1PWZA

Crystal structure of the haloalcohol dehalogenase hhec complexed with (r)-styrene oxide and chloride
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
252
structure length
252
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords halohydrin dehalogenase
publication title Structure and Mechanism of a Bacterial Haloalcohol Dehalogenase: a new variation of the short-chain dehydrogenase/reductase fold without an NAD(P)H binding site
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Lyase
total genus 89
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pwzA00
1J0XO 2DUUA 3GDGA 4KDFA 3ZDFA 3RFXA 3PIDA 1B8VA 5F5LA 1JLLA 3GDOA 3FTPA 5COBA 1V0JA 3RD5A 3CIFA 5TT0A 3WBBA 5JC1A 2NWQA 2AE2A 1GY8A 4J16A 4Z0PA 1YDEA 3IP1A 1AE1A 2DBVO 4OMUA 3DOCA 4BO1A 5FF9A 1SMKA 4XWYA 4A03A 2PK3A 3NRCA 3NKLA 1QV6A 1FDUA 3KM0A 4BKPA 3EVNA 3TZCA 1Z45A 2PA3A 2C5EA 5JS6A 1HLPA 3HFGA 4RF5A 3F5QA 4U0JA 1KC1A 4CR7A 1CETA 4Z3KA 3O4RA 5IDYA 2JD2A 4TZTA 3OIGA 4CM9A 4Z3DA 1GEGA 4J2HA 2VNSA 3BMQB 4R9SA 5EERA 4IMPA 3Q3CA 3ZV4A 4C4OA 5TC4A 1U2DA 4FOOA 1YH3A 3JQ9A 1H93A 2QRLA 2C2XA 4JX8A 3TFOA 3PGJA 3BYZA 1T4DA 3LSYA 4JJGA 1ML3A 3RKRA 5FWNA 4P4GA 2JCVA 1HE3A 4M1QA 3OIFA 3JQGB 2B5WA 4DYVA 2EF1A 4M86A 1X14A 1DPGA 4BNIA 4IZIA 1RKXA 2G17A 3DOJA 4MPDA 2GD1O 4J1NA 3CXRA 4LSWA 2O2YA 2BLLA 3CMCO 3TZ6A 5CPBA 3MJ4A 2DC1A 1N9GB 2AQKA 1LQUA 3EK2A 4B4VA 4K26A 4PLFA 4ONEA 1PS0A 2UUPA 2J8ZA 2CF5A 3L6EA 3JQ6A 3TNLA 2Y1DA 3SXPA 1YB1A 4TQGA 3U4CA 5ITWA 3ZV6A 4Q3DA 4J1QA 4NDNE 3TPCA 3JQAD 3GK3A 1E7QA 4CMAA 1DJQA 5BSGA 4CM7A 2ZYGA 1WZEA 3E82A 5L40A 2OMEA 2B37A 1ULSA 1I8TA 1CEQA 1XGKA 2PZKA 1UAGA 2Z1NA 3F3SA 1ZK3A 3QJ5A 3MTGA 4J4HA 2FPIA 4PLYA 4CL3A 3KXDA 5G2OA 5JW6A 2P9EA 1OMOA 2FZWA 1PZFA 3FNFA 4EJ6A 2BFAA 5CDTA 2HMUA 3BHJA 4I5FA 1E7MA 1E3SA 3U9LA 1U4SA 1F0YA 1FDTA 2UV8A 4E33A 2D5AA 4PZEA 1P44A 2CVZA 1F17A 1GZ6A 2PGJA 3JQFA 1DC6A 1YQDA 1VE9A 1S7CA 3KOUA 4RZHA 1XQ1A 1P1FA 2BRUA 4PZCA 4FPXA 5L45A 1BW9A 2Q3EA 3KEOA 1EQUA 4P4LA 1NPTO 4Y6PA 2YQ5A 4QSMA 1O94A 3WMXA 5THKA 4BKRA 4KUEA 1NQAO 3NJ4A 2AMFA 1H9BA 1U3UA 4KUGA 1MB4A 2NU7A 4EJMA 2AEMA 3GZNA 1Y8QA 3M1LA 4LRTB 1GDHA 4JLWA 2X5OA 4A10A 1XIVA 2DBQA 3PIIA 3FSRA 4FR5A 5FI3A 3ZWCA 1Q2XA 1KEPA 1C1DB 4FFOA 1U3VA 3WR5A 4OOFA 1OZAA 2WEKA 3CH6A 3NX4A 3I1JA 3ETEA 1VC2A 3RSHA 5L4LA 2GZ1A 4LW8A 1P1JA 1PJBA 3WXBA 5JAZA 1Y9EA 3PJFA 1DFIA 3O38A 1ZXLA 4K28A 3QHAA 1MXFA 4RPGA 4D79A 3MZ0A 5A04A 3I3OA 1MC4A 3KVOA 3V1TC 5KVSA 1P45A 2PGLA 3WLFA 1G0NA 5U9CA 1BHSA 2YFQA 1I2ZA 1GUFA 3UHAA 1PS9A 3WJ7A 2W2KB 1R0KA 4J9VA 3B1FA 4BNKA 5HBRA 2PKQP 3QW2A 3I9KA 3FN4A 1EUZA 3RC9A 1R4MB 4OSOA 5L4SA 4CUZA 1LSOA 3DFZA 3ROMA 2PFGA 3MTJA 1NFQA 4GWKA 1QG6A 1ENPA 3ON5A 3GPDG 3EVTA 3NTQA 3UOGA 2EEZA 3DBHA 3F6YA 3VPFA 1T2CA 2Q4BA 2RBEA 1E5QA 3JD4A 4E12A 2WWRA 3K30A 5EESA 1QRRA 4RVFA 3RUCA 4DRYA 4ZQFA 1HDXA 2ZB3A 1JTVA 3RBVA 4KQWA 1A4IA 4D0RA 3PXXA 2AQHA 5HS4A 2WD7B 4DIBA 1DLJA 3UAGA 2J5KA 1P74A 1PGJA 1PS8A 1V3TA 3STHA 3DZGA 3JQDA 1M76A 5A9SB 2GGSA 3VVCA 2QRKA 7MDHA 1UAYA 2X8LA 3QWFA 4ND2A 1PWZA 4WCDA 2WMDA 3OEYA 5JO9A 1IB6A 1I2CA 4UVEA 1R0SA 1DXYA 1NPDA 1OFGA 3C8MA 3VH3A 5H83A 1HF3A 1PQWA 4PLPA 4D7AA 2Y66A 4WUVA 3ROPA 2PGDA 4YXFA 2O7SA 3G17A 3GNTA 4R41A 1U3TA 2PNFA 1YOVA 3GY0A 1YL5A 2E82A 1T2DA 4XJSA 3EZLA 1I3NA 5L7WA 3ZHBA 3HHPA 3PFFA 2PTGA 4WECA 1WNTA 1UXKA 4GSLA 4IY1A 4EJ0A 3D3EA 3CE6A 4FSHA 1XWFA 4RQTA 5TNXA 4DLLA 1ZBQA 1KEVA 1JAYA 4FFPA 4LVUA 1DC3A 1XG5A 3DC2A 1PU2A 1NTOA 2NVUB 4YJHB 3VAZA 3WICA 3UF0A 3DWFA 3E6AA 4Y6SA 1DFGA 4FBGA 2IYOA 3PHGA 3ROQA 1J6UA 1NQTA 1UP7A 2DFVA 2IXBA 3LT0A 3I83A 3L77A 4ND3A 1YGYA 4J7UA 3NT4A 1WMAA 1YVEI 1Z73A 1E1NA 5BSFA 5HWSA 1B15A 3OA2A 4UUOA 2YW9A 1BG6A 4BKQA 1B2LA 3L4SO 1QSGA 2JL1A 1L7DA 1VM6A 1EBUA 4BB6A 4BO4A 4DBZA 2Y1GA 3UCFA 1MUUA 2PH5A 1TLTA 3KB6A 3NUGA 1B3BA 1PR9A 2EP7A 5BSHA 4AVYA 9LDTA 3CPSA 4JIGA 3RQSA 1Q0LA 3NDIA 1N7HA 1KYQA 2Y1OA 3JQGA 4XGKA 2H1SA 1U9JA 3AM3A 1Q7BA 1P0FA 4NK5A 4BNUA 1X0XA 3RASA 2OP0A 1E77A 2HAEA 2VWQA 5KJEA 3GEDA 4DC1A 4E2YA 1EDZA 3H9UA 1ZVMA 3TOXA 2BHLA 4Q39A 1J4AA 2RHRA 4TKLA 4UVHA 4WKGA 1Y5RA 1HE5A 3LF1A 3LVFO 2WJPA 2EKLA 2FSVA 3PPIA 3FI9A 4OIMA 1O8CA 1IL0A 4N18A 1TB4A 3QWHA 4W7IA 3OQBA 4A2CA 2VYVA 2HMSA 3CZRA 3KLPX 4FJ2A 4KZPA 5EJ2A 4FC6A 3DZBA 5F3RA 5DT9A 1J5PA 3ZWAA 1A9YA 2VYND 3D3WA 1K6IA 4IS2A 1DHTA 1ZMOA 3ZHYA 3TZQA 2ZYDA 2PR2A 2B4RO 1NVTA 4F45A 1U7HA 1E7YA 5AXCA 1EK5A 3OJFA 4B7CA 3UVEA 5F21A 4OOEA 4YBZA 4YDRA 3KZVA 4R9RA 4E5KA 1DFHA 2HO5A 4OJNA 3B70A 3LDHA 4R16A 3JQ7B 5IXSA 1MA0A 4MP3A 1PJ3A 1BMDA 2IYPA 2J3HA 4MVJG 4WLFA 3ZN2A 5JMPA 3AJRA 3WQSB 5BR7A 1VI2A 4ITUA 1AXGA 2Q99A 1JKIA 4HFNA 4BMSA 4FB5A 4RPKA 1ZKMA 3AUAA 3FD8A 3WGZA 5BSEA 3EGOA 3GZ4A 1LRLA 4A7PA 1VRWA 5JCJA 3VPGA 3ZW8A 2HSDA 3VZRA 1YBAA 4GGOA 4AJ4A 1TA4A 1V3UA 3R1IA 2AE1A 2X9NA 5FEUA 4ROSA 1BVRA 1DIAA 4A27A 4D41A 3IAHA 5IF3A 3DZKA 5T8KC 2XOXA 4BVAA 5B12A 1IPFA 3KEQA 3OJOA 3PLNA 3AY3A 3JSAA 3IIEA 4XQ9A 3WQQA 1ONPA 5IXYA 3D64A 1NQ5A 1FDWA 1BDBA 2D3TA 1N9GA 2CVOA 2TMDA 4DXHA 2YYYA 3HN2A 1NXQA 4YT2A 5JBIA 3R3JA 4L4SA 4DQXA 1V6AA 3DHYA 5JAQA 4MVJP 1IZ9A 4XX0A 5DBGA 2V65A 1O89A 4CM8B 1SEVA 2SCUA 3NGLA 4IIVA 4CM9D 2PD6A 1LNQA 5TRTA 4JROA 2G82A 5IG2A 1AN9A 4TRMA 4J6FA 1YDWA 1D8AA 2QX7A 4DUPA 3ZNOA 5IDQA 2VWPA 1MG5A 1PWXA 4NBVA 5A05A 4FQ8A 4YCAA 3HN7A 3S2FA 3D3WB 3AY7A 3O03A 4RZIA 4BO7A 1G1AA 4N5MA 1GCOA 4UUPA 4DIOA 3BHMA 1EZ4A 4IDBA 2CNBA 3VPHA 5C3MA 1B14A 8LDHA 1WDMA 4Y9DA 5JC8A 2WM3A 3OQ6A 3S2GA 3ZW9A 2DU8A 3D4OA 3DBVO 4ALIA 3K8ZA 5FFFA 3VZPA 2I3GA 4EW6A 4WPGA 2HRBA 2WYVA 2YHIB 1DAOA 2NU6A 2HK8A 5A02A 1U5AA 3JQCA 2PWZA 2JHFA 3DONA 4IQ0A 1IHYA 4UEKA 5L51A 1PR3A 1VSUA 2JFHA 3GF4A 3KETA 2JD0A 2DVMA 1UXGA 5L4NA 1EE9A 3H5NA 2GCGA 4S1VA 4E3ZA 3C3XA 4MVJM 4HADA 3RFTA 4LVCA 1QV7A 1F8FA 4Z9XA 1R4NA 1LI4A 4P8RA 3K73O 3I9JA 1LRKA 5JLAA 1DC4A 1LC3A 2O3TA 5ES3A 1PL6A 2P4HX 3EC7A 5EPOA 3MJTA 5AXDA 3FNEA 4NFSA 4XKJA 3VKVA 1O9BA 3OP4A 2QHXA 4RVGA 2D8AA 2Y0CA 3H6KA 1PGOA 4KDEA 2VWHA 5JAIA 3P2OA 1T4BA 4TWRA 1NNUA 1N1EA 1X1TA 2GN8A 4B7UA 4BUCA 4YT8A 1NVMB 3DDNA 1AGNA 4ALKA 4DQUA 4JQCA 3N7UA 3NDRA 1BVUA 5JY1A 3MJVA 2ZTUA 3AK4A 1KIFA 5JSFA 2NVUA 4GVLA 4FDAA 4CJXA 3H3JA 2YDYA 1WWKA 3EUWA 3GMDA 2I65A 3W4KA 3H9EO 2B5VA 3GG2A 3H9JA 3JTMA 4LSMA 2P91A 3PJEA 4K6FA 1K2WA 4QFCA 3JQEA 4ZQBA 1DRUA 3JQAB 1JKJA 3DR3A 2B35A 2HLPA 4RGBA 4Y6RA 5CDSA 5JYDA 1R12A 4BS9A 3W8EA 4JBHA 5I7EA 5K0ZA 3QWIA 4BOYA 1X1EA 3DBLB 3D5QA 3P7MA 2EERA 3IJRA 5DDIP 1QR6A 2RHCA 4WEQA 1PJ2A 4YAJA 3OJLA 4J4TA 5DCUA 1HE4A 3L9XA 3OM9A 3U4HA 2WSBA 4CQMB 4IINA 3RUEA 4U7WA 3PZRA 4UVIA 5JDCA 3NT2A 5KKCA 3L9WA 4RF3A 4GQAA 5BNTA 1ZIDA 2JCXA 3FBTA 3UUWA 1YO6A 2O3SA 3NGXA 1Z6ZA 4BNVA 2IEDA 4GH5A 2D4AA 4HP8A 5DNAA 2VHWA 4A73A 4WLEA 2UAGA 5KIAA 3RBZA 4Q3BA 4IJKA 4CV0A 5F5NA 4PVDA 1N7GA 4B4OA 3RC2A 2GZ2A 1W4ZA 1PQPA 5G0TA 2NV6A 2UYYA 3IOYA 4YVFA 3UKOA 4OKNA 1RM0A 2Q1WA 4DL9A 2AG5A 2W98A 2EIHA 3BTSA 4JK3A 4QEDA 3ZI0A 3KSUA 4QTZA 2GF2A 3A14A 3HFSA 3H9QA 2DBRA 1ZK1A 1K6JA 1DJNA 1GYRA 3E1KA 3O26A 3B20A 5CEJA 1KEWA 4CMIA 3KYBA 3HG7A 2X0RA 3ZU2A 1K89A 5AXBA 3MJEA 3I6IA 2X9VA 2Y67A 5DZSA 5LDGA 1LSUA 2P9GA 5TJ9A 4WCFA 4BMVA 2HMVA 1X13A 3JV7A 2BGKA 4B3JA 2C29D 3LU1A 3DBRB 1TI7A 4YJFA 1VPDA 1SOVA 4CMGA 4XYEA 2UVDA 3IKTA 2Q4EA 1UZMA 3K2EA 3GHYA 3LK7A 1UXHA 3QVSA 5KTKA 3I23A 1JVSA 4HNHA 3AFMA 5TF4A 3GG9A 1DIGA 2G76A 2JJYA 4BGIA 5KVCA 3KYCB 2TMGA 2EP5A 4OXKA 4J90A 5TQVA 2Z1MA 4ALNA 3E8XA 4OXNA 3AW9A 3ZWPA 5G0VA 1T2EA 4YYZA 1W0CA 4YT4A 1H6BA 4PIVA 2FY8A 2PV7A 4FFMA 4EI2A 2J3IA 3RJ9A 2FZEA 2C59A 2PH3A 5B4VA 1ID1A 1KC3A 4MJLA 4IPTA 2B83A 4BNZA 3JYNA 1UZNA 4I8XA 4L8VA 5MGBA 1ZZEA 1YL7A 5BQFA 5JDIA 3U0BA 2X4GA 1UH5A 4NG5A 3PZBA 9LDBA 1XLTA 1QYDA 4TVOA 4XQCA 5EMHA 2HK9A 5IAAA 1EEHA 1KEUA 1UR5A 4LRSB 3VH2A 5CG2A 5JDIC 5HRUA 3M2PA 3SLKA 2I99A 4LCJA 5JMWA 5ICMA 4B7XA 5DF1A 1A27A 1IE3A 2A4KA 4J4BA 5BNIA 1GYPA 3ITDA 3Q0EA 3QY9A 1E92A 2GSDA 3TL2A 5TX7A 4C7KA 3ABIA 3QV1A 4J0FA 4MVJD 1WMBA 2X23A 5TT1A 3ZU4A 1LDYA 1PGNA 3JQFC 4NK4A 5B37A 3E03A 1IOLA 1H9AA 1U8FO 3DFUA 1LDEA 1T24A 1ISIA 3JQ8A 2Z5LA 2ZYAA 4R5HA 4XYLA 4UAGA 2X5KO 1E3EA 1E6WA 1E7SA 5KJ6A 3HE3A 1IHXA 1GU7A 3OH8A 1GAEO 4WOJA 1ORRA 2VOJA 4YJDA 3GAZA 4IM7A 2E49A 2G0TA 1NYTA 3KSZO 2EJWA 4J9UE 1IYZA 2GR9A 4YACA 4AJJA 1YB4A 2VZ9A 5DP2A 2OXIA 3L6OO 4WCFB 1YOVB 4J7XA 2GERA 4YAGA 4QO7A 2O3RA 3SBOA 5AQ1A 1PJSA 2CF6A 4L75A 3PHLA 2IDZA 4BNTA 4GWGA 2Y05A 5IJZA 4BV8A 5A9RA 1H5QA 4II3A 1Y5MA 1NWCA 1GUZA 1KY5A 2O3JA 2RIRA 1YRLA 4UULA 4X54A 1B26A 3W6ZA 2BH9A 4RPJA 1PZHA 1E5LA 2VYVD 3QIVA 3OHSX 5DOVA 1GADO 3UCEA 2H63A 3C24A 1XCBA 1XU9A 4BL5A 1I3MA 2FWMX 3RC1A 3MEQA 2BI7A 4PN3A 4NU5A 2X6TA 4R51A 1EE2A 3GQVA 1SNYA 2WD7A 3OJEA 4MKZA 3BMNB 2OZPA 1AHHA 1QXSA 1U1IA 1V9LA 1ZUD1 3SC6A 4N5LA 3IQDB 1Y8RA 1E1MA 2EKQA 3DL2A 2HJRA 2PLAA 3LZ6A 4UEOA 4WLNA 4ZICA 1NR7A 5G0WA 5GZ1A 3HDHA 3DAFA 1BTOA 1E6EA 5C7LO 4KOAA 1PL7A 3WOHA 3ICPA 4XRRA 5KNLA 2BGLA 2O48X 5H82A 4PLTA 1NP3A 4J49A 4Q3EA 5IFLA 1KY4A 2WDZA 3WGOA 4AJ2A 3IL2A 4R5MA 1LEHA 1ZK4A 1T2AA 1IUKA 3H3FA 5CPFA 2ZK7A 5L7YA 4WE3A 2VUUA 3I4FA 3G3EA 3TFQA 1HDRA 5L53A 1E3LA 3PRJA 4RORA 4JBGA 3I9MA 5F1PA 3H7AA 4IDFA 2O7QA 1UDAA 3F1KA 3WTCA 1AHIA 3TOZA 4CR6A 4M49A 4DBVO 4DGSA 3O8QB 4IMRA 4N54A 1PQUA 2I76A 2UDPA 4HFJA 3GFGA 1YJQA 2X0IA 3C7AA 3B6ZA 3NJ8A 3PTZA 2DPHA 3C1OA 1N92A 4YJGB 4DYDA 4IGEA 1I01A 1MX3A 4PLVA 1LUAA 2EW8A 1C1DA 4AJOA 3K31A 3NAQA 3K92A 4AJNA 2X22A 2DPGA 2VRBA 5B4TA 5CDUA 2LDBA 3W4JA 3OJ0A 1IULA 4XR4A 4IXTA 3ZHZA 5JYEA 4HX5A 1ZNQO 3GA0A 3HDJA 2HCTA 4TRNA 1PEDA 4XZ3A 4CM4B 1BSVA 4RF2A 4WLUA 3RROA 1NQOA 1E1KA 1TT5B 2PKRA 2GUGA 2YZ7A 4DLAA 3TJRA 1VJ1A 3D4PA 4ZD6A 4F6CA 4XGNA 1I10A 3RAJA 5CDYA 2H5LA 4BO5A 1C0PA 2QQ5A 3ZHXA 3H9GA 3BTVA 1XHLA 5JXWA 2ZTLA 1E7RA 4EGFA 1UZLA 2R6JA 4R01A 2A35A 5DCYA 1PGPA 4Z9FA 4HBGA 3JQBA 5T6BA 2YV3A 3CUKA 4CQLB 5ADHA 1P9LA 4R69A 2GN6A 4Y98A 5JPIA 1HYEA 4CV1A 3JD3A 4P22A 1DHRA 1UDCA 3IUSA 1ADBA 4E13A 5DOZA 4CQMD 1DSSG 3RU9A 3MWEB 3PP8A 4Z6KA 1PJCA 1W6UA 3KTDA 4YA6A 5LDHA 3AUSA 1OBFO 2X0NA 1EVYA 2X86A 2BMAA 3GGPA 2DKNA 1LLUA 2PZMA 4DWVA 1YKFA 3V5NA 3Q9NA 5F1KA 5G4LA 1VKOA 4GKVA 1E3IA 3CSDA 4RDIA 3QWBA 3ZWXA 4E5PA 4NPCA 3S2EA 2DQ4A 2ZB8A 4L74A 4KMSA 4PRLA 1RYDA 1FDSA 4BNWA 4O63O 1YXMA 4DREA 4E31A 1HL3A 1YONA 1HWYA 1RM4A 2XXBA 3Q2IA 1Q7GA 3W1VA 3VPSA 1ADCA 1ENOA 2PY6A 1E6UA 1YE3A 1D3AA 1MXHA 1DRWA 2EW2A 2GN9A 3PDJA 1N1GA 2EKPA 5EQFA 1I0ZA 4LK3A 4W9NC 1EFKA 1XEAA 1UXIA 1B3RA 4QX6A 1NHGA 3CMMA 3WSWA 5HTOA 5KJ1A 1Y6JA 3P5SA 1ONOA 4DC0A 3HQ4O 5AXAA 5K9ZA 3VH4A 1D4FA 2NUAA 2NVWA 1U8XX 3FR8A 3LYLA 1VLLA 3AM5A 1NWHA 3EY4A 2GPTA 2I66A 1LU9A 3DHNA 4TRJA 4YQZA 1H2BA 2GN4A 1GFSA 2RH8A 4TVBA 1JKFA 4AJLA 4U5QA 5J23A 4W82A 4I5EA 3INGA 5I7VA 4EITA 1I30A 4QUKA 1SB9A 4XQEA 3E9NA 1PIWA 3GUYA 4ZA2A 4BIIA 1LDGA 3WWZA 4CLDA 4MDHA 3GN2A 4MVJH 1LSJA 3TZHA 5G4KB 2VNAA 3ZWMA 2W2LD 3OEWA 1S6YA 3QRWA 2E37A 3L07A 1EVJA 3RUHA 2Q49A 1RM5A 1PTJA 1GPJA 4D3FA 5ER9A 3R6DA 4OYRA 2VOEA 4B3HA 4P38A 3ORFA 4CR8A 1P1RA 1WP4A 4ESOA 4UREA 4IDCA 5G4KA 1R15A 3U49A 3ZV5A 2C07A 3UH1A 1QYWA 2HMTA 3KBOA 1QMGA 2DTXA 1AUPA 2Q2WA 4EDFA 1DIRA 2VWGA 3KO8A 4GAEA 4RCVA 2NU8A 3FWZA 4MVJI 4BB5A 1IY8A 2DBZA 1XSEA 1PSDA 2IXAA 1TEHA 2VHXA 4XQGA 5EQDA 4GBJA 1LDNA 3K9QO 3WBFA 5ILOA 2I9PA 1A71A 3MCVA 3OFSA 4CLOB 1LJ8A 1KS9A 3OQ1A 1ZSVA 3A4VA 2XAAA 2VN8A 5C5IA 3OETA 5JE8A 3VHRA 3WSVA 4CMJA 4WEOA 1R0LA 1ISHA 5ENDA 3V2UA 1EVIA 2PZJA 3PI7A 3C1TA 4I9HA 1I5RA 1KVSA 2OGUA 1Q7CA 4CMKA 4G5HA 1DLIA 3AWDA 4N5NA 5B4UA 2H9IA 4XYMA 4I08A 3HZZA 1N5DA 1D1SA 1VL0A 3CZMA 1WXDA 4PG8A 1JW9B 4QECA 1NHWA 4FGSA 1QLHA 1R4NB 5BNFA 4W7HA 3EZYA 2RH4A 4CMIB 1LDMA 3AOEC 1U7TA 2CZCA 2AHRA 2IZ1A 3BTUA 1O6ZA 4A0SA 4E4YA 1GR0A 2DT5A 2Q45A 1ZEJA 2DM6A 4XDZA 3MJSA 3FPCA 4MKRA 5A5EA 3WNQA 2YDXA 5G0UA 5JFOA 3FTNA 3RU7A 4P4NA 3BA1A 3P2YA 2P68A 2NADA 4D44A 5A06A 1EUCA 1LXCA 3BMNA 3FWNA 2D0IA 1GQ2A 5EIOA 4RVSA 4I5GA 3SLGA 3T4EA 3L0DA 5L95A 1NPYA 2AA3A 3DXFA 3DMTC 4XB2A 3W4IA 3IS3A 2W4QA 4OHUA 5JY6A 2P5YA 3QVXA 3A06A 1QYXA 4MOWA 2VZ0A 2OL4A 2F1KA 1K0UA 1M2WA 4GI2A 2A9FA 3E5RA 4PGFA 4XEHA 3E9QA 3RC7A 2CMDA 4L73A 3H2ZA 4BNFA 3WTBA 2D59A 4KTVE 3BIOA 3Q11A 2W2KA 4GX0A 4RJTA 4D3DA 3DBLA 3EW7A 1OOEA 3OECA 3VKUA 4GX1A 3VZSA 2FSSA 3EYWA 3WGYA 4CM4A 2ZJ1A 4M55A 4WOKA 2X0JA 3U62A 3QE3A 2J3JA 6ADHA 4K1LA 4WCFC 3JQAA 3R3SA 3PQFA 1C1XA 3WS7A 4LMPA 4XD2A 4YR9A 3HWRA 4UEJA 2JAHA 1T1SA 1SEPA 3Q2KA 3KLMX 4CM3A 1HSOA 4JNKA 3GFBA 3V1YA 1BXGB 2EXXA 2ZCUA 1EUDA 1JQBA 2JHGA 4WASA 4BKOA 3WGHA 5KCZA 3UFXA 2CVQA 4E5YA 4L4XA 4R3WA 4TRRA 3QSGA 3GAFA 1DEHA 5KKAA 3PYMA 3C7DB 1M67A 3FBGA 3GZNB 3OMLA 3U4IA 4G65A 4AICA 3RJ5A 5EN4A 4Y8VA 3X2EA 3N58A 3G1TA 4HFMA 4EUFA 4XYGA 4AJEA 4R4JA 3RUFA 4QT0A 3A9WA 4E2XA 2X1HA 1HYGA 1T2FA 1HZJA 3QLJA 3EDMA 3TL3A 3HB5X 3IMFA 5I9MA 2VT2A 3RWBA 4LN1A 4GKBA 3TRIA 1X0VA 4FFRA 4L4RA 3EAGA 4OSPA 1G0OA 2QZZA 4R1NA 4RO0A 4TSKA 5ICSA 4WNIA 4KWHA 1BXZA 1M66A 3ICCA 4NBRA 4ZQGA 1QLJA 5A1TA 1ULUA 2AQ8A 1WAMA 2YFHA 1WDLA 2VUSA 3GVCA 2BD0A 3ZH2A 1IZ0A 4IDDA 2HKIA 4RLSA 3WMWA 4I5DA 5KJFA 3UW3A 4OQZA 4YQYA 1Y8QB 3HSKA 4FOSA 3GVPA 1WDKA 2V6MA 1H6CA 3OBBA 4ALMA 4O5OA 4S3MA 1LDBA 2AW5A 2BFPA 1VJ0A 3PYXA 3VH1A 3RFVA 2NU9A 1R37A 1HRDA 4XJTA 3SJ7A 2Q2QA 1HDGO 2GASA 1I33A 1BW9B 2CDAA 3PHIA 1SO8A 3FCOA 3PQEA 5T64A 3ZCXA 4NHEA 4GMFA 4BNYA 4BV9A 1X15A 1GD1O 2O3UA 4WGGA 5LCXA 3GRPA 2ILTA 3KHUA 2JAPA 4GX2A 1C14A 5TJHA 2VUTA 3VZQA 3KSDO 2YV2A 1X7DA 5CEEA 1YQGA 4JP2A 3O9ZA 3GH3A 4HY3A 3W8DA 4BNLA 4J0EA 3VDRA 1B0AA 2EHDA 1A72A 3WGIA 4K9DA 2Y0DA 3ZWNA 4CUJA 4RDHA 1A5ZA 3LT1A 5HA5A 5ILGA 5KVVA 4IXWA 4OM8A 5IN5A 1ISMA 2ZQYA 1V3VA 4ALLA 5TLSA 1CDOA 3GVIA 2B4TO 4IDAA 3ZWWA 3PHJA 1Q0QA 3ANNA 1BXGA 2XF8A 1VL6A 2IZ0A 3OIDA 4FN4A 4LMRA 3VVBA 3V1UA 1ARZA 4BQRA 4TKMA 3PHHA 2FR1A 4IUYA 4NZ9A 4PLCA 1C1XB 4FS3A 3ULKA 4OL9A 4W9NA 1Q0HA 4YRAA 3QWAA 3RCBA 4CMEC 4E6PA 4IGFA 4J7CA 1LA2A 3H5RA 5A3VA 5L9AA 3AOGA 4Q9NA 4R1TA 3INRA 4WLOA 4HFRA 3I6QA 1FDVA 2ZQZA 4PLWA 1UUFA 4NR0A 2C20A 2O2SA 2GYYA 2NACA 2ZTMA 3QVTA 2DLDA 1CJCA 1MLDA 3EHEA 4DA9A 2NVBA 5A03A 4RPLA 3WGGA 1HE2A 4ZN6A 1GZ4A 1EFLA 1O5IA 5ER6A 1LLQA 2XPCA 1A4UA 4II2A 2FMUA 4RL6A 4CQMA 2ZB7A 4B3IA 4D42A 1ZFNA 3NDJA 2G1UA 2CDCA 2EGHA 2FPGA 3AUTA 2Z95A 4D43A 3UICA 3GOHA 3U3XA 4B4UA 3TF5A 1M6WA 2C7GA 4Z0HO 4OH1A 4NQZA 3NTRA 2P2SA 4RQUA 4FFNA 5TSDA 3HDQA 2YUTA 2AEJA 4FD3A 1WZIA 3HUDA 1M6HA 4FFLA 5KWEA 4B8ZA 4KWIA 2NTJA 5JO0A 2X5JO 4EEZA 3ADPA 2VHVA 1ZEMA 3BMCB 1ZO8A 4GLOA 3AOEA 4LGVA 3U09A 2HK7A 3ANMA 4BQPA 2P4QA 3IJPA 4PCVA 3UXYA 4PLZA 2UUOA 1X7HA 2VHYA 3I5MA 3G79A 4CMEA 3MJCA 2O3QA 2Q1SA 3CINA 4OXYA 4Q3AA 1DDOA 3KYDA 3T4XA 5T5QA 3RI3A 4RVUA 3QVWA 4R68A 3WIEA 4Q3CA 1YBVA 1VJTA 4FJ0A 4YJFB 4ZGWA 1SC6A 1LQTA 5THQA 4DMMA 1XELA 2DTEA 5FI5A 1C3VA 5GY7A 1HKUA 4XR9A 2WYWA 2V6GA 4WLVA 4U6QA 2OBNA 4PVCA 4E21A 1DB3A 3GUCA 4DIFA 3NYWA 4CUKA 2W90A 3ZNNA 4YAIA 5B1YA 2J3KA 2R00C 1P1IA 3JD2A 2C2YA 2I6TA 4ID9A 3CTMA 3L4BA 3M1AA 3GEMA 3VOSA 1RYEA 2Q1UA 1B8PA 2ZTVA 1E3WA 1ZK0A 2YQ4A 1V8BA 3DTYA 1XYGA 4AL4A 3GMSA 5EINA 3ZV3A 2QZ9A 2WD8A 2W2LA 5JCJD 5DCWA 4JXKA 4J1SA 1O0SA 1YBMA 3DEYX 1C0LA 1ADGA 4ALJA 1U5CA 1BGVA 1XA0A 2YHIA 5A5FA 1B8UA 1SB8A 4ZQEA 4CMBA 2E48A 2Y99A 3GLQA 4RVHA 4IJVA 4IJWA 4IJUA 1I24A 3IC5A 4AJ1A 4NBUA 4YAEA 3W8FA 2P9CA 3WGQA 5A9TA 5I8ZA 4Z9YA 4PLHA 3KUXA 1SPXA 3K96A 4EYEA 3UGKA 5TIIA 3JD1A 4XYBA 1SCUA 2RCYA 4FGWA 5ITVA 4E5MA 1ZMTA 4KUHA 1F12A 5TGDA 2NM0A 4NH4A 3JQ9C 4XIYA 1N2SA 4MIOA 1I3LA 1P31A 3PYLA 1ZSYA 4BNMA 2VHZA 1ZJYA 4GX5A 2B36A 3I9LA 1YS4A 2LDXA 1YQXA 4EZBA 3ONEA 3ROKA 2ZJ0A 2VQ3A 1PJLA 1ZJZA 2O50A 1KETA 3QP9A 5KJCA 4PZDA 2WTBA 3ZGYA 1H94A 3BHIA 4QO8A 4MVJE 2JFFA 3RUIA 4F3YA 4CLRA 1YB5A 4CLOA 2J6IA 2B69A 1NFFA 1EBFA 2Y1EA 4ZRNA 1OAAA 4BO9A 2G5CA 5DBIA 5I7SA 1Z75A 2GDZA 5C7IO 4AG3A 3PJDA 4BNGA 4BGVA 1DIHA 1HXHA 1ONNA 3S2IA 1NAIA 4L9RA 3DHEA 4JJIA 1RWBA 4DMLA 1VSVA 3MOIA 1QP8A 3EMKA 3OICA 5DP1A 3GEGA 3ZZNA 4EEXA 5H81A 3PEFA 4RV9A 3D0OA 1JVBA 2FN7A 4C7JA 2YJZA 3FR7A 4O1MA 2ZCVA 1KVUA 3TDKA 4ND4A 1GV1A 1UXJA 5K6AC 5L3ZA 1HYHA 2EWMA 3D5TA 3H8VA 3G1UA 5CAEA 1QKIA 2F00A 2CSUA 2Y0EA 1P3DA 2FPPA 4OGWA 2WE8A 5AVOA 3N74A 3AI1A 3BMQA 1U2GA 2YV1A 4Q3NA 1NX6A 2ZIZA 3BMCA 3GGOA 1OC2A 3AI3A 3GC6A 1DC5A 1GEEA 3BAZA 1P33A 1HZZA 4M8SA 2QG4A 1FK8A 2IEBA 3WFIA 2VCYA 3DMYA 1C0KA 4CPDA 3GNQA 3FNGA 2FHSA 6LDHA 2Q1TA 3WQRA 2ZATA 2NNLD 4EUHA 5KVQA 1YWGO 3X2FA 2A94A 3K5PA 2WYUA 4IDEA 8ADHA 2PD4A 1HDOA 2JKVA 3V2GA 1PZEA 1RPNA 4B79A 3GNSA 5I7FA 4FCCA 3VPXA 1Y7TA 1AXEA 2OFPA 3DAGA 5COAA 1TT5A 3RKUA 2E6UX 3GDFA 5C7OO 4QFDA 1ADFA 2OO5A 1XQ6A 3BTOA 3BMOA 4YWJA 3OF2A 1C0IA 4IDGA 3A28A 2IE0A 4DPLA 4DPKA 1FXSA 3U4DA 2PZLA 5CHEA 1K3TA 1QORA 4E0BA 4BHTA 1T25A 2IODA 3WWYA 1ZH8A 4R3NA 4RF4A 3KYCA 3LC2O 3AU9A 3L4BC 3F9IA 4DVJA 2Y1CA 4XRGA 3B1KA 2D2IA 1E7WA 1Z7BA 2R00A 4CM1A 4D0SA 3SVTA 1GPDG 4A26A 3JQ8B 3A1NA 3M6IA 4IZHA 2JFGA 3WNVA 5CG1A 2GO1A 2XXJA 3OA0A 4GPD1 3KV3O 2IRWA 1XKQA 1PGQA 2BKAA 3JQBC 3I9OA 4MO2A 3P19A 1ENZA 2NQTA 2EJVA 4B4WA 4E5NA 2BELA 1P0CA 4JP3A 5A3JA 4CQLA 3NTOA 4HNGA 3WFJA 3IP3A 1UP4A 1HT0A 4AFNA 2I3AA 3ZWOA 3DAPA 4F6LA 3F5SA 2DAPA 5GZ6A 2AG8A 1HLDA 3JYOA 1LX6A 2GLXA 4J3FA 3BZUA 4FW8A 1PZGA 2CFCA 3S1LA 2DFDA 1PX0A 3DMTA 1GV0A 4XIJA 4E32A 4CLXA 3E9MA 1MFZA 4YRDA 4BO2A 4I1IA 2FR0A 2PKQO 3C7CB 4NIMA 2C0CA 1HDCA 4LCEA 1ISJA 1I36A 1CQJA 3NEPX 4M87A 5COQA 4ZQHA 3IDSA 4RPHA 4CM6A 5GMOA 4BO6A 4IQ8A 5I8WA 4G81A 1BWSA 1BXKA 4FIZA 3C85A 4OKIA 4XA8A 4JJFA 4ZHSA 3GPIA 1NBOA 3DTTA 1KVRA 4J43A 4PG4A 4XCVA 1BDMA 4YJGA 1TVEA 3I4CA 2DUWA 4RLHA 1DBVO 3LC7O 3WYEA 1ENYA 3ONFA 4ND5A 3ADOA 3LC1O 1R4MA 2I5PO 1A7KA 1Z7EA 1R66A 4YB8A 2AXQA 3ENKA 2J5QA 4CLHA 1RM3A 3ITKA 3WB9A 4J1TA 1FJHA 4HXYA 4HUJA 4W6ZA 2NQ8A 4CLEA 1EMDA 1LRJA 4G2NA 3ZNPA 1MG0A 5A4DA 3PDUA 1PJQA 4JBIA 1LSSA 1WLYA 2NSDA 3U5TA 5T67A 2HUNA 3IUPA 3PLRA 5JNLA 2CUKA 3FHLA 3E5MA 4XDYA 4XGIA 1FMCA 5IZCA 4ZU3A 4UVGA 5GZ3A 5G0SA 3JYQA 4CODB 3H4VA 5AYVA 2OUIA 3PWKA 2AQIA 4YPOA 1Y81A 3KYDB 1D1TA 1GQQA 2O4UX 3ANLA 3CKYA 4UUNA 4WJZA 3WIDA 4XB1A 4F46A 4AJKA 1BRMA 1LBEA 2C7VA 4NBWA 5IN4A 1E3JA 2EGGA 4NFYA 1Y1PA 2FP4A 1LC0A 1JN0A 4NJOA 3FNHA 4CV3A 2RAFA 7ADHA 3K2BA 3H65A 1QYVA 1L7EA 1LTHR 3TSCA 2GZ3A 5FYDA 4UVDA 1ISFA 1EQ2A 2VTDA 2BFOA 3BXXA 3JYLA 4H3VA 4YTEA 1CRWG 3T7EA 1VL8A 4ILKA 2D1YA 3DZHA 2B0JA 1GTMA 3PJGA 4TROA 1Y9AA 4MINA 1PJTA 4R1UA 3ZNQA 3GT0A 1JAXA 2Q2VA 3IKVA 1U3WA 1NVGA 2OBYA 1KOLA 5KOIA 4M54A 1W73A 2OOSA 1A9ZA 1GQYA 3NV9A 3E18A 4BGEA 2AEFA 3G0OA 3H2SA 3F4BA 1EK6A 3G49A 4L0QA 2FRDA 4MVJA 3HDYA 1B16A 3LQFA 2X58A 4MIEA 3W6UA 4A5OA 5L7TA 1NM5A 5IDXA 2HQ1A 4BMNA 1H6DA 3VDQA 3AUUA 1KVQA 1TT7A 3GGGA 4U8GA 1GZ3A 4BKUA 1Y8RB 2Y93A 2DTDA 5CEFA 4KP7A 3WX0A 3GVHA 1HDZA 2FOIA 1IPEA 2YY7A 1ZXBA 3F47A 3PVZA 2JCYA 4NNJA 4BO3A 2Y68A 3AY6A 1NR1A 4OO3A 3FRJA 1EVZA 3AI2A 5JDCC 3LLVA 1XU7A 3F4LA 4E2WA 3TN7A 1NASA 3GR6A 1B7GO 3MWDB 3D7LA 1E3WB 3Q1LA 4U6SA 3ETGA 3M2TA 3WYCA 4O6VA 4DPMA 1JWAB 4TZKA 4EBFA 2QW8A 4AJHA 3AU8A 3PQDA 5JCXA 4I9NA 1GCUA 4CM8A 1JU9A 4CV2A 4PG7A 4YRBA 1CWUA 1Z82A 4YAKA 2CDBA 2EV9A 1V35A 3JQ7A 4BGUA 3PK0A 4M89A 4W99A 3VC7A 3DB2A 4WNCA 5BT9A 5CDGA 4GSKA 1UP6A 3SX2A 4ZVVA 1CIVA 3ZWYA 4Z0TA 3ZWVA 4R1SA 1SOWA 4E30A 3K6JA 3DZFA 1XDWA 3ASUA 4FJ1A 4EUEA 3DO5A 3WGTA 1R16A 1W8DA 3ONDA 3HJAA 2HJSA 3WLEA 1Z74A 4NU6A 2VTEA 4BNXA 1F8GA 1F14A 2V6BA 2NLOA 3ASVA 3GRKA 1U4OA 1HEUA 1MV8A 1N8KA 1H6AA 2GNAA 3I52A 2R2GA 2A92A 1GL3A 3V2HA 3WG9A 1SZJG 2VZ8A 4K6CA 4D46A 1NAHA 3SJUA 5MDHA 2I67A 4URFA 1DOHA 3BMOB 5EL0A 1UDBA 4ZRMA 2EG9A 4PG5A 1H2HA 3LF2A 3RIHA 4WK6A 2NTVA 4O59O 1OC4A 2J5RA 5DULA 3RUDA 1JA9A 4ZJUA 3ETDA 3S8MA 4GGPA 4MP8A 1MP0A 1TXGA 2QYSA 1Q1NA 1I3KA 2VT3A 1O95A 1M75A 3RUAA 4BO8A 5JAMA 4QQRA 1DO8A 1P1HA 1UJMA 1MGOA 4BNNA 2V7PA 2BFMA 3GN1A 3DZJA 5ENVA 3UCXA 3TQHA 4MVJF 4MP6A 1LLDA 3DBRA 4LISA 5I9LA 2HU2A 2FR8A 4R54A 1E1LA 1GUYA 3PWZA 3PFWO 2D5CA 4BO0A 3S55A 4ND1A 1H0KA 4CM5A 3PWSA 1T1RA 1ZCJA 1MFPA 4PG6A 1SBYA 3HADA 1OI7A 2H6EA 1I32A 5U1PA 3LT2A 5DN9A 1ZSNA 1L1FA 3JD0A 2POQX 3GVXA 4O0LA 1CQIA 3INTA 4IS3A 1JDJA 1WPQA 2X9GA 1DRVA 5DBFA 1E0DA 2HRZA 4CLRB 1LLCA 3GHHA 4NI5A 4CMHA 3I9NA 1CERA 4N7RA 3QQPA 2C54A 1U28A 4IBOA 2ET6A 4U0KA 1P1KA 3Q6IA 4BNHA 4IIUA 3B1JA 4JGBA 5K6AA 4GL4A 2CD9A 3JYPA 4I9UA 4NJMB 4J2OA 4NBTA 3O8QA 5CFZA 2BF7A 1X7GA 2E4AA 3DQPA 1ISGA 2V6FA 4GMGA 5T8KA 5IZ4A 1YJ8A 1J49A 2CY0A 4MKXA 4BNJA 4GLLA 4HWKA 2JD1A 2WE7A 1WW8A 2HDHA 4IQGA 1ZW1A 3ZU5A 4AJIA 1VKNA 4TMFA 3AFNA 4H7PA 1CF2O 2GRAA 1PJ4A 4PRKA 4H15A 4Y67A 1HSZA 3V8BA 1I2BA 2Y1FA 3TZKA 2Q50A 2ZKLA 3SEFA 4MIYA 3HNPA 1F06A 2OORA 2X7HA 2QYTA 4PFJA 1A7AA 1KVTA 3HB4X 4HV4A 3OSUA 1DAPA 1P77A 3NT5A 3ST7A 1GYQA 3MOGA 2YHUA 5CP8A 2QIOA 1SAYA 3WDSA 1EDOA 3RVDA 3LLSA 3VTFA 1PL8A 4OAQA 4OQYA 4AJPA 4NFHA 1T26A 4YEDA 5LC1A 3FF4A 1RJWA 1KERA 4QXMA 5IZCC 1WVGA 2Q46A 2O4CA 3ZWBA 2P5UA 3UN1A 3E48A 3JCZA 1HDYA 4PLGA 3F1LA 5HM8A 1CYDA 4JN6B 3PGXA 4W4TA 3FPLA 3QA9A 3TWOA 3LT4A 1XR3A 1QYCA 2VRCD 1K5HA 3ZU3A 3T7CA 3CEAA 3D1LA 4L76A 3R0IA 5IDWA 5T57A 2HMWA 5U4QA 5AOVA 3C1AA 4B8WA 1HTBA 3DZIA 1R6DA 3QVOA 5I9NA 4UUMA 2C82A 2OHXA 4CMCA 4DTIA 2O23A 5F1OA 4DQVA 1YL6A 5A9SA 3ENNA 5HS6A 2OP1A 4D3SA 2VYNA 2VRCA 4RVDA 4KQXA 2QRJA 4NJMA 4KTTE 3AM4A 1DIBA 1HETA 4GVXA 5TS3A 3Q9UA 1KBZA 3DOOA 4INAA 4J91A 1MC5A 2ZB4A 3D4NA 4NMHA 3SC4A 2BGMA 1FF9A 3DBHB 1JWBB 2NTNA 2W8ZA 1K6XA 4FC7A 4YJHA 4E2ZA 2B4QA 3COSA 3H5AA 4YT5A 4CL8A 4D45A 1NFRA 3KRTA 1G6KA 2BI8A 4DLBA 5C37A 3F46A 3RBXA 3WJAA 2IZZA 3WYBA 1D7OA 4H16A 3L6DA 3VTZA 1ZK2A 4HKTA 2C5AA 4JCOA 2PD3A
chains in the Genus database with same CATH superfamily
3INNA 3MHTA 1Z9BA 4F3CA 3ET5A 1KWKA 3U17A 1WPGA 4NDZA 1KA9H 3G2HA 5F5LA 4N82A 2Q8QA 3D0QA 3CG4A 2FSFA 1V0JA 3JRWA 3BREA 3GUZA 5COBA 5CNKA 5EZYF 5GWXA 1JDVA 3ZH9B 4D4GA 4J16A 2I4IA 1YDEA 3HJUA 1JEAA 1DUSA 3BHNA 1MEOA 3KYIB 3H7IA 3FCAA 4OMUA 4M9RA 2C3UA 2MSWA 1K5DA 4A03A 2PK3A 1MIHA 3DOIA 1QV6A 4GE0A 4L0CA 1RTKA 2BMWA 2ZPAA 1WUYA 1YZKA 3BD9A 3EVNA 4H7DA 3S27A 4ASUA 4TXHA 2PT5A 5J5VA 5TPZD 3LQKA 4KGVA 2C5EA 3CRW1 4MQBA 3F5QA 3FA2A 4YO7A 1O0BA 3KKEA 1ZOIA 2AFHB 1L4EA 2H92A 3MT7A 1NA5A 3N8GA 3P71T 3BD8A 3PRKE 4JR0A 3T35A 3D7KA 4TZTA 4CM9A 4Z3DA 1GQRA 3CE9A 4M83A 4RXTA 1TADA 1DV1A 1ZVKA 5KWIA 1JIXA 2YNMA 5TC4A 1MC8A 4WESA 2JLWA 1FFXB 1PX2A 3A3NA 1H93A 3NXSA 3TOVA 4JX8A 4DDUA 3TFOA 2ETVA 2DKOA 3PGJA 4KQIA 2XDYA 2Y1WA 2DY0A 3LSYA 3R7WB 2ZT5A 4P4GA 5B6IA 1D8TA 1Q83A 1FCJA 1THGA 2PMKA 4M46A 5FPKA 5AW3A 4XWAA 2XB2A 2H1IA 4DLYA 1DPGA 4CDMA 3JSXA 3AIOA 4DDHA 4FCVA 2I55A 4RH3A 2XRFA 3SKXA 3TW8A 4IF6A 5EZ6B 1PDVA 1YTLA 4LJLA 5EYPB 1CS0B 4BO1A 4FYWA 1Y7HA 4J1NA 3OURA 5EAIA 2XI4A 3OTQA 4BVLA 4BYMA 4QQKA 3TQSA 1ZICA 3Q8KA 1T1IA 4WK2B 5FCDA 4C7VA 4D5EA 1SELA 1BC5A 1LQUA 1EINA 2AQKA 3VOTA 1U9IC 2CVHA 2XQJA 2VHCA 3EJWA 3L0SA 3LCVB 4ONEA 1WCXA 3VJRA 1JL3A 4LDNA 3D81A 3L6EA 1YZFA 3JQ6A 1EFVB 1JSCA 1QOQB 4TQGA 1N1DA 5ITWA 3D8HA 2XIJA 1DKPA 2NTEA 3K09A 3DEIA 3OEEA 1ZYUA 5TQ2A 2Q6KA 4BQNA 1N2EA 2C7PA 3G2KA 1U02A 4KBGA 2OMEA 1SXJD 2B37A 2IP2A 3ISJA 3ZE6A 2V0GA 3K1JA 3EPJA 2WKPA 1I8TA 1CEQA 4G97A 1PZMA 1CJVC 4G07A 3F3SA 4MMXB 5FNZA 3USES 3M81A 4J4HA 5L8VA 3WLJA 2FKNA 1UJ6A 3IEMA 3RTDA 4IXDA 1WKCA 3O4IA 3QBTA 3GELA 4OK6A 1G8FA 3GV0A 3K0HA 4PFKA 1A9OA 1M7GA 2D5BA 3M3HA 4RL4A 4UAVA 4EJ6A 3KQVA 4IX1A 1N2ZA 5KQGA 4I5FA 2H54A 2KYRA 3E3AA 1U4SA 4JC8A 3N8IA 1FDTA 2A1UB 2QLLA 4E33A 4RFSB 2YBEA 4C4TA 1CS0A 1MQAA 1PNTA 1GZ6A 2PGJA 2RKBA 1TLLA 4WSOA 3RVOA 1YQDA 2JHPA 1D9ZA 3S44A 4G36A 1IAVA 3L7LA 3AEZA 1OBHA 3MN1A 3BSSA 4JOSA 1XQ1A 3NQ41 2BRUA 1IIRA 2H0AA 4BFXA 2VJAA 3CCFA 1W29A 3B6MA 2P8SA 4JLDA 4LNHA 3R7WA 3ZDQA 1QCDA 1WM1A 2YQ5A 3EC2A 1KORA 3IAXA 4KUEA 4FWBA 2HF7A 4NARA 4ISCA 1HFWA 1H9BA 3LWBA 1G8JA 1RKQA 1MB4A 3NNDA 3C6MA 4C87A 4B3GA 4FXOA 2I0FA 4EJMA 1DKMA 3M1LA 4CE6A 1GDHA 3PRHA 2JATA 2FWBA 3R5SA 2G4VA 3LSTA 3NVDA 3HMKA 3GPCA 3LQRA 1TMKA 1EWVA 3NHYA 4IL5A 3PIIA 4HQKA 5CLFA 3MTIA 1E5VA 3ED5A 1FU4A 4PS1A 3X3HA 1KEPA 3HEMA 4BX3A 3VI4B 3WR5A 3E9RA 3R9XA 5FWDA 1OZAA 3AGQA 5JNVA 4HDOB 2VQFB 2IH4A 5EHIA 1IEVA 2V45A 1J00A 5L4LA 1WCV1 3MD0A 3RGWS 1QONA 1WX1A 2YN4A 1P1JA 2RHBA 2W6OA 2CYBA 1YJXA 3HR8A 3WXBA 1AQUA 1RIFA 4NCNA 4UCXA 2P40A 5C35A 3BAFA 8OHMA 3P9QA 1IFXA 1DFIA 3B7PA 5FOUA 1ZRMA 2BF4A 3O38A 1SA0B 1N3BA 1LK0A 2PT6A 4D9MA 1MXFA 2AVDA 1XMJA 3KZKA 3DGFC 3MZ0A 4POAA 2JZCA 3WNCA 2QU8A 3PGA1 3CT4A 2C4UA 1G0NA 3I92A 4JV5B 4CDNA 1OU4A 1O6CA 1ZU4A 2WVGA 2YFQA 1GUFA 4N5HX 1PS9A 3KOWA 4D4IA 5HKKA 4PGGA 1AZLA 1NJGA 1R0KA 4LJRA 3CBQA 3H5TA 5EJ5A 3WK4A 2R44A 3W8NA 2CLOB 3BFJA 4AMGA 1EUZA 2CZQA 1R4MB 1VE7A 5L4SA 3SZOA 1A98A 3DZ8A 3L8DA 3DFZA 2BGUA 2IUYA 1WBJB 3SQOA 1NFQA 2VDLB 3CISA 3PB3A 4ER3A 1SD2A 2OV8A 1OXBB 1QDUA 2JCSA 2PMDA 3ESRA 3ON5A 5EJFA 1M8FA 1RRMA 2EEZA 2N3ZA 4QL3A 1HEIA 4YO8A 3UOGA 4EF5A 1NUSA 1ZC3A 3IQHX 2RBEA 4FFSA 1E5QA 1XZIA 3DEHA 1OW3B 1K92A 4M1TA 3V7NA 1OA1A 2WWRA 2Y2VA 1E3MA 3AERB 5EESA 621PA 5AVYA 1BX3A 3CY6A 1LTQA 2Y4NA 2ZB3A 3OKPA 1JTVA 2CGEA 1BD4A 1A4IA 5FUYA 1HC7A 4YRSA 3DFKA 2HV9A 2WD7B 2JG3A 4DYHA 4GP6A 2ZJ4A 3AZPA 1XLTC 4DNFA 1YQEA 3JQDA 4DJFC 1RYHA 1R3DA 3QFFA 4G8JA 3OQOA 1JE1A 4HWGA 5A7GA 2XB4A 2V96A 2WBLC 3FLAA 1UADA 1N2IA 1UBLS 3IHTA 3R24A 3VVCA 4CI0B 4EI7A 2PCJA 3T4UA 3TRJA 3UJPA 3NO4A 4W9MC 1SKAA 4AKIA 1QFJA 4H0CA 1E2NA 2PUTA 4R6XA 4DT1B 3ZLVA 3BUSA 4WCDA 2WMDA 5JO9A 4F6RA 1XVAA 4M0FA 4HVTA 1UEJA 4JXXA 3OMWA 1ECFA 4RDCA 4BMPB 3HUFA 2G4LA 4C5AA 4EKGA 3ROPA 1U2DC 2J9FB 2O7SA 3G17A 2Q29A 2CEAA 1JRLA 2VBIA 5HIJA 3A2NA 4J3NA 3WMEA 3DDUA 1YC2A 5BO5A 1OILA 3GY0A 1TZKA 4YRRA 1T4GA 1XJCA 1OLXA 2E82A 2R97A 1I3NA 1WD7A 1SCBA 2FAXA 2JHAA 4WECA 1BNCA 3QVLA 4GSLA 3H16A 4PRZA 3RHZA 1I1OA 1T6NA 2FE1A 2TYSB 1KEVA 4UTNA 3R5HA 5CGZA 5CUQA 4FFPA 2WB4A 6YASA 2HREA 1DC3A 3K20A 3W5AA 1LBQA 5HJEA 1FXUA 2FMFA 2XWJI 1JBKA 3MYYA 4UU7A 1G5HA 1PQYA 1RPTA 1BGXT 2PRZA 2NSHA 2QTHA 5G02A 3WICA 3DWFA 3A1WA 1GDDA 5JROA 5M7EA 3VA7A 3PHGA 3R23A 4LZLA 1J6UA 3WMRA 3O9MA 3ZCQA 3EDOA 4CKCB 2XCTB 2ZUCA 1OYVA 1SBTA 1Y48E 3GFTA 4PC3A 3TJRA 4DDKA 1R0YA 2JI7A 3I83A 1N6NA 3L77A 4OB8A 1T36A 3NT4A 3TXYA 1YVEI 1NNSA 5KUTA 2O0JA 1XZGA 1YD7A 3OA2A 2YW9A 1OE0A 3STYA 4BKQA 2EFJA 4DCOA 5K0EA 3OHMA 2FSIA 1RJDA 3DOHA 4PO8A 3JVEA 4BWVA 3KJXA 4DBZA 2L17A 4LA4A 3UCFA 1ZBDA 1JMYA 3R6WA 4Z4QA 1B3BA 1T2NA 1XQYA 3NUZA 1Q0LA 5J2UB 3NCTA 1VLZA 2JGLA 3T9BA 1NMYA 1I0IA 3PE3A 1Q7BA 1X8LA 4G9GA 1UBSB 3CNLA 3K3PA 4JD5A 2VWQA 3P9IA 3GEDA 4E2YA 2WTEA 1XZAA 1ZVMA 3ASZA 3IOBA 3EGWA 5EZQA 3OTGA 3G9UA 3DQZA 3ROXA 4F7WA 4HNVA 4E08A 4C0AC 3IP5A 1J4AA 1PD0A 4Y2TA 2WJGA 3OZTA 3LVFO 1EM8A 1HE5A 3LF1A 3PPXA 1KP9A 4UDYX 3UV6A 1XAHA 1CW2B 2EKLA 5FT9A 1Y4ZA 3RGGA 3RDPA 4OIMA 4S1PA 3H3XA 4JVSB 3BRQA 3TSOA 5BWBA 2NZVG 1TB4A 2GKSA 1UPBA 5HF5A 3UM9A 1L5FA 3OQBA 1BDIA 3TTYA 2CLDX 1S5PA 3W2EA 4BTLA 1B2RA 3G82C 4E1AA 3J7TA 3KLPX 2PLFA 3HB0A 5DEOA 5EJ2A 5C1OA 2I7XA 3OI7A 1OTYA 2OGTA 4P83A 4GL2A 5DT9A 2JGFA 4G9BA 3ZWAA 1GCIA 4EYSA 3BDIA 5TY0A 2EX4A 5J3JA 3D3WA 1K6IA 5IBPA 1RYBA 1C3OB 1KO1A 1TAHA 3G5TA 1ZMOA 3ZHYA 5J2UA 4OX9B 1RMQA 2WWWA 2IOQA 5L3VA 1GGJA 1U7HA 1HQCA 1JAZA 3DF9A 4OHCA 3DDSA 4B7CA 3D6UA 3ML1A 4OOEA 4JOBA 3KZVA 3SBDA 4M1KA 2HO5A 3HCEA 4B76A 4ZCRA 2Q4DA 3B70A 2QUHA 3JQ7B 3OQIA 1MA0A 3HPRA 4P3XA 1BMDA 1U7PA 2QL6A 2GJAA 3L0YA 5AOBA 3VAYA 2BZ1A 4KR2A 3I2YX 3ZN2A 2V6JA 2IEGA 4YCDA 4JI7B 3AJRA 1RLMA 4OJTA 5C1DA 4I4LA 1W36B 1GUBA 1M7HA 1NBEA 3QENA 4GR5A 3D6FA 5E2BA 2WM2A 1JKIA 4HFNA 4R0NA 3S2YA 1ZKMA 2I62A 1SHLA 3WGZA 5BSEA 3EGOA 5JUWA 3DT8A 1X7WA 1VRWA 3IURA 2R7NA 5AK6A 1FLAA 3TMAA 4K88A 3ZW8A 4IDOA 4F96A 1Z0DA 1W36D 3Q0TA 4GGOA 1NN0A 4HX2A 1KDOA 3R1IA 1VLVA 1GAXA 3N75A 5F33A 4UUBA 1RWKA 2DB3A 4H6XA 3IAHA 3PUYA 1Y37A 4S1WA 5IF3A 1JV2B 3E7XA 3JTEA 2XOXA 1NUQA 3CRZA 3AHEA 2GILA 2QRNA 3JATB 5A4JA 1WEKA 3KEQA 5B12A 5AIAA 4TXLA 1GPBA 4R1MA 1NQ5A 2GARA 3CUUA 1EBBA 3R4VA 4PX9A 3L41A 2TMDA 4BY9E 5TPZA 3A8TA 5AJHA 1TPYA 2FCRA 3HN2A 3QLUC 4C07A 4F8EA 4OBXA 4QTTB 5JQGB 1V6AA 1JFVA 1XRRA 2G7ZA 4MVJP 3OQPA 1IZ9A 4QM6A 3EPLA 1A1SA 2IHTA 2QM7A 4B6JA 4V3CA 2CCJA 1VHWA 4CM9D 5EE9A 1MTOA 2PD6A 2Y1LA 3DE2X 3MXOA 2B34A 5H9WA 1AN9A 4TRMA 1D8AA 3GLTA 1UPUA 5IDQA 5KX5F 2YNMD 3MWYW 1E9AA 4HJXA 2IXEA 3KKNA 1U0NA 2YC2C 5LLSA 3SBXA 3SHFA 1GGNA 4U4AA 1NJSA 2YMLA 5C18A 2WIFA 4HDRB 5K8UA 1YVRA 5F7ZA 4IX9A 5H7XA 4Y7CA 5F2EA 1CXZA 5EJIA 1ZD9A 3A4MA 4IIYA 4G5RA 4X63A 1KJNA 1J9ZA 3DTVB 1YIOA 4EELA 4XSGA 3K9GA 1M8KA 2PHZA 3GD5A 3OKCA 4KQ9A 1B14A 1KU0A 3VPHA 1Y33E 5JD4A 5LQNA 2HHCA 4F4JA 4FNOA 2YN0A 2O14A 3UK7A 4YWHA 2HX1A 2LKCA 2Q5HA 3QEMA 3ISTA 2I3GA 4H08A 3WI7A 4WPGA 3MMXA 4XUCA 4P80A 1QGUB 2HK8A 4C2AA 2D5IA 3LX5A 1NQWA 2WU3A 3JQCA 1YZLA 2R8EA 2CFSA 2ZM6B 4K81B 5L51A 5F51A 5IVKA 4IUCS 3R9KA 2CV1A 3KPJA 1VSUA 3TSYA 2N0SA 2JD0A 4TL9A 4XGRA 5AW0A 3T6KA 5L4NA 1EE9A 1H2XA 5DE3A 4ERNA 1IONA 2LCQA 1Z62A 1ADJA 4LVCA 1WUKS 2XE4A 1F8FA 4WJKB 3BN3A 1R4NA 3FFXA 4OU4A 3FPKA 4WVLA 3OOHA 3IVXA 4P8RA 4WERA 5AKIA 4MYDA 2OD7A 3SXJA 1M34B 4K6MA 3U7QA 1W36C 1PL6A 1YE5A 3EC7A 5EPOA 3QFTA 1UJBA 5KYUA 4OI0A 1XL0A 3PGVA 4NFSA 1UDXA 1BMFA 1SZDA 1W6RA 3O1IC 3OP4A 4G0OA 2DX7A 1CVIA 1I7LA 1Z8NA 2D8AA 1G5PA 1V8PA 2OBBA 2XVZA 2VWHA 1JEEA 1RZUA 2H2HA 1Y80A 4GHWA 1Z0ZA 4W5RA 3P2OA 3LP5A 3TBHA 1WXWA 2GN8A 4B7UA 1AGNA 4PNHA 3AWIA 2HWKA 3FWPA 1BVUA 5K2MA 2FR8C 3ER8A 4MGYR 4P7KA 1Z56C 2RGXA 2WI8A 3RS0A 2ESRA 2QVYX 1T3HA 2W4MA 2VNJA 1QGAA 1WLSA 4BQQA 3H3JA 4D9HA 3S8EA 1OUMA 2YDYA 4CIDA 1NC3A 2HHLA 3OKFA 3ZWQA 5HZGA 4KQMA 3EUWA 4X65B 4J0DA 4P4UA 2DPLA 3KZOA 2C4WA 1XZPA 2MIIA 2B5VA 1UM8A 3GG2A 2F7SA 3NHUA 1WHTB 4RENA 1Q21A 1XMOB 3VUEA 4LSMA 2Q3DA 2VP5A 3PJEA 1K2WA 4QFCA 3DTNA 5HXAA 4ZQBA 1L7PA 1MZVA 4XPZA 2B35A 2HLPA 1TO6A 5E0OA 4V1CI 2ZANA 5K0ZA 1TX4B 1ZMBA 2B5OA 2WLTA 5BOSA 1C7FA 3GU3A 1EPUA 3QWIA 4M7WA 3TD2A 5ALNA 1VPLA 3HC7A 1M2EA 1U80A 1X1EA 1A3CA 3D5QA 3P7MA 4LDQA 2TRSB 3UJBA 1BQ3A 4WEQA 4X1YA 4P35A 3C97A 1PJ2A 3L8HA 4YAJA 3Q12A 2XCIA 3OJLA 1JXOA 3W1EA 2CVFA 3CRMA 3T3IA 1HE4A 3D6JA 1WB4A 1NUTA 1N7JA 3OM9A 1W19A 3QU2A 4E3WA 4K03A 5LQCA 4CQMB 4U7WA 4WL0A 4UVIA 1RZRA 4N9QA 2H7XA 5KKCA 1P2VA 1Q17A 2I7VA 2G9UA 1JHMA 2JCXA 3GEEA 3FBTA 3KT0A 2YXPX 3ADBA 3EEQA 2QT1A 4ZK2A 5DLYA 2DQSA 2FZGA 2A1UA 3NGXA 1Z6ZA 1ZP6A 3OPVA 1JHAA 4X94A 3S1AB 1QH9A 3PNSA 4BNVA 4BRSA 3ZTYA 4C1BA 2HADA 4KLNA 5DNAA 1YUBA 4GM4A 3RYHA 4BBPA 3QEAZ 2AXNA 5IWCA 4LFBB 4KXVA 3ESZA 3O4GA 4WLEA 2UAGA 1CSEE 2IUEA 5KIAA 3HR7A 4Q3BA 1NKTA 1U1GA 1XTQA 1JKJB 3MMZA 3MRVA 3DE4X 6ADHA 3AVQA 1I4WA 2WA1A 3H9BA 1M6EX 1JHPA 1KZ1A 2GZ2A 3PC6A 1PQPA 3EH2A 1M8JA 3H18A 5G0TA 5CNMA 3U4MA 4M0DA 4YVFA 2B7CA 3JQRA 1MAVA 1KXJA 1TZBA 2AG5A 1XRQA 3BTSA 1PL0A 1E2LA 4JK3A 2ZTSA 1CUZA 5AVVA 1XPRA 4X1KB 1ZW6A 2BEJA 4L9WA 4IFEA 4QGHA 3ZQKA 2GF2A 4F1KA 1G8SA 1K6JA 1SWWA 2ZSEA 4HDNB 1DJNA 1GYRA 4OHWA 3WHIA 3RVNA 2IUUA 1KEWA 3TTXA 3KYBA 5AJYA 1ZGBA 1U2EA 4KXLA 4AY3A 2G70A 3FNBA 3I53A 4NQRA 2X9VA 1KO7A 2OCGA 2QZJA 3NFRA 2IE8A 4H0FA 5LDGA 5EJ9A 4K2AA 4Q05A 2YXDA 1VG0B 3MPUA 2P9GA 4KODA 3HWSA 5EIBC 1TD9A 2PO7A 4HI0E 4WCFA 4EHBA 1X13A 3PGLA 4QYIA 2BGKA 2F64A 5LMZA 2IX3A 3LU1A 3NIGB 4DFDA 4HVCA 2DLCX 2X3YA 2WC1A 3FMVA 3KIPA 4MULA 1CNMA 3VYTB 1Z34A 4TKUB 5LUAA 1AV6A 4RWZA 3BD6A 1SOVA 5BVGA 3KDPA 3QXCA 4XYEA 2UVDA 3GJSA 2Q4EA 2F3RA 4MQEB 3RG8A 3K4PA 5KTKA 1QS0B 1BFUA 1JVSA 1RQ7A 1Y0BA 1J20A 1QFZA 2AS0A 2VSNA 3I23A 3QKSB 4JIMA 4QBIA 2W70A 3T9EA 5JPCA 4DS3A 1MAAA 1WEHA 5A3SA 3IL2A 3Q1KA 4U7PB 2R8ZA 4BGIA 1N57A 4JWKA 4IYJA 1ZVVA 2GVDC 4UXJA 1J0AA 4ZODA 1T91A 1V43A 3MGAA 4YMWA 4YASA 5IT9A 1DEAA 2BTQB 2DFTA 2WUGA 3E8XA 1Y6ZA 4OXNA 5E1MA 3G23A 3B3GA 4N8EA 1Z0UA 1V47A 5CVVA 3EEYA 1T2EA 3U3MA 4YYZA 4R8VA 5UKDA 1E8MA 2JEOA 2QV0A 5LUBA 3SX4A 3ZHTA 4B09A 1H6BA 1N8NA 4PTLA 1Z0JA 2SKEA 3WY9A 2J9ZB 2QP4A 5TQJA 4D8YA 5DNUA 4RTOA 4NYJQ 5JHGB 2FZEA 4RDXA 3M8KA 1RBZA 1UT8A 2WF5A 3EPRA 2R6HA 5EIHA 3FOWA 1RPZA 3JYNA 4DLPA 4R05A 3SDZA 1YAHA 1TM3E 1Z8FA 3DWGA 3QKWA 4U9IS 1CUAA 3LVBA 4TLEA 3PQ4A 2UYGA 5JASA 1HUQA 9LDBA 2ZRHA 4L6AA 4MKGA 1KEUA 3NP9A 4MS3A 4X9XA 5HRUA 5FNVB 4NOMA 1R9GA 1ESCA 2DPMA 4L8YA 2VQDA 4H6VA 4TQ9A 5JMWA 4LNAA 4EGQA 4LZJA 3MTBA 1R1DA 4EJFA 1NBMA 3PKJA 1UJ4A 5CNIA 5G1OA 2NNWB 5ICMA 1MW8X 5BSMA 4J4BA 1UANA 1Z17A 2VFAA 3ITDA 2KM1A 4C7KA 3DP9A 3TL2A 3MQ2A 4RK7A 3ABIA 5CLHA 2F4VB 1HT1E 4Q18A 4EB8A 1Y63A 1T3TA 3D6HA 3K1AB 1N6HA 4NK4A 1H2ZA 4ETNA 5B37A 1ZL0A 2ZM5A 3JPWA 1XF1A 1YRWA 3KJGA 2WJIA 2ODAA 4RHEA 4WKCA 1OXKB 3E03A 4RTRA 3ZCVA 1U8FO 3DFUA 4D74A 4DLZA 2JGEA 1FYVA 2KQUA 3ENWA 3H0KA 3UNXA 5K6RA 3QVMA 4IKPA 3SYRA 4Z3OA 2CV0A 2GPYA 1NLYA 1RKBA 5CB0A 4B46A 2O0KA 1WD5A 4C05A 5KJ6A 4ITRC 3OH8A 1BCRB 4F97A 5EMNA 5DGCA 3GAZA 5LB4A 2G0TA 4HSEA 2Q5IA 1NYTA 3AEQB 5D3KA 3URKA 1OAOC 3KSZO 1KJIA 2Q6VA 1XKXA 3BFXA 4FLFA 3UKJA 1NSYA 2EJBA 5EIFA 5AVSA 4UBNA 1E4YA 5LXTB 5KQSA 1KAGA 5GJWC 4KO2S 1E6MA 4OYHA 1QANA 1QQ6A 4UNPA 2AN4A 1CUUA 3UK6A 4N0DA 1NW7A 3SQMA 4B34A 2CXPA 3OG9A 4NENB 4WCFB 4BDTA 2O3RA 4C7BA 5AQ1A 1HNWB 3OE4A 1LK7A 4TYNA 2CF6A 5KYYA 5F12A 4BNTA 2IDZA 1V39A 3EBPA 4GWGA 3ZKWB 5BV2P 2B2NA 4ON9A 3UYKA 2UUBB 3WXMA 2B4AA 2TMYA 3AV3A 4L27A 2GTHA 1RHUA 4H0NA 4ARZA 4II3A 5FAKA 4HNAA 4IFTA 1SCUB 3KQNA 4AY6A 1KY5A 4BXOB 4M9SA 2PM8A 4Q9LA 2XA9A 3EAQA 4HH0A 4UULA 1NI4B 3B9PA 4X54A 2G5PA 3SBEA 3TI7A 4TYQA 3FZNA 1IY2A 4LGMA 3H1AA 5FEMA 1KOJA 2A9RA 3ZVNA 1L4BA 4R2JA 3KVRA 4OCZA 3UCEA 3ZY4A 3MM4A 4MEBA 1SUPA 1XU9A 1IK6A 3VFDA 4HEHA 5BNZA 2EEPA 4QVKA 3MEQA 1ZM7A 4QYSA 4PQYA 5C8XA 1E60A 3A32A 1XCPA 1U8ZA 4JYCA 4BLSA 4PN3A 3NHZA 4R51A 1ETHA 5G40A 1TYBE 4JYZA 5EPEA 1AGPA 2IV2X 3I72A 2O2ZA 4HVAA 2OZPA 4XAQA 4XWOA 3EZ7A 2ZRMA 3IKMB 3QUCA 1G8YA 4KO4S 3R3XA 1FP4B 3CR8A 3STUA 4EFLA 4UEOA 1MJFA 1EX9A 2HIMA 4ZICA 1NR7A 4ABTA 4R1PA 4ZQCB 5E38A 5GZ1A 3HDHA 1N36B 4M0EA 5KOJB 1JDBB 1PL7A 3E2IA 4G67A 4WZAB 3ROZA 3NWEA 5LN1A 3S1AA 2GXAA 3REFA 2O48X 1RS0A 4PLTA 2QRMA 4YRCA 5H8WA 4WA7A 2YFYA 2ZR0A 4V0QA 4RKRA 5CLIA 3IV6A 1A96A 1A4XA 5KCMA 2HSWA 3TQFA 1R5JA 5K0JA 1KDYA 3CVYA 1C1YA 4IILA 2GYVA 1EHIA 2JAQA 1JNXX 3N2KB 3RWOA 3U0VA 1Z4PX 1ABEA 1LEHA 3KQYA 4LWOA 5DM4A 2P75A 4B4KA 5CPFA 3GROA 1BOFA 2ZK7A 2Z43A 1LNZA 1WCWA 3I4FA 4WE3A 1CTQA 3TFQA 4PANA 3GJQA 1FP2A 5L53A 4O3MA 3BJRA 5A6VA 2QQ0A 4TLAA 3VPBA 4DG5A 4WKBA 3AR6A 1AHIA 4CF3A 3CLSD 1SQ0A 4K9SA 4RGVA 3SR3A 4N54A 4JYBA 4OSEA 4G8DA 1PQUA 3X43A 4EZEA 3HVKA 1WHTA 3MFQA 1F8XA 1WF3A 2UDPA 3GFGA 1KQ3A 2X0IA 1G3IA 3ROEA 2AMLA 2JAUA 1KWGA 1IQUA 4IGEA 5E1DA 4A6DA 4PLVA 1LUAA 2EW8A 2K4MA 4AJOA 3CH4B 2M6SA 3GLIE 3NAQA 4GYKA 1A5SB 1HEYA 3CEJA 2EAUA 3C4QA 2R8XA 3BL8A 1WSBA 3DQQA 1NVWQ 1OKKD 2VRBA 4M76B 5DVZA 1D07A 1JZTA 4PQGA 5CDUA 5LM3A 2LDBA 3V1NA 2HY7A 3GB9A 3OJ0A 2XVYA 4JQZA 4LQ4A 4O4JB 1UMDB 3H5VA 3KUKA 1FRZA 3GA0A 4HX5A 3K6KA 3CW8X 5H70A 4XZ3A 1OIWA 4XX1A 1BSVA 3RROA 2OXRA 1NQOA 2WJ4A 5KYXA 3LH5A 3DEAA 2YZ7A 1VP3A 2XZOA 2WNHA 4UCWA 3AKEA 3KQQA 4PGHA 2QZ4A 1VJ1A 3EWAA 1QK3A 5AH0A 1G9TA 4ZAWA 4NZOA 2WF6A 1WUIS 1T8YA 5HE8A 2H5LA 1STOA 3T3PB 2ZJAA 1QMPA 5JXWA 2V97A 3CRNA 2Y8EA 3RS3A 4ARSA 2VSQA 1G63A 4DR6B 1LKZA 4Z9FA 4ZYVA 1THTA 5I7HA 3HKBA 1TU3A 3TEFA 4AKGA 3JQBA 3FKSD 4CIVA 1KZ4A 4M3NA 5EMLA 2BFCA 3K2IA 4RAOA 3E3NA 1FQOA 4GMHA 5CM2Z 5ELMA 5ADHA 5FUMA 5LNK1 3K7EA 4DCSA 1SUCA 5JPIA 1CHDA 1CZKA 3PQ2A 2WF8A 2G5TA 2NQ2C 3DAYA 2DR0A 3RV3A 3JAWA 4IZ6A 1JLHA 2GA9A 3Q41A 5EIEA 2AOTA 5DOZA 4CQMD 1DSSG 5CB4F 1BYIA 1JHUA 2YC4C 4MEAA 1QZTA 3QUSA 4R84A 1V1JA 3PP8A 2ZIWB 1JT2A 1DOZA 1QBKC 1W6UA 3CPJB 1Y6FA 1NE2A 3JR7A 3WB0A 2ID8A 5F4BA 1EQAA 1GGFA 1LLUA 1YKFA 4D9FA 2RB4A 5B58T 4D98A 5DTIA 1QRSA 2CB0A 2BUAA 3SPXA 4ZYWA 4GGMX 2HV8A 4UBMA 3K9HA 4RPIA 2MSKA 3QWBA 4QBHA 5AM2A 3E61A 3R3ZA 3DVQX 1LI5A 2IYFA 3S2EA 1A1VA 4K6OA 1RYDA 3RTGA 3BICA 3VU9A 4RTQA 3K9NA 2IXTA 1V16B 4LFCB 4I1PA 5IUNC 2WIJA 3OIWA 3N2GA 4TTRA 1HL3A 3D31A 3FMIA 2D2VA 1RM4A 3PFIA 3T5DA 1SM4A 3DKPA 3CURA 2VTBB 2VR1A 4CFYA 1ADCA 3TLJA 2PY6A 4CHTA 3KOYA 1YE3A 1KBOA 4LJ4A 2GN9A 2EKPA 1K3UB 2BKLA 2NIPA 1CD5A 4LK3A 3ZBQA 2Q0SA 5HIKA 1EFKA 1SPBS 4YMSA 4GUDA 3LECA 1NHGA 4EG0A 2KS6A 1DT3A 2HA3A 1O9HA 4DC0A 3S40A 1OH5A 4DABA 3QVJA 3VH4A 2NUAA 3FR8A 3KL2A 4YMVA 4RTJA 3LYLA 3EIXA 2GPAA 2LCIA 1VLLA 4HB3A 3AGPA 3SYNA 4F85A 3BT7A 3EY4A 5EP2A 1H3NA 1KJ9A 2H11A 2FRXA 3HUTA 1X7WB 4PCAA 1JKFA 4U5QA 5J23A 4I5EA 2DQKA 3N7AA 4TTVA 3INGA 4AG6A 5I7VA 3FDZA 2VPYA 4P4TA 5AHKA 2VYFA 3HBFA 3COJA 3Q8WA 4ZT5A 3OMXA 4FDTA 3LM8A 4BIIA 4OHFA 2XUAA 1VI5A 5K0LA 4CLDA 1VZ3A 4M0CA 4MR7B 3AJDA 1H69A 3TZHA 1UJ2A 7REQB 3ETLA 5G4KB 3L7IA 3ZWMA 2RJNA 4FYXA 2QA5A 5ESDA 3EXHA 2HDWA 3LDAA 3NV7A 5I9TA 5EXSA 4YRKA 3SHTA 1PTJA 1DBPA 1GPJA 5HK8A 4D3FA 2ANBA 3FUUA 4BX2A 3ZI7A 2YN2A 3F73A 3A1SA 4LPSA 5CTJA 4ZEMA 3K70C 3B2NA 1YCGA 2Z2YA 2I8CA 1VL5A 4AU1A 1RTTA 4DNPA 2EWVA 1IQRA 1P1RA 3R5XA 2C9OA 4ESOA 1CY2A 4IDCA 2XE7A 3F6PA 3H13A 2CMKA 3V4RA 3VRHA 2BCGY 4XFKA 4QTXA 3KBOA 4YHHB 3OC0A 4M98A 4KIWA 4EPXA 3FOCA 4W5TA 1NR5A 2NU8A 3GMIA 2EFCB 1KDTA 3FWZA 4MVJI 5JXIA 1JEYA 1Z29A 4BB5A 1IY8A 1NC1A 2DBZA 2FFQA 3PNBA 4MDYA 3JWPA 3GAAA 2Z8YM 2YWGA 1K7FB 4N6GA 4GBJA 3WBFA 5ILOA 1Q3TA 3LW8A 1G8MA 1K1EA 5DW3A 5DNCA 5K8LA 4HYQA 2SKCA 1ZGJA 3DC7A 2IZ6A 1VA5A 3IV7A 2YZGA 3THRA 2PUBA 1T3LA 2H9AA 4YV1A 2DBYA 2ZQ5A 2H65A 2LP4Y 2XAAA 3FLMA 3OETA 5FTMA 2O1EA 2OZLB 2YOGA 1AF7A 1FUUA 4UOEA 1JZSA 1PVOA 3QPUA 2GK7A 4OGKA 3SCZA 2PZJA 1T43A 1ZJ5A 4LGYA 2P6RA 1VRCA 1OFUX 2IIBA 4I9HA 3K72B 4LDRA 4RIFA 4DMFA 2OGUA 4DMGA 4XVCA 4MRMB 3NATA 3LOPA 3AWDA 5B4UA 3UWOA 1X3SA 2BM1A 4XYMA 4I08A 5BUQA 3QOYA 2Q5CA 2LRHA 3NBMA 1VL0A 4M9UA 4N39A 3WNDA 3V42A 3VMFA 3NHAA 4WN9A 1P0MA 1VYTA 4YROA 4BQOA 2ZU6A 4QECA 4ID3A 1KMIY 3C8HA 1Z7GA 4G8BA 2IPOA 3BEOA 2YCLA 4KKXB 3JVVA 1QB8A 4CHGA 1KAEA 4CKEA 1DX6A 3D6TB 1IOZA 2ORYA 5GM1A 3S70A 4OXXA 1XRJA 2ZSJA 3RS7A 4BVBA 4K9NA 1IRXA 4A92A 4DCVA 1G20E 5BVHB 2AIRA 1GR0A 2DT5A 2ECQA 1DVRA 2VJPA 4PSUA 2DM6A 4ZARA 2OT3B 3T12A 5A5EA 1ZUWA 2P2ZA 4YDHB 1XN1A 2JIMA 2QL7A 2YDXA 4OX9Y 3VC3A 1S3GA 4D44A 2QROA 1Q3HA 3M6FA 1FL9A 2IEIA 2WFAA 2W6MA 3FWNA 2D0IA 2ZYSA 3OCCA 4Y1EA 2HXYA 4KXQA 5AM1A 5HF9A 3DMTC 4GE3A 3G5MA 5CT9A 1DARA 1MORA 1RI5A 4XB2A 2A9OA 1H42A 3GWGA 3HYSA 3IHLA 4XSVA 1XTUA 2FZ5A 4OHUA 2Z4TA 3QVXA 4Z7OB 5JY6A 4MRRA 3HXOA 2GPJA 1JH8A 2H18A 3AUXA 4M0LA 4QIHA 3UMFA 4IOLA 3SYKA 1CJUC 4WZ6A 3EQ6A 4RTLA 3AL3A 3P96A 1OX4A 1M2WA 2BSAA 4PGFA 3E5RA 1UQTA 2D1FA 4N01A 3RC7A 4Z54A 4MR8A 2XMQA 2DHEA 3H2ZA 4BNFA 5JTTA 3WTBA 1CUYA 2HZBA 2Y77A 1EU1A 3B5IA 3BIOA 3QTLA 2FUEA 3EAFA 4ZOEA 4DIUA 2G63A 2AYZA 4IOJA 1SD1A 2ZDGA 4Q93A 2QN3A 3DBLA 3DUFB 3GXOA 1SURA 3O74A 3GLIA 3RAEC 1J90A 3KU4A 4IV8A 5CT5A 3EYWA 3WGYA 1FDIA 4MARA 4EABA 4WCFC 3JQAA 2ZWVA 1RWQA 1VKJA 1W87A 1QUEA 1C1XA 1ULTA 1VHQA 4H6WA 4LMPA 3U1TA 4EGSA 1O9GA 1BCRA 4G4SO 3LBAA 2NT4A 1JBQA 5IULC 1A5AB 5BSWA 4QPNA 4LWQA 3OFVA 4Q1CA 2B92A 5DHFA 3VR5H 4L6IA 1KEEA 4HAIA 2JI9A 4OQMA 3T0IA 5SY4A 2JHGA 5E6RA 1VKZA 5BSRA 2XH8A 2GKOA 3UFXA 2ZI4A 2QLMA 3KFVA 1VDZA 5FPPA 3B78A 2RHLA 3KXPA 4B3TB 2GT1A 1ESNA 2YXEA 3PYMA 4LTNA 2GCOA 1M67A 1L3IA 3AKCA 4FHFA 4L95C 5EN4A 3B82A 3IUEA 4XYGA 1E9CA 1E20A 1JMKC 1UMCA 2R25B 2O07A 1C9JA 4HDMB 4BB0A 1Z06A 4JHXA 4Z2YA 4OYYA 2C1EA 3TL3A 4NEGA 5I9MA 4R9VA 5EWMB 2IYQA 2GAOA 4REQB 5CK4A 1WXIA 5G1NA 3O84A 3ZYZA 5KC9A 4GKBA 4GLBA 3TRIA 3RIGA 1B1AA 2BI4A 3R75A 3C7KA 5AI0A 3Q3IA 1Z8HA 4GYJA 4TSKA 2GBLA 3KR1A 4WNIA 4B75A 5CCDA 1BXZA 1K5GA 4ZC1A 5IYZF 4D5GA 3WIUA 5DK6A 2AQ8A 1N6OA 4U8HA 3WLMA 2AKYA 2Q9CA 1N3YA 3T3NA 4ZV4A 3GVCA 2BKUA 5DKFA 2BD0A 3F5FA 2VHQA 4CF5A 1AU9A 2ZSIA 3A25A 3EQ2A 4C0SA 3WMWA 1GZHB 2JLQA 3ZIAA 2AC4A 1QC5A 1MJNA 2ZI7A 3LKZA 3LY7A 2X2EA 5BRJA 3EPKA 3HVUA 5I45A 3GPLA 3B52X 3FSEA 4FOSA 2WSIA 3AETB 1J8QA 1NATA 1WRBA 1FVXA 2RBKA 2QRHA 3DOFA 1BEZA 5IT0A 4G63A 2AW5A 3X1JA 2BFPA 4YDQA 2O8BB 1K7SN 4M6WA 2R60A 4RE6A 3LL4A 1VE5A 3FVRA 1GGVA 4UTZA 3FVTA 3A0UA 3E35A 4RD1A 3NBYC 3A6LA 1HDGO 1CX9B 2M6LA 3IXLA 2YJ4A 1NXOA 1N25A 1QHNA 2VCEA 3FCOA 1BCSA 3ID6C 3LKVA 4HEJA 1L9KA 1GD1O 1J09A 1QIIA 3RSLA 3V4SA 1NXPA 4KE6A 2EZ8A 1L7VC 1GPLA 3RE1A 2JAPA 2BJHA 1OROA 3REQA 4B33A 4Q9JA 3MUOA 1M2GA 3OHPA 4WNAB 3PXGA 2SCUB 4JP2A 3GD7A 1MH1A 3VU0A 3F2IA 4TL6A 5IJ0B 1ITZA 4Q9AA 3WGIA 3AMVA 1E79A 1ABFA 5KVVA 4HWSA 2C3MA 2Y0DA 9MHTA 1G4HA 2OEPA 2XD9A 3NOVA 5DLPA 3KELA 2WP0A 4Y1RA 5ELXA 1D4OA 2XE6A 1AKVA 2SICE 5HA5A 4GUAA 2Y71A 4IXWA 2QMYA 5ILGA 1DAMA 1DJPA 2PWAA 5SZKB 4FSDA 3A04A 5IAGA 1ISMA 4V1CA 4N03A 3V7FA 4BJ3A 1Q14A 4OY3A 1P29A 3AHFA 3SFTA 1CDOA 1GZ7A 3GVIA 4IDAA 1ZH4A 1PR2A 2ALJA 2Q5FA 2AN3A 3CX8A 3PHJA 3FCSB 4HZIA 4W1RA 3ANNA 4HXFB 4LWZA 1NOKA 5BYAA 2BIFA 1S8NA 2VT6A 3ASYA 3NALA 2ZYVX 3ZCPA 1NBME 4LMRA 4A8HA 3N39C 1ARZA 4EJSA 4KFCA 1G2QA 1N2JA 1QF9A 2AR9A 2FDCA 4FS3A 2G6BA 1EGVB 2RMKA 2W8BB 2NZYA 3HCBA 2C77A 2HJWA 5ENZA 5HBGA 3F8WA 1Y8AA 1K6MA 4MQ5A 4Q9NA 4UMFA 2C88A 4Y1RB 3QLEA 4EX7A 5I9IA 1AQIA 2ID4A 3AP3A 3IAFA 1QVZA 4NR0A 2IWHA 1VKHA 5CVCA 3UJAA 1YUMA 1XT6A 2KX7A 3FYDA 4RXMA 5EY5B 4TWAA 1M0WA 2GEVA 2FN8A 4XPIB 3EHEA 1ILEA 1UWCA 1WHSB 2AXEA 3AF0A 4OI1A 1B43A 1G9SA 5EYPA 3ZG6A 1JDZA 1MC1A