VA 2ADOA 2GZMA 1JHUA 4LX8A 2BGIA 2XUGA 4RJJA 3I30X 4XYEA 2X8BA 1XEXA 5HIMA 1JQBA 3I8OA 4EA8A 4DB4A 3VHQA 1H2ZA 2R00C 3AL0C 4JXZA 3UFXA 1E6WA 2EFCB 5J59A 1HL7A 3AGEA 4B6OA 2SCUB 4ZJZA 2HJHA 4MGYR 1I3MA 3K6SB 1TMOA 3OCUA 3MJHA 3NTOA 4GEKA 4POOA 4WVLA 4XLZA 1X7ZB 2GYWA 3EXG1 4QDKA 5K4GA 2CWDA 3I1IA 3Q6IA 4MB6A 1G8HA 5AW8A 1T4GA 1VCNA 5EA2A 5ESRA 4BMYA 5BVGB 2X8JA 1UDWA 3BZUA 1JLKA 1DY6A 3VR4H 3HL9A 2B0CA 2GJ8A 3A1SA 4IKOA 5FFMA 1PGJA 1II9A 1TK2A 3CSSA 1TTQB 3NM5A 3A3PA 2H92A 2H4JA 2NOAA 1EDBA 5BOVA 4B3RB 3ILYA 5AYVA 3HFGA 3JRNA 4PZ9A 5JS7A 2V8FA 3CRQA 3OC2A 1S96A 1OV4A 1NRXA 2QP3A 2GTIA 2RCYA 3I92A 4JBLA 1VECA 1IM5A 4X5OA 3UHAA 5JYDA 1RC8A 1XZCA 1M1YE 2WPDD 4IQGA 2Q1SA 2YZKA 1GWNA 3PRJA 4FUWA 1ACJA 1X1DA 3CRVA 4I9HA 5JFGA 1ML3A 4J7UA 2XTZA 4ID4A 3DUFA 5AW6A 1SU8A 4OXRA 3BIFA 3UKDA 2Y2GA 3DT6A 3D31A 3WV4A 1YDMA 2RHRA 4ND3A 4YAKA 2FRDC 3LFUA 5ALLA 3WOHA 5AM3A 3O4JA 5F1PA 1ISPA 3KYBA 3VHXA 2O2JA 5E1OA 5ITSA 3R2JA 4HQLA 5KEIA 1QF6A 2RB5A 2XRMA 3FNBA 4D56A 2ISQA 4M60A 2XNSA 3L49A 4KMOA 5CT4A 3KSGA 3MRXA 3U3ZA 1KQFA 1V5EA 3EIEA 2R1TA 3NHUA 1IELA 3QLJA 1CNEA 1J24A 3DOJA 1LI5A 1LVGA 3FMOB 3WLNA 3Q2IA 2FZEA 2L17A 2PA0A 3RWOA 5FYQA 4PG8A 2F1OA 3BWBA 2PO5A 1YE5A 3ANYB 1KORA 2BWJA 1SUWA 2IUTA 4YFVA 2Q3HA 2GB4A 2O7QA 4KYVA 3P09A 1PDWA 3MZDA 3EXG2 4JLFA 2PVSA 1R4ZA 3PFIA 5GGXA 1F0KA 5T4FA 5H80A 1FYWA 1GDTA 1GFIA 2HGZA 2OSBA 4LCEA 1Z39A 4RESA 3IP1A 3R6DA 3IVMA 4LRQA 4NFLA 2VJPA 3I12A 3LGXA 2JLYA 1KGDA 1E32A 2FQXA 1KVLA 1CK4A 1GRQA 1W6RA 4RL4A 5D7BA 2VJNA 3ESZA 3PF8A 3H82B 5CGSA 3G23A 1MNQA 2Z4TA 4ZOQI 3R9XB 4BN0A 3TW4A 2FG5A 3I8XA 3VR6A 1YQQA 5B7PA 2CW5A 4WZ5C 5F7ZA 4CLCB 2XD1A 1E66A 4ANFA 2CFSA 1XRLA 4L3WA 4TKVB 1FR6A 2HHJA 2XDWA 3UM9A 2X0KA 3LPLA 5EUMA 2AFIA 1XMQB 2BJVA 3WNVA 3LCEA 1PEDA 2MHCA 3M83A 2E4VA 3HBJA 4TUYF 2XYGA 5DYYA 4Z53A 1RKXA 2D1TA 1W9MA 2JHAA 4GOXA 4EI2A 4JA0A 1GPH1 3EMKA 3AFHA 2P3LA 3P19A 2X40A 3O75A 3LT0A 1UBRS 4E03A 4RD3A 2PMFA 4CTOA 3WRZA 1ORVA 2CNDA 3RIGA 4QOGA 2HDWA 4GC5A 1Z26A 2WU4A 3O1IC 2CJPA 5IS1A 2Q7XA 3SP1A 4D4KA 3PQCA 1OXKB 5FBQB 5HTKA 2E4UA 2HRQA 3V3KA 4B81A 3AVXA 4RE6A 4F1KA 3KM0A 5KPJA 4R2XA 1JFLA 3PC6A 4JJZA 3RC3A 3ABQB 3W1EA 3PX3A 1FFAA 3WHIA 4EY7A 4YT4A 1Y1KE 1Z18A 1VG9B 1Y42X 3A0VA 3CLRC 2ALJA 1Z0SA 3KNZA 3L7LA 4P3KA 3TFWA 5I8WA 4U9IS 1E4OA 3NEAA 3NAMA 4J49A 1SPXA 4RADA 1FFSA 2W4IA 3DPUA 4N92A 2ODPA 1JP7A 1YE8A 2QUBA 1Y8ZA 1V9YA 2OXIA 3VZCA 1YKGA 3OQJA 3FLBA 1OAAA 4LOAA 2ZMVA 4G23A 3JARB 4WK0B 1A9QA 2MINB 1V4BA 3I6ZA 4QTZA 4RHCA 3IERA 4PG4A 3RJ5A 2QJTA 5H4GA 5C51B 1TT7A 2G8LA 3FFAA 4UMVA 2O59A 4EG0A 1LDGA 2V6GA 5GV7A 3T4PA 4F04A 1WYBA 1WMBA 2C9DA 1D5WA 1U0HC 5DYNA 1SKAA 4CIWA 2F8SA 2BI7A 2V45A 3OFND 3RK1A 4EVIA 2YVAA 1UJBA 3E5HA 3IRUA 2GD1O 3GJSA 1EVYA 4YUWA 3GLFB 2QX7A 1YAXA 2ZIEA 3AU9A 3FPSA 5A4JA 5HZMA 1MKIA 4GPTA 2JLUA 1CJSA 2HCTA 3TDNA 1KEWA 1BMFA 1T9CA 4PFKA 1SQ0A 4YCJA 1ZVMA 5K3CA 1ZITA 5A1JA 1IXYA 3C4PA 4UCXA 2QMYA 2NT3A 2JCVA 1BIFA 2OQIA 4O4IB 4Z4IA 4X97A 3G2OA 5IFKA 4M8LA 3HN7A 1IHPA 3TS1A 4YJ2A 4B8ZA 1YB2A 2H07A 3DZCA 1XMXA 3KCQA 2HRBA 3V1MA 5BVHB 3CZRA 4KVZA 2ZGVA 4KQRA 3I52A 4QPPA 5L09A 4RQAA 1E6EA 1PHRA 2DPGA 5EOOA 3BULA 3S1SA 4UEOA 1MT3A 1YIAA 1RKUA 2JI8A 3AHDA 2EAUA 1ZOSA 3U13A 2SECE 2P27A 3AM3A 2PD3A 3G2LA 3EFOA 3G7NA 5K0JA 2BEUB 1KJQA 1GARA 2REQB 2W0SA 5CTJA 3SVZA 4A8JA 4BZXA 2ZQYA 3RTAA 5CRIA 1NM5A 2BKXA 1ZK0A 1EFRD 5KPDA 4RUKA 1EXWA 2V9PA 4RH1A 1RLOA 2A9OA 5A91A 4PLGA 4ZYWA 5FA5A 1A8SA 1R0SA 3S7TA 5AUPB 4JVOA 3ZE6A 4G3WA 1NBEA 4Z4FA 2EBFX 4JLSA 1W19A 5DHQA 5D1NA 3IILA 5DVAA 1VKRA 2GEKA 2AMYA 3LF2A 3N0WA 3QW2A 3B3JA 3VU3A 3CUUA 1DC3A 1GILA 3I0MA 5HBRA 3E6AA 2OAQ1 5U47A 3FYUB 5DM4A 4E3MA 3GAFA 3TX2A 5K9ZA 1DOZA 2R47A 2I34A 2IOQA 4EF6A 3DWEX 4BE4A 1M5RA 1REQA 1JPUA 3TI7A 3STUA 4WESA 1H3QA 2HI0A 3PKJA 4KPUB 4MINA 4OBBA 2YBEA 3KEMA 4LJRA 4WUTA 4RSRA 1KVRA 2BM1A 1JIQA 1QYXA 2Z2IA 1UEXC 2H2GA 3FYTA 3GWZA 5FEMA 5ILOA 3BGDA 1IPHA 3DZ8A 3D2LA 4Z9AA 4M3NA 3EGXA 2E4YA 5DSXA 4B5KA 3PWTA 1WY5A 3UO9A 1DCFA 3PXEA 3PWZA 1GFSA 4TTRA 1Z63A 1NURA 1G18A 3DLPX 2ZB7A 3QPVA 3TL6A 3QEKA 1BH6A 2WTUA 4X68A 3CEPB 4D4MA 4M99A 2XZOA 1JQAA 2DT8A 4K6GA 6CHYA 3L5OA 3LYXA 3AY0A 1CDDA 4ARBA 3CEMA 2B4YA 4BN5A 1TAUA 5HM6A 3DE2X 5CJ2A 4PNHA 2C3OA 1Z33A 2K87A 1FJ2A 4R4SA 1LLQA 2VXBA 3GXBA 2PZJA 3O5AA 4HLDA 4CT0A 1OUMA 1IUNA 1T0PA 4RO0A 5FLXA 5FAPA 1KNXA 4GICA 2ZYRA 1V41E 1GGFA 1M2VA 3D7MA 3LVRE 5EWLA 1XXHB 3BWEA 3FTEA 3MQOA 1WV1A 2W6ZA 4EPWA 1RXVA 4GVLA 4X6YA 4HCJA 1W0JA 5EVEA 1DO0A 4OYRA 3W4IA 3N58A 3LTNC 1JFTA 5BSEA 4LAFA 4C08A 5JAPA 3ZW8A 2O6LA 4JLWA 2JAXA 4RHEA 1KOUA 2FW7A 2P91A 2Z09A 3EXIA 3IAHA 3ZCTA 3VPXA 2NZVG 5DKLA 4OMFG 3ZWMA 4L0QA 3H5IA 1ZI9A 1U63A 2JGIA 3EB9A 1X1TA 4DFDA 5J7EA 4LV2A 3A06A 1R6DA 4U7GA 1GGNA 4XLTA 3U3JA 2QRMA 4F3LA 2VDWB 2Q4OA 3H1AA 5IZCC 2W6PA 1BXRA 2YFKA 1ISJA 2YZGA 4MHSA 4A2WA 3SWWA 1UC9A 3T4QA 1CY8A 1SRQA 1Z13A 3AERA 4OQFA 3PYPA 3VYSB 3CO0S 3A6LA 3DHNA 4YTEA 3QFCA 2MSDB 1T0UA 4YRPA 1SQFA 2MSLA 4BE7B 3QX8A 2B6NA 3U3OA 2AYXA 1NMZA 5I45A 1N5JA 2X0JA 1P19A 3HKBA 3G8BA 2ERYA 3JASA 4XD2A 4C5CA 4GKBA 4PNEA 3LPCA 1GAEO 2O7SA 5A3RA 1KYWA 5IJWA 2PU2A 3UXEA 5KYWB 2ZR7A 4IO1A 5AOCA 6ADHA 3VHXB 4DR2B 1K4KA 2ZEJA 1SXJA 3FPHA 3G5MA 1TRKA 4IX9A 1KI7A 2ZXFA 3GEPA 3L1IA 4IGIA 4Q1VA 2PV7A 3SH8A 4JEUA 4M6WB 3NI9A 5TLSA 1IVSA 1W76A 1YNSA 2PV0A 4IINA 2ZJ1A 1YB4A 4ZANA 1EE2A 1L5HB 1QKJA 1ZJZA 4GLQA 2BN4A 3AESB 4DAEA 3ANMA 1RQRA 4KZ3A 3QXCA 1QH1B 4NETA 2HIHA 2J9FB 4JLNA 4Q4HA 4R6XA 2V6MA 3AX6A 3A0UA 4U7PB 3TTVA 4PM8A 5DJTA 1CB7A 3D5TA 1USUA 4DM7A 4KIFA 2QLNA 4LWZA 4XQEA 5DLEA 2G1PA 1P4JA 1KAMA 1HX7A 1E3JA 2V4MA 2FH5A 1F0YA 3VJKA 1DEXA 4BIMA 4PYJA 5CFNA 4HEJA 3JQFA 4S1WA 4TKUA 3AQ4A 2GETA 3ZHBA 3MWYW 4WZAA 1RJ9B 4PZCA 5HK8A 1DAIA 1EEXB 2OQ2A 2WAEA 4BLPA 3BM5A 1ZCAA 2AFHA 2XCUA 3L7KA 4UA9A 2WG0A 2O0JA 4ZO8A 3H1TA 1UBTS 3K15A 5IKPA 5LQDA 3T1OA 1IZ0A 3C98A 1JEEA 3KQVA 1RHJA 4CLRA 1CS0B 2I7VA 3HR7A 4J0FA 1N9BA 1JX6A 1LC3A 3RTEA 1MB0A 2OBNA 2PL3A 3HDQA 4QC2A 3UWOA 5FQQA 2BCJQ 3FPEA 1C4XA 3QFHA 2FF5A 1JQEA 2IYVA 4DSTA 2H1HA 4TKVA 4XT2B 1MB4A 2DPLA 1OHHA 4PHHA 4GKAA 1V8BA 4HYYA 4PPFA 3O6VA 3JQEA 4YR9A 5JPDA 3ZD6A 1THMA 2EFJA 4PM9A 3M6BA 1HE2A 2G9UA 2XECA 4FXPA 1SKYE 4YP1A 3NHBA 3TSYA 1HI9A 2PLAA 2OCAA 1A69A 1QHIA 1CUUA 4BQQA 4OB8A 3ICEA 3E22A 1SCKA 4TYQA 3RT7A 3JQCA 2ORVA 1NXYA 3UB5P 2XTAA 4U8GA 3VDRA 2PQMA 2XJ4A 3LEQA 1QAQA 4KPEC 1X8JA 2A94A 4Y13A 4K28A 4MYUA 2R97A 3NDGA 5P8WA 5CG1A 4ZYUA 1QKIA 3LQKA 4DSOA 3NUGA 2C9YA 1MN6A 4H7JA 1RC0A 2J33A 1O0BA 4P4SB 1ID1A 1WDTA 3RTBA 1WZCA 1ZK2A 1VMIA 2QTRA 4OF4A 1NVXQ 5DI3B 5ALNA 5EFOA 9LDTA 1RRMA 1PK9A 1SNYA 2V4UA 3A2LA 5JYCA 1W8IA 3SR0A 5DGHA 3WIEA 4G1BA 2NU9A 2X02A 3U7QB 1QIJA 1FTSA 3ZWCA 2D0PB 3NC0C 3SEQA 1ENPA 3QOXA 3N8RA 4DA4A 2DR2A 1JE0A 4L57A 1EHYA 1I4EB 1OX5A 2VBGA 2XNDA 1M0EA 1EK5A 4A0QA 1RLTA 3C7VA 3C4VA 3D72A 4ZIRB 2NZUG 5FQKA 2GJAA 5FEUA 1SBZA 3VR3D 1LPSA 3ACCA 2Y9PB 3DZDA 3AERB 4R1UA 1VI2A 4MKRA 4JROA 1Z5VA 1T4MA 5HDQA 3EPRA 5A4IS 3GP5A 3HLDA 1XTIA 3G59A 4FN4A 4RZSA 4HG2A 3UKJA 4BFXA 1JU4A 2WYOA 5F3DA 5JWRA 3RXXA 2HV9A 3BXFA 1MB3A 4HTFA 1MXFA 4HN9A 2IYPA 1JNUA 4H59A 4DE1A 1O6BA 3H42B 4HNGA 4EITA 1DO2A 1MPXA 1GAWA 1QCYA 2P1DA 3AEQB 3IDAA 4FHZA 4FQ8A 4GGPA 4L5IA 3GHYA 4YYZA 5KX5F 3QMVA 1YVDA 4BNXA 3G68A 1GKKA 2OV1A 1GQQA 3DH0A 2ZW9A 2WD7A 4OG2A 1IKGA 3AXTA 1B74A 2YN0A 5KOIA 2YW2A 2VDMB 4CW7A 3A31A 3KOUA 2A35A 4MOWA 1M2GA 2R1VB 3NC4A 2E2WA 1PG2A 3U80A 2XUHA 1UMCB 3UW1A 4ZGWA 4C5BA 2EX9A 2ZRPA 3AHGA 3GFVA 1TEMA 2Z58A 4IFIA 4JD5A 1MO3A 2H17A 2HSWA 3KOMA 3RC7A 4BNTA 1E6LA 2J3JA 4I1SA 3O3MB 2W42A 1R4AA 1Y3FE 4HBZA 3R7NA 5KVCA 4ALKA 4HX9A 2W8BA 4CL8A 3GFFA 2PDRA 1GCIA 3LLSA 1EVJA 2WNHA 4GX5A 3SSOA 1EW0A 4CU5A 3BCUA 3UN7A 1OPXA 1QHHA 3CF4A 1GADO 3CR8A 4IUCS 4MQ5A 1Q1BA 5TPZA 3ZX4A 2P4UA 4OK6A 4M54A 3OZGA 5KCZA 4G0WA 1U3CA 4L9FA 2IY9A 4RYEA 1SC9A 3MBZA 1W9HA 2GARA 2Y55A 2P62A 3DYBA 3EIXA 4JUBA 1S7CA 5IJZA 3EPJA 3H4IA 5BRAA 1EQ2A 3HUOA 4IOKA 2H65A 4OXIA 4MWTA 2W93A 3BBPA 4R68A 4WEJA 1CUIA 1GA6A 1H9BA 1XA3A 2H4YA 3EIFA 3KZXA 2PT5A 1EWYA 1NR5A 3GGGA 3L0IB 3WRVA 3P0IA 3C97A 3HBFA 3NECA 3IYLW 4E94A 3D6AA 4Q7KA 4RYLA 3G9UA 1DQPA 2B37A 4A6XA 4AICA 1KGFA 4V0ME 1MW9X 5A8BA 1FTQA 2NYVA 1NE2A 1MP0A 4UU0A 1XJ2A 1FVHA 1Q44A 2VQ6A 3N6XA 3OEED 3PXXA 5C4IA 4DCTA 3E0YA 1P29A 2REBA 3M4JA 4ZU3A 3O1LA 4OGFA 2A5LA 4C30A 3FB4A 3LI9A 2PX4A 2R5WA 2GCGA 4O33A 4OJKA 2JDID 4I3GA 3B60A 2AX4A 1GRCA 2MSWA 4OV6B 4P4TA 2GCIA 3W90A 4HDAA 4ZHQB 4D9JA 5AJUA 4NPCA 2WKQA 4K3VA 4RIGA 5C7IO 4TVBA 4D3ZA 3Q8MA 5E1MA 4S1VA 5LWHA 4RTSA 3ESRA 2YMQA 3A2MA 3F7OA 2I2XB 1WZUA 3D43A 3DFMA 4HXEB 1CJBA 5BN4B 4NABA 5A6SB 3CLTD 4DADA 1BLPA 3KAPA 1EE1A 2F43B 3S40A 1H5NA 2PMKA 5LCXA 3T3GA 5I7WA 3B85A 4R8MA 2ZM8A 2OAEA 1KI2A 3OHMA 3CZCA 3U9TA 3B47A 2PX5A 2RIPA 2HFJA 4OEHA 4PN7A 5T67A 3JR7A 1ZGGA 1UEJA 1E69A 2VZ8A 3L7BA 2C61A 3U16A 4N0DA 3UFXB 4WW0A 1NR1A 2Z9DA 3QBJA 5HOQA 4OP1A 3DOCA 5KYXB 4NCJA 4P81A 2NUPA 3DBVO 4I1OA 5DTSA 5FHRA 4B0OA 4MQBA 1YQSA 3NNNA 4MUBA 1H5XA 1EG2A 4JXXA 1FFYA 4MIKA 3C8DA 3DTVA 2HSDA 2Q3LA 2BM9A 2WQ6A 2AI1A 2GI4A 1UGUA 1NBME 3ROMA 2FSVC 4Q93A 1XPRA 3LP5A 4RPCA 4WECA 1TLLA 4R71A 1PGQA 1VLVA 1G8PA 2DUJA 1QV6A 1C8VB 2DQ4A 1OMEA 2IYRA 2ZBUA 4IJUA 4LVNA 1QQ7A 5J2TA 4F3LB 3PTEA 1R9GA 5DNCA 4QD4A 5CXWA 2BFPA 2HYDA 2P2LA 1P7WA 1L3LA 1RW4A 3HP4A 1LLBA 2DQZA 3WIBA 2ACKA 3EZ7A 2P4SA 4DWWA 4B4UA 2WNSA 2VHJA 1IN7A 1V16A 1WB5A 1X1BA 3JARA 4AP5A 5KSZA 2X9GA 5LKRA 2ZIZA 1XTPA 2UUAB 4LXGA 4ZQEA 2RCXA 3ILHA 2WBLC 4EJ6A 3DE7X 5TGZA 3AI2A 1GHPA 3OOEA 5DBHX 5ED4A 3H9EO 4X1KB 1Y6FA 1K63A 1R2QA 4GOGA 1FU8A 4Z8XA 3IKMB 4FD8A 1GLNA 2WG1A 4S0XA 1JIXA 4QQKA 4LBWA 3QUQA 1ECCA 4MV6A 4RELA 2HF2A 2FZ5A 5HJ7A 3HB0A 3NKLA 5DKKA 1BXGB 2VJDA 3IUSA 5A9SB 2WIJA 4UM8B 2IV3A 3G82C 1CQAA 2LPMA 3QKRA 4JQCA 3R3ZA 4MGHA 1DLJA 3NJ8A 1ZJYA 2I3AA 5GY7A 3D02A 1EFDN 1FP6A 3I2KA 4RY8A 2Y0EA 1Z09A 4JF4A 3LDFA 1KPHA 1SK8A 2AVXA 1U2DA 4H8RA 2O48X 3EF3A 3ZZ0A 4ZV4A 2CLMB 2X2PA 4G37A 6ABPA 3LHFA 1HE4A 1XP5A 2WEKA 2ZZKA 3S99A 3RPEA 3SIXA 1DQYA 4AJKA 4LV0A 4AYXA 1EVIA 2E85A 3PNMA 3UT6A 3BTSA 3N8IA 4KOEC 1ZZGA 3A4YA 3CIFA 4J94A 1MD9A 4XJXA 1RQXA 4Q00A 5B5SA 1JSRA 2QHKA 2XCTB 1UMKA 2FCAA 3NOTC 3IQDB 1VYHA 4G1CA 2GBGA 2B4KA 3JCZA 3VH1A 2VUUA 4H31A 3BVPA 3I5AA 1C3EA 3DKKA 1KPIA 3SKYA 5K0EA 5JZ9A 3LQ1A 4Y2UA 1OBFO 3NHLA 1Y3IA 4Q4AB 2XQVA 5EV0A 1KEUA 3HUEA 4IKPA 1NVVR 5EVJA 4AJNA 1IATA 1GO2A 1LSUA 2XMPA 3SC6A 4LTNA 3IHBA 1ORWA 4I5FA 4S0ZA 1FNCA 3ZG8B 1D4AA 3KWMA 1B3RA 1B8VA 2XVYA 4Y18A 4JA2A 2J0SA 4BGIA 5FTMA 2QU8A 4Y6PA 1E58A 3HZRA 2P79A 5FQNA 2GVNA 2FSFA 3P0FA 3EUWA 3GVPA 3RFBA 3QXHA 4HWTA 2ZJ5A 3PNQA 4LMAA 5EZ5A 2QVXX 5U1PA 1T3SA 1PZFA 2FFQA 3T34A 1K08A 1UK6A 1ZVQA 1EXVA 2QORA 3IT3A 3ZI0A 1YHNA 3AG6A 1SVIA 3GCGA 4II7A 3KQSA 2R79A 3QBVA 4MQMA 2Y0PA 4MUMA 1DKRA 1LLCA 4L5YA 1YA8A 3N5KA 4WFIA 1EFLA 2VTBA 3P96A 4RPHA 4WJZA 3FYCA 3OC6A 1XU9A 1VC2A 5K8LA 2YJTD 4TVOA 3ROFA 3OIUA 3ZV5A 2YXBA 3N6RA 1CG6A 2EW2A 4RFLA 3RFXA 4TV9A 1AVTA 4ABYA 3QU5A 1P1CA 1OILA 4UBLA 1F14A 4AM8A 3EPHA 1V9SA 2V58A 4HK4A 4AKSA 1UMDB 1TK3A 4JAVC 3DCNA 4BV8A 4C5AA 1D07A 2MSKA 3G31A 1EUYA 3OSZA 5KSCA 4NH0A 2CMDA 3ND6A 4PLCA 1UT5A 1RXUA 2HXYA 2XDAA 3ZW7A 3KALA 1OH7A 4HLUA 3ZY6A 5CX7A 1FDOA 1E4DA 2F6RA 1QGUA 5JQGA 2QQGA 2RJOA 4CDNA 2WHEA 3BXZA 3RU7A 3E1GA 4I3FA 5ADUS 5JDCA 3KSHA 1IWPB 4H7PA 1TQ6A 1L1QA 3AXSA 4Q9JA 2H5EA 4JP8A 1AGRA 4Q7QA 4AY2A 5E2HA 3SS8A 5F2NA 4NENA 1T3HA 4OXYA 1TE2A 4E3ZA 1HE1C 2WHQA 1M3SA 1C30B 3A2KA 2YKHA 1NQOA 2WKWA 4F9EA 2GLXA 3GUHA 3G85A 3DMRA 1TAHA 1U9YA 1TQ2A 1KOJA 3ZE1B 2Q1TA 3EBPA 4CQMD 4B3DA 3UPUA 2YH2A 3GFGA 2HJGA 5A6VA 1W8DA 4K9SA 3N39C 3ILVA 3Q3EA 3A9WA 2ORYA 2F9FA 3JATB 3W5JA 3CVWA 4Z9YA 4QXOA 1KAHA 2PUAA 3TSOA 3MOSA 4GS9A 1NJ1A 4ETIA 4TV8A 4UVIA 3QI2A 3RV3A 4JLUA 1Z7WA 4M0KA 5CPBA 2RKBA 1V2GA 1NJ2A 2MSNA 4AS3A 1N1DA 4LJYA 4N8SA 2BGLA 1O89A 1W36B 1R9MA 4A2PA 2QN6A 4KNYA 5B64A 1W63M 1GSHA 1O94C 1SVKA 1DUVG 4NV1A 1IHDA 2P7HA 4KE9A 4ZU6X 1QH0A 3TKAA 5C9ZA 3PR1A 4EFMA 3EUFA 4DLYA 1Y1LA 1Y81A 3DLAA 4BMWA 4PTLA 2VZWA 3Q7RA 2CJWB 4CLCE 3SF8B 1WA9A 2WIKA 2Z4SA 2V7QD 4BN4A 4G89A 1SWVA 3FJYA 4FGZA 2GDJA 5JYEA 1F6WA 5AQ7A 2FW6A 3RIYA 1SO8A 2C2YA 2OCPA 3R5XA 3OKFA 4ZICA 4Q3NA 3VTZA 4H6WA 1WPRA 2JFBA 3D59A 5DHAA 4XEUA 2NXNA 1R74A 1M6VA 2HGVA 1IN5A 2FEXA 2YS7A 3DS8A 4QHSA 1YS9A 2WE7A 3CH5A 5DSTA 4BJHB 3D9YA 4FMBB 4UM9B 2R6CA 3MBKA 4CV0A 1SZDA 4MCAA 2VXCA 2ZPUA 2BFDB 2ETXA 4IGAA 3V2UA 2EXXA 1EFCA 2PAFA 1MA0A 1JHYA 3QTTA 2Q1UA 3JPYA 1R00A 1B3BA 4X6TA 2YBDA 5JCOA 2FDXA 5I7FA 5H8WA 1IBLB 5B3KA 1M33A 5EJ8A 1ZL2A 2RAFA 2OXFA 5MGBA 4HBUA 1Z5WA 2QLLA 4OK5A 4A15A 3IHWA 3CVXA 2M2IA 1PZMA 2OPBA 1NW5A 3MCWA 3ZZUA 4AF7A 2ID4A 1Z45A 3TI9A 2VV6A 4UAGA 3EYAA 1XCBA 4DQVA 3H2IA 1LPNA 2V0NA 1FDTA 1T0IA 2XR1A 4UCWA 3UK0A 2HDHA 5IKXA 2Y1XA 1H23A 4DCVA 2W2TA 3UPPA 4FDAA 1PVDA 3LSYA 3EG5A 2PMDA 2PVPA 4OQXA 4TTJA 4WA8A 1Q1AA 4YGXB 4A0FA 4P2BA 4PCLA 1EZ1A 3CS3A 2XHZA 3BH0A 3QP9A 3A26A 2RHGB 5FBKA 4ISBA 4PRKA 2YFYA 4XD7D 4MO9A 3RWMB 2PSJA 3HVFA 1WF6A 2AL7A 3I2IA 3NEJA 4E2ZA 3LA6A 5KYXA 1AA6A 4EGCB 1M2JA 4EM6A 3I34X 3L4EA 5G0UA 3VR4D 4EG6A 3SQXA 1I7SB 5JSHA 3WO0A 5KQPA 2QL5A 3R9XA 2JB9A 2Q5JA 1LBHA 3HRIA 3K9QO 5EVIC 1ZM9A 3OEEA 1S4MA 1Q7TA 5T4EA 1F2TA 4QGAA 3PUZA 4IIXA 2ZTVA 4B7AA 4X64B 3V1TC 1G8JA 1K9VF 4G6ZA 4NCBA 1N0VC 1TOAA 2DFTA 4M46A 2Z8ZA 1MQ9A 2Y1FA 1VHJA 3TPFA 2E1PA 1G9XA 2HMYB 2HXGA 2P6UA 5FSRA 5L10A 1D2AA 3LXUX 1ZI6A 3IDOA 3DBIA 3OE4A 1GAJA 4OQIA 5K3FA 3WDKA 3WIUA 4LF5B 1ZGJA 4F9FA 3SI7A 2RHWA 3CO5A 3UUGA 3LP6A 1QH8A 2QAIA 3ZI7A 1C9NA 1A7KA 2X8WA 3HKBB 2QMOA 1P8AA 1G5IA 4IX1A 3JQ8B 3M3DA 1GCUA 3COVA 1KE1A 4G25A 2G80A 1XRSB 4RY9A 4EECA 3C43A 3LH5A 4ALJA 3FVQA 3COYA 4KUGA 3WYAA 1ALQA 1JECA 3H5WA 3TGPA 5KO2A 4OHMA 1CR2A 3KRTA 4DN6A 5IK2D 3PITA 4GT1A 1SRRA 1UXJA 3WIOA 3T3EA 5JAMA 1CUWA 3C2QA 2IS1A 2V8CA 3EXHA 2HWUA 2XEXA 3KYZA 4DAOA 4S05A 4LE1A 2HMSA 2IS4A 1QF9A 4KR7A 1XCMA 3FSJX 3ZJTA 4FLFA 3TR0A 2Z8XA 4DLNA 5CGXA 2HA3A 5JUWA 5CK5A 2AR9A 2YIVX 3K70D 2OORA 1XZLA 4FNMA 1DJCA 1LEHA 4BWYA 1UOPA 2VAWA 4HGZA 1P8JA 1W36C 1NKVA 3D2CA 5EJAA 3HXKA 2ZTMA 1QHNA 4FI3C 5G41A 2Y8HA 4YT8A 3GLFA 2JC3A 4FC6A 3U19A 2H1WA 4ZOCA 4JVMA 4BPRA 1PU2A 2GBPA 1MC5A 2AFHB 1P0FA 2GASA 2I7XA 2YWRA 3AFGA 3CWZA 4O2LA 1X70A 5D5HA 1DQZA 5HYVA 4C6RA 4Y0UA 3H7AA 3SYNA 2F1KA 2VTVA 1E5VA 2JFWA 3FKSD 4L9SA 4DC0A 2HP9A 3N8SA 2AN9A 1PV4A 4MVJD 3L8MA 1GM5A 1DX4A 1VLLA 4UM7A 3B78A 4OQMA 2HAEA 1IY9A 3K0FB 4PF1A 2J9OA 4B2IA 3OTWA 3WZ2A 5D84A 2XRYA 3GUUA 3HHPA 5JPCA 1YJAA 4P1ZA 1CRZA 5EKSA 1A9PA 4FGUA 5H1YA 3WBJA 1RC1A 2P7JA 5FH9A 2J7VA 3LI8A 5A7FA 5GQSA 3VE3A 1V7ZA 4JYBA 1F2DA 4YPFA 1J7JA 3P5SA 4UFOA 3W8DA 2PZ8A 1NI4A 5AVQA 4KI7A 4DNFA 3ORSA 2Z57A 3PJEA 3Q2KA 1L4KA 1HEUA 3D4OA 4UREA 4NY1A 4KFCA 1EESA 2D2IA 2QRNA 4XRRA 5T7BA 1Z6FA 1JJFA 1A7AA 4DUGA 1I10A 2BV3A 3DVAB 1P9RA 1NSYA 1OWMA 2BF7A 2Y2UA 3GCDA 3H1EA 3H9GA 3I9FA 3QITA 3V8VA 5MN6A 2WTBA 1OXBB 4RJIA 4WN3A 4WI1A 4KR3A 4MSUA 1UJ6A 3H1GA 5EYPB 5KQMA 2ARKA 1X7ZA 5BMOA 1ZN9A 3AU8A 1C1HA 1ZK4A 3A58B 2YDXA 3SZTA 2PVCA 4FIDA 4QLOA 1PP4A 1J1IA 1TZBA 1TUBA 3DW0A 3V80A 4C04A 1DJAA 5B58C 3KYDA 2Y59A 4ID3A 5HUHA 5KMGB 2PRFA 3SC2A 4DMCA 2HHHB 2NYRA 2AMLA 2P0EA 3O4GA 2HYIC 2XOEA 4CEJA 2PXHA 3VR5D 1RLJA 1P18A 4UDYX 3CMCO 3WYEA 2REXB 3H1FA 3O8BA 2F1RA 3PUYA 4MWZA 2QT1A 3LFVA 1M1NB 2OLJA 3GC6A 4RK1A 3SXJA 2P4QA 1JEQB 4RX2A 3H17A 1JXQA 4OQHA 1BHSA 1C3JA 3E4CA 5A93A 2XUZA 3FNHA 3UANA 5BT8A 5EVIB 3G2HA 5J5VA 1ZNQO 4D41A 2P9TA 3VPDA 4M98A 1JAYA 1N8SA 2O2XA 2P41A 2YNMA 5JVDB 3UT5A 5KTKA 1NZOA 2H9YA 1YULA 1QG4A 5HL1A 2VA8A 3KP1A 4MXDA 5AK0A 1RI1A 4ENVA 2IYNA