1QBGA

Crystal structure of human dt-diaphorase (nad(p)h oxidoreductase)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
272
Chain Sequence
VRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H DEHYDROGENASE [QUINONE] 1
publication title Crystal structure of human DT-diaphorase: a model for interaction with the cytotoxic prodrug 5-(aziridin-1-yl)-2,4-dinitrobenzamide (CB1954).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 83
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 1999-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qbgA00
2X2OA 4YAWA 4QODA 1TIKA 1D03A 1J9EA 2MWMA 3B6KA 3HR4A 1JA0A 4DY4A 4Y7CA 3NHLA 1FTGA 1SG0A 1OBOA 1RTTA 3HA2A 2XOEA 4PTZA 2QX4A 2M6RA 1FLAA 2W5UA 2HNAA 2V9CA 4LTNA 4ZVMA 3W78A 1YCFA 2MT9A 3LCMA 2F1OA 4ZVLA 4ESEA 4D02A 3EDOA 3OWHA 5LBUA 3F90A 3TE7A 3QFCA 3FW1A 2QMYA 4YAFA 3OX2A 3UXHA 2BPOA 3P0RA 4QOJA 1ZWKA 1CZKA 1XYVA 3GFRA 2BN4A 3GFSA 2HNBA 2OHIA 4J8PA 3KAQA 1ZWLA 2FX2A 2FZ5A 1FVXA 2FCRA 2QMZA 3LT5A 4FGLA 4LAFA 4U7FA 5BUCA 1QHEA 1TLLA 2OYSA 1CZOA 2D5IA 4DILA 1WSWA 4FGJA 3B6IA 3KLBA 4LTMA 2B3DA 1CZNA 5NULA 4LTDA 5FA6A 2FOXA 1H66A 1T0IA 3NHUA 3B6MA 4N82A 4C0WA 1AKRA 1KBQA 2R97A 2KLBA 5F4BA 1C7FA 3RPEA 1CZRA 3G5MA 2KQUA 3NHWA 4S24A 2FZVA 1JA1A 5LMCA 1AHNA 1XYYA 1AKTA 1YOBA 1DX9A 3N3BC 1AKVA 2Z9CA 4QOFA 3TZBA 1YRHA 1RLJA 1CZUA 1BU5A 1ZX1A 4N65A 4NULA 4XDGA 1C7EA 3ESXA 2WC1A 3OJXA 5EMNA 4CF6A 2Z9BA 3L9WA 4GQIA 1NNI1 3KAPA 2X2PA 3NLLA 3SVLA 1XT6A 2OHJA 3O73A 4GR9A 2Q9UA 1D4AA 1WSBA 1QR2A 3OVMA 5F12A 4QOGA 1V4BA 1H69A 3F6SA 3N39C 4ZVNA 3B6JA 2BZSA 1SQSA 2QX8A 3NHRA 2M6SA 3D7NA 3OJWA 3W77A 1OFVA 3FX2A 3QE2A 4R81A 3S2YA 4PTYA 1E5DA 1YDGA 3UXEA 1J9ZA 1I1OA 3FNIA 2MTBA 3KEGA 1X77A 3K1YA 3NHJA 5LVAA 3HLYA 2FAXA 1OBVA 3N3AC 5EAIA 5F51A 4F8YA 4Y9RA 3O2NA 5TGZA 5FUQA 2A5LA 3ESYA 2FVXA 1AKWA 1B1CA 3K20A 3OX3A 2V5UA 3FJOA 3NFRA 4YAOA 4BMOB 2N1MA 1J9GA 3JSXA 4DIKA 1AZLA 5NLLA 3GAMA 1FLVA 4ICIA 3ESZA 4HEQA 1DXQA 4LA4A 4QOEA 2BMVA 2ZKIA 2FLVA 4QOHA 4YQEA 4U7GA 1AKQA 1AMOA 3ZHOA 2OHHA 2HPVA 3U7RA 2AMJA 2Z98A 3FVWA 3W7AA 2ARKA 4N9QA 3U7IA 1FX1A 5ULLA 5LBTA 4FX2A 1CZLA 4HS4A 1KBOA 2R96A 4H6PA 2QX9A 5B3LA 3ES9A 4OXXA 4CETA 1QBGA 3R6WA 1XI2A 3TEMA 5FX2A 3NHSA 1J8QA 3QFRA 4C76A 3EYWA 4ZVKA 3OWXA 2QWXA 5A4KA 5LJLA 2MOKA 1CZHA 4M0CA 1BVYF 1AKUA 1DXOA 2V5VA 4GI5A 1FLNA 2FDXA 2XODA 1QRDA 4FGKA 4QOIA 2QX6A 3W79A 2RG1A 3NHPA 4C14A 5JROA 5LJIA 4BMPB 5B3KA 5LLDA 3GFQA 3NHFA 3NHYA 4NLLA 3OX1A 1AG9A 4XDHA 1F4PA 2QR2A 3NHKA 2BF4A 1YCHA 2GSWA 1D04A 4YALA 5EA2A 2Q62A 1T5BA 6NULA 1VMEA 3F2VA 4C0XA 1GG5A 1YCGA 1RLIA 1RCFA 2Z9DA 3L9XA 4H2DA 4U7HA 3F6RA 4PU0A 4YAUA 1FLDA 1FUEA 1YKGA 4Y9UA
chains in the Genus database with same CATH superfamily
3R7LA 1NIPA 4MR9B 4Q4HB 2BR3A 2CLSA 4BX0A 1SD1A 1WKCA 3ONEA 3AM5A 4TXNA 4R9NA 3CVVA 5E4JA 3B53X 1NKTA 3PICA 2XT9A 3W6ZA 4DR6B 1V6SA 2D7CA 4UU8A 2CE2X 2WFMA 4JP2A 4QBIA 5TGDA 2RGWA 2ZIZA 5BR7A 2H31A 4ZCIA 1LS6A 5LU9A 4QBFA 1T1RA 3H6KA 3NT4A 1HYQA 4FK8A 5FBRB 3ONDA 5F3DA 3M33A 1G291 3DE5X 3DOEA 3GOHA 4WQMA 3W5HA 1OH7A 1R0BA 1QZUA 3VO2A 2YJ6A 4TS1A 421PA 4G1VA 1R00A 3TCXB 2EBUA 3HB0A 3G68A 1CUXA 1PWEA 3ILVA 3ONNA 3ZXSA 2GO7A 4I9GA 3BX1A 2RCNA 1EVJA 1F9EA 3H1FA 5EHQA 4YRIA 5JNLA 3P9RA 1V8DA 3S5UA 3CU5A 1SCIA 3LW8A 4EX7A 4QICA 1ZQ1A 5JNUA 2PGOA 5DV9A 4A82A 2VDMB 1X87A 2JJ8A 5DW3A 5FP0A 4ZYTA 1VJ5A 2QL9A 2XY4A 1MG5A 1FJ2A 2EQAA 2DE0X 4MVJD 1Q95A 1QR2A 1W0KA 2W2LD 2JKZA 2ZBEA 1IBSA 4XH9B 1PAUA 3VR0A 3KYCB 1MJGM 2PVCA 4DQKA 4OXKA 3T4PA 1W29A 5A6SB 1NL3A 1DSSG 1JQKA 1PX0A 4IW3B 3RUFA 5IVDA 2R4UA 5DRYA 3AUJB 2A33A 2CJXA 3L7JA 1FA9A 1P39A 2G72A 2FMKA 2I66A 2J33A 1JIQA 3FR7A 3KVYA 1DX6A 4M2LA 3BVPA 4NL4H 3TLXA 4WASA 1DBPA 3GFPA 3AV0B 2D4AA 1HTBA 4P4UA 1U4NA 4FVTA 4WBNA 1H4QA 2J0UA 1HK7A 2PMEA 2DWOA 4C20A 2WNIA 1W8IA 3P9ZA 2E4VA 4LA4A 4LC0A 4NEHB 4O2BA 4OXYA 3T5MA 4QUHA 1EDDA 3R0VA 2GESA 1PL8A 3GBPA 3LWNA 1YT5A 3U7RA 2FP4B 3DAOA 2FWNA 3HN2A 4X1IB 4Q6BA 5IBQA 5CFZA 4D1YA 4Q4JB 1JLLA 3LUCA 1E1RD 4PGAA 1B00A 3STVA 4DC1A 1CJMA 2NU6A 3FR8A 1WKBA 5KWVA 3U09A 2JLXA 4ABYA 5SY4A 5HF8A 3V97A 2WTAA 4CG2A 2QZJA 3OIDA 3ZZMA 1PZFA 4JKYA 4Q3NA 2EGGA 2JARA 4EUKA 3NVMB 5JZMA 4QASA 3EG9A 5CCBA 2YCBA 3FHLA 5CD1A 4FU0A 1Y1SA 2PJUA 3JR7A 1PE0A 2JHPA 2JI8A 2FN8A 2ZJ5A 4HMPA 1OTXA 2WPDD 3M6AA 5AVOA 5IW8A 1I33A 4G24A 4TV8A 3TM4A 1H3FA 1W73A 4FYWA 5EHGA 3G2LA 4JXXA 1N3BA 5K3FA 4PYKA 3EMDA 4MJLA 1AIPA 4C89A 1LW7A 4KGVA 5C34B 4AWAA 1I94B 2EIXA 2QJTA 1HY3A 1DQZA 5JYDA 3P52A 3A26A 4LRXA 2FUNB 3CNBA 3AHJA 3LDGA 2VSXA 3HFSA 1CETA 1T0BA 3E9QA 3MJDA 4HDNB 5LZ9A 1ADGA 4TMFA 2WB4A 1QZXA 1CJTC 1SB9A 2M9MA 1A7JA 3NONA 2LTAA 3KTFA 3OCZA 1TO2E 4OJKA 3R3WA 3WL4A 4ZJYA 2B98A 3GJYA 3LI2A 3CH5A 3OZIA 5HKBA 5HDBB 1N92A 2GD2A 1UDBA 1UWCA 5HA5A 2EJCA 2NUPB 5AK6A 1KYTA 1FU4A 3RJ9A 1ZVVA 4LF6B 3DEYX 1QZ3A 4Y2TA 1RI2A 3G85A 1XPJA 1FRVA 1QANA 3D3WA 4R1TA 5D5QA 1PJCA 2BRUA 5IVPA 1X1DA 3T6KA 4WACA 1QOZA 1OZ0A 2CHQA 2P5YA 3R7WB 5IUNC 2OORA 4I81A 5D7NA 3LS2A 3V7WA 3PPXA 2YY7A 4G1CA 1GSOA 1HNNA 3VOTA 3OEHD 4E7OA 1V4VA 4WGGA 4LZWA 5DMHA 1AD2A 1Y81A 4AN4A 1KJNA 4TQUS 3NM4A 5C7YA 2J1LA 1Z8DA 2F6RA 2H2WA 2X6TA 5AJHA 1OT5A 5ALYA 2VQFB 2YIDA 4ME6A 4UATA 2AJTA 1DX9A 4HQ0A 3MGGA 4WLFA 1RLJA 3CVJA 1XZKA 2PS9A 2YHSA 4R9VA 2C7PA 4JY7A 4DOMA 5GIOE 1QKIA 4WLOA 1EBFA 4PSDA 1PQWA 2DZDA 3K5PA 3FMOB 2IELA 1PQ4A 4C29A 2H17A 1SXGA 4BRWA 1J56A 4Q3EA 4EI2A 2R4QA 4Q9NA 4MS4B 3JWGA 3WMWA 2ZSAA 3GNSA 4CFYA 2MYTA 4M54A 2P2ZA 2EL9A 1II0A 4C0LA 3NIFB 1L5GB 4BQFA 4HJRA 4JZKA 5DTJA 5AESA 1E60A 3W3AA 4QWWA 2QIPA 5I5EA 4N48A 3SXJA 2P4UA 3Q7QA 1TGYA 3KHKA 2A9RA 1T8YA 3O1JC 4EY4A 5T6BA 5DGTA 5B2FA 2YWRA 5DCYA 4IFEA 4CQLB 2CT8A 1RWOA 3NOVA 5JS6A 1ZXBA 3U4DA 3A8TA 2BF7A 4TSRA 2RK4A 1NI5A 4K88A 2XYHA 5I9LA 3DPSA 3CCBA 5GJVC 4MB6A 3IXMA 2B69A 4H7EA 4MUEA 3FYDA 1ZZEA 3CURA 1YZQA 3STUA 1DRJA 2P6OA 2V74B 4OSEA 1R10A 4DIUA 1EK5A 5TV2A 2W6IA 4NV0A 1TYZA 4M9CA 4QBTA 4G25A 1W0JA 3QKSB 1VHDA 2F43B 2X5NA 5CA0B 4L9WA 5AW0A 3UY4A 2ZBFA 2A0XA 4Q9DA 5A7FA 2A9OA 2JGRA 2I6XA 1KVQA 1ZAYA 3P2MA 3GFOA 1IUPA 2EVWX 2YZGA 3IAFA 3KJZA 1N7IA 5ETJA 1U3FA 4TWRA 1FBTA 3TX6A 3GJTA 4ZYYA 2Q46A 3EGXA 2E5FA 2EFGA 3IVGA 2CZCA 3KLPX 4EYOA 1ULUA 1UXOA 3NB0A 5JSKA 1LPNA 2ZBUA 3NHAA 4GVXA 1EIZA 3HCFA 1C4WA 1MGOA 1RXIA 2LW7A 2NSLA 2Y9MB 3NNNA 2YXBA 3NT2A 3CPEA 4CN8A 2QGZA 3WGTA 3DTVA 1WZUA 2Q3DA 4J6FA 1NXWA 4G0PA 4JYMA 3V2UA 4CQNA 4MSUA 1DZ3A 3BTUA 1CWUA 3CR7A 3D2AA 3PXCX 4RV9A 2X0FA 4YAUA 1OV6A 1X8XA 3NI2A 3JV7A 4RA6A 2BMEA 3VZBA 2XUHA 1YRYE 2J09A 4LE1A 2HD4A 5TSDA 3SF0A 3TDMA 1Z6ZA 2HJWA 2POCA 4KQ9A 4GECA 4U02A 3VPSA 4BS9A 1ORWA 4CV1A 1FTGA 3KDAA 1AB6A 1W36B 2YOFA 1DIOB 3GLGE 4AKIA 1HXHA 1YXMA 2FYTA 3QXXA 3JQAB 1UKEA 2QLJA 3DFFA 3TTXA 5FWYA 3W2FA 4UUQA 3PUYA 1OXUA 2OG1A 4GYYA 3N2GB 4MUKA 3OOEA 2WIFA 4ZT5A 3EGDA 2Q3FA 3BEOA 3DL2A 1FDSA 1KI8A 3K96A 3M6MD 4GPD1 2OFFA 1RM5A 3FOBA 3IUSA 3PWSA 3L01A 1QHEA 2BV3A 3VU9B 4NYJR 5KKCA 3CF4A 4UNIA 4OHYA 3BCSA 2JJ2D 3K2QA 4EATA 1ABEA 4OQNA 3RTCA 3TL2A 2ZK7A 3PFFA 3FA2A 4RADA 1BJRE 4HD8A 5F5XA 2B4YA 4R51A 3WGUA 3QX3A 2YV4A 1AKRA 2JEZA 1ZCBA 3WRXA 2FZWA 4NI5A 2WSYB 4RIIA 1ZGZA 2P6UA 2WJGA 4XGKA 1YJ5A 1HYGA 3TXYA 4IOMA 3A58B 5JSQA 3KT3A 3SS8A 4QDXA 4TROA 3OE1A 3RKUA 1J06A 3EXHA 1O9HA 4FHFA 4CPDA 4MLCA 2SBTA 1FPMA 3N74A 1AHPA 2NTJA 2PO7A 2C4TA 3L7YA 1B93A 5JS2A 5TJHA 4EO9A 2EW8A 2WMDA 3PS9A 1TQ4A 4NJOA 1CUEA 2BHRA 3N8GA 4J0IA 1RHMA 1LGYA 4A8HA 4EKDA 1YI0A 4LOAA 3QX7A 2FP3A 2GN1A 4AM8A 3L93A 4TLLB 3UJDA 3DF9A 4TOIA 3EFBA 5CYFA 1WR8A 2F1IA 3DTYA 5DBOA 3EQ7A 4NZMA 1VLHA 4RPJA 3SC2A 2XNDA 3H8JA 2Q2VA 4IFBA 2ZBQA 4LI0A 4MRAA 3TZ6A 1UM8A 1US8B 1WP4A 2DRIA 2VDNB 1PW5A 2SECE 2XYRA 4JUFA 1M6EX 4Z9FA 1WABA 2CXTA 3UWSA 4CEHA 1PG2A 4F3KA 1UDXA 3JAWB 1R6DA 3GIWA 3A28A 3ZV6A 1CQXA 3BS4A 2L19A 4Q3OA 1IB6A 5AOAA 3WTBA 4I1SA 4BECA 3KQHA 3S68A 4LHXA 3U4MA 3LDUA 4OQZA 4H3SA 4JB0A 1MB3A 1UDWA 1DEHA 4JJGA 4JBXA 1SU6A 2ZT6A 3RNLA 2ZZNA 3K8ZA 4GDMA 3QNWA 4DXDA 1Q1AA 2BGNA 2Z1NA 2A1TS 5TF0A 3WYAA 4HGYA 3KZCA 1G7RA 4QNRA 4RPKA 1LQ2A 3SE0A 1A9XA 5K0FA 1SCAA 4JVMA 3NHPA 1ZRNA 4EG3A 1BROA 4HF7A 2D5CA 1ESEA 2WSSD 4DV2B 1KR2A 2NW6A 1YOVA 1A4IA 5FH9A 3AB7A 1IPFA 1UOOA 1N6PA 1WM1A 2CUZA 3DSRA 5D3KA 2CCJA 3PD0A 1DO0A 2JS7A 2IY8A 3L1HA 3TSOA 1H9AA 1YK1A 1TB4A 2J4FA 2LCIA 4Z4HA 2V1UA 2BTQA 3C3DA 4PHHA 1G2IA 1Z2AA 2RJOA 2Q5EA 2Y3IA 3GBSA 2NUBA 2UVPA 3FBWA 1LI7A 2IIVA 2NPFA 1MX3A 1QFJA 1B0PA 2H2DA 2IP2A 2OQ2A 3L6UA 4ZZ1A 1NLMA 3ZQUA 1GO2A 1Q11A 2I99A 4RMIA 5J23A 2QTVB 2XTZA 1A27A 2PD6A 1ONOA 1PFQA 4LYGA 3TLBA 2Z6UA 4D4JA 1O8BA 2F8LA 5HRCA 3ZHBA 1HDRA 3Q72A 2G63A 1E6EA 3FI0A 2OD2A 2PM8A 3VC2A 4B45A 4J8PA 3VPBA 1DJLA 3I72A 2C2WA 5EQDA 5K0ZA 1TAHA 5TQ2A 4Z7QB 1LWOA 1M0TA 4NAVA 3JVEA 4DMFA 4E32A 1I1NA 3J7TA 3ABZA 3S7TA 4CIAA 1TEVA 4K9KA 1YAJA 1Y4ZA 5NULA 3L7BA 4YPOA 3EEBA 2O3RA 1FDVA 3RVBA 1Q0SA 3FNHA 1O0SA 4CL2A 1R4NA 3PQ4A 3GLIB 1Z5NA 2XBLA 3KB1A 2JFVA 3JQ8B 5JHHB 3LVRE 3VVMA 5A5DA 4TS9A 4ZYVA 2RK3A 2XKAA 5ALXA 5IT4A 3B60A 1BRTA 4E51A 5LBTA 2HW8A 1YWGO 4M89A 2YXDA 4A2PA 3U7FB 1NAHA 3WMGA 2G28A 1CUZA 3OOSA 3QU9A 3HXTA 4MNTA 1T26A 2OGZA 4G6ZA 3HCBA 1G8MA 2X2PA 3OTGA 4N40A 4N03A 5DLYA 5FT9A 4CHGA 3RCBA 4HLNA 4YMGA 1RD4A 2GTIA 1P80A 2QJOA 4EKEA 1YFKA 2Z5VA 1I7SB 2VBCA 5BSHA 2J3DA 2DC1A 1ODTC 4MCJA 5DULA 1L5NA 1N3IA 1GV1A 5KVQA 3KV1A 4NU5A 1SQGA 2JLYA 2GCNA 5IJZA 1ITZA 1T13A 3GN1A 4UVHA 2BZ0A 1SVUA 2BUBA 2Y8EA 3NHJA 2ORVA 4KR3A 1CDDA 4IDOA 3C8DA 3AI3A 3QOWA 2WWXA 2DH5A 4GC9A 2WV7A 3RODA 2IPAB 3NG1A 2B82A 4FWIB 1B1CA 2XOKA 2O05A 1ZJJA 2Z2ZA 2GARA 3D7LA 3A6HA 4AZTA 4CMEA 1WL8A 2C8LA 4KN8A 1R18A 3ZD9A 2P90A 2QMOA 3OQPA 4Q7JB 1OWLA 4BAZA 2G3YA 2IF2A 3FYSA 1DQNA 2VJNA 5LPNA 1REQA 5DGIA 1XEXB 4E03A 5KZMB 3CUUA 1V26A 1FRZA 1XA4A 3QJGA 4IHQA 5L40A 3IXLA 5FWXB 2Y0CA 3VR6D 1IJFA 1ST3A 2NYRA 9ATCA 4WLVA 5HG0A 1JSZA 2YV2A 1OXSC 1TKRA 3N2GA 2HO5A 4K05A 2IPXA 3EGOA 1NN5A 3MAJA 4I4TA 4KN6A 3C6MA 1R12A 2C2HA 3LT2A 1NVAA 3MBIA 2JFFA 3IUPA 5EWJB 4EG5A 4URFA 2Q4EA 3ELWA 4D8WA 3X0DA 1OHHD 3BF7A 3LSYA 5CBPA 3BSFA 3BWCA 4KLCA 1L9KA 1TYDE 2R79A 3LLCA 1WZIA 3ILXA 5HFJA 1II8A 3GUVA 2ZE8A 4XOUA 2WAAA 1CEYA 5GM2A 1B6TA 5EINA 4RAQA 4TXHA 1NQXA 1U4OA 1XTJA 1CX9B 4GXQA 4K9DA 2XGGA 3DW3X 4L5AA 2EATA 1YZTA 2YFKA 1EQ2A 2Z4TA 3G0CA 4KPFC 4AYWA 5AM5A 4NCKA 3ANTA 3N8HA 4YRTA 1E32A 3UJBA 5KVCA 2E37A 1RE1A 3JYLA 2V9CA 2BZGA 5IJXA 3MTAA 3GD7A 2PKYX 1MCZA 3V1UA 2QSZA 3SQXA 3BZUA 1QAOA 1RWBA 3TN7A 4IHJA 4EUSA 1V5IA 4YPFA 3JRXA 5LLTA 4C5CA 2HBYA 1ZVMA 4WX2B 1RZ3A 3H17A 3GXOA 5HQTA 4G5OA 1E1DA 4Y9DA 4U8GA 3GRKA 3LPMA 2LXNA 1O94A 3SPXA 4EUEA 3AVXA 1BXZA 3FPLA 3M3HA 4XI9A 1W4RA 4YIHA 1DJMA 1U2EA 5B3JA 4DCOA 1HRKA 1U7OA 3LECA 2PY6A 1MO3A 4V2UA 5E3JA 2O1SA 4EH1A 4DEYA 4TUYF 3Q6IA 3X1YA 4UBJA 3COWA 1LQTA 1MIOB 1OLUA 2F1KA 1C50A 2VJYA 4NEGA 2ZVJA 2UYQA 2P3SA 4AN1A 1AF4A 2QYTA 2Z1MA 2C9BA 3SYMA 1LPPA 4Z51A 4CF7A 4ZEMA 1G20E 4ENWA 5JAZA 1PP4A 1P74A 5KU1A 5B58T 3AJ8A 2BSAA 1H2HA 1M7HA 3MWKA 4L07A 1DQPA 5EOVA 4Q18A 5EMHA 4COOA 3A1CA 4LGMA 4KAAA 4MEAA 1A9XB 1PLLA 2X0EA 5AM2A 5KYNA 4BPBA 1GPNA 2A78A 4FEEA 4C04A 2F67A 4GT1A 1E5DA 3WDLA 1USIA 3PX7A 1F0YA 2REQB 2VJPA 1EZZA 2EKPA 3H2SA 3BD6A 3L8YA 4CYMA 4DZTA 1H2YA 3PENA 1YULA 2OXTA 3WTCA 3V4OA 3Q1KA 3X2FA 3MINA 1EQAA 1MPXA 1Y98A 3RT7A 5B6JA 3FOEC 2MCFA 1RQRA 4N18A 5DHUA 2R7LA 4FFOA 1PT9A 3IGFA 4P86A 3OJ0A 4DLRA 4DJDC 2HMTA 3QYJA 4LJRA 1FPQA 1E2LA 1GKIA 2UVDA 4M1EA 1WQ4A 2QRQA 1NXPA 1UPBA 2A9KA 2GKSA 3TSWA 4D25A 5AJXA 1U6KA 1WUJS 1ZNXA 3HVKA 1ISRA 4QLOA 2D1YA 4JUCA 3UYLA 2DLCX 3IPLA 1SD2A 4ZDIA 1C14A 2VHQA 4XGNA 2RHOA 3G9TA 2WNSA 3DT9A 2J6CA 2YWCA 3WMRA 1YNOA 5KHLB 1TX4B 2MYUA 4J43A 3L04A 2XXJA 5LQAA 1DQRA 1XD9A 2HCRA 4RQUA 1I4LD 4NU0A 3UJAA 3R40A 3E53A 4QT4A 5TR9A 4B6PA 5IXSA 4Q7KA 1KMNA 3IJRA 2Q3MA 1E2HA 4DMUB 4MZXA 1AUOA 1KY4A 2BGKA 2LIPA 2P5UA 3GGSA 3KUXA 2GSWA 4Q66C 4BMSA 3DUFA 1MXFA 1NLZA 1PT8A 2C59A 1T3HA 1J23A 1U0NA 5F77A 4RTJA 2RKWA 4JA0A 4WV3A 4BAUA 2R3SA 2W48A 4Q3AA 5TB5A 3OY7A 4A2CA 5TPWB 2Y0EA 4R2KA 3ITNA 1V5GA 1MOQA 3BT7A 5AHXA 4LRSB 2O8DA 3S8MA 5E4FA 1EJBA 1QQAA 3PNOA 2ZU0C 2IEDA 3ITEA 3M81A 4DFDA 2JH9A 2VOEA 3JYQA 1ULHA 3PHGA 3V9AA 2FKAA 4WK0B 3TMYA 4DUGA 3BGOS 5JTTA 3WRXC 4RKRA 3TJRA 4AJ9A 4CI0B 2H57A 1P6QA 1IN8A 1QO0D 3I34X 4DTCA 5JQGB 2IS4A 4N5HX 1L1EA 1R6VA 3H16A 3P9YA 3D6MA 1Z5WA 4DIEA 3GIDA 1S4QA 1SXPA 3ZWAA 4GLFA 4ZAVA 4UZFA 1DEKA 2QE6A 3PA8A 3T5TA 3LT4A 2F3PA 2G76A 5KNDA 4HWPA 5JDIA 5EJEA 3W9YA 1GGJA 3B6IA 1N9GA 3JU3A 4EKYA 2YWJA 3KQNA 1SXJA 4PPQA 4XWTA 4PQFA 4CN9A 3ZNOA 5IHPA 3NGLA 1QLJA 4DAOA 3TECE 2RAFA 3O0TA 5P21A 3GA5A 3TMAA 1V5FA 5A02A 2KQUA 4DLNA 5K0NA 4I55A 5HVNA 1CRZA 3N3BC 1NMZA 1THMA 4O6VA 5F4ZA 3IIIA 4WCFA 3UG7A 1RR6A 2CXXA 1IY8A 4K6OA 3HCEA 5HQ3B 2QRKA 1SOWA 1JDSA 3BRSA 4UM8B 4ZHQB 5I7SA 1QV6A 3VR5H 1N6OA 3GGGA 4IDAA 4YJ3B 4P9NA 3HKEB 3PTZA 1ZGBA 3V46A 3PFWO 4AIIA 2UZ3A 2FEMA 5KWEA 2CYBA 1TO6A 5JSHA 1S9DA 4PIMA 3A9TA 3PHJA 4RHTA 2GF2A 1VCHA 1JQJC 3AIOA 3NGMA 3RFXA 5E6RB 1J33A 3HRIA 3VV2A 1JX6A 2G9RA 3FMIA 4FUTA 3VHXA 4NE9A 4QQ8A 3ICCA 4BE4A 4C2BA 1KKMA 1O4WA 2ZXFA 3HBFA 1JYEA 2ATCA 1E8NA 3LBFA 4TTTS 5GQSA 3DL0A 2XMZA 1U02A 1UDAA 3BA1A 3WL7A 2G77B 3A05A 3ESYA 3I4FA 4ZMBA 2H4HA 2OQIA 3AESA 3AY7A 1TMYA 1CF2O 1MB0A 3FKQA 3T35A 4CT4B 2YBDA 1BFDA 4UNPA 1WPQA 2V6MA 2FX5A 1UH5A 2B1IA 3ML1A 3FWYA 3JRNA 1ECGA 1WXWA 2VXYA 4JNKA 2VLBA 5KYKA 2PL3A 4E88A 4YCBA 4KUGA 3F3KA 5C37A 4IV8A 4RTNA 2FE4A 5AOCA 5ERYA 3OWOA 5KQPA 1VL2A 2I7TA 2WHXA 1N8SA 3ETJA 1M7BA 1Z15A 1GZ5A 1F6BA 1KMHA 3UJ7A 5IT0A 3D6AA 2CMKA 1U2QA 3KPVA 3AFNA 3FZQA 4K6HA 2H2IA 4OQFA 2VPWA 2BP7A 4P4GA 1DOHA 3IKTA 1EFAA 1EFLA 4RVOA 3LOQA 4FINA 1N6LA 2YH2A 5FLEX 2G8LA 4EJSB 2VUTA 5AJUA 1RPJA 3DAGA 3Q5DA 4V0OA 2V5VA 3AVWA 4TKMA 3I52A 1L5RA 3NT5A 4LZZA 2AEMA 4RK0A 4EMSA 4UBKA 1Q0TA 1KK1A 5E1DA 2Z2XA 3OPYB 5EE3A 1WE2A 2HXYA 3FWZA 4L75A 4X6LA 3ZWCA 3QMVA 2NQ2C 3C3EA 4U39A 3W2TA 2BBTA 3DZBA 3FCAA 4V02A 2O8VA 3VAAA 5JXGA 2JHFA 4DMMA 5EPEA 1OA1A 1ZITA 4YXWD 4EELA 4FTWA 4JQYA 1XZJA 2ODTX 4M9QA 1MB9A 3CSDA 3QPDA 5MFPA 2UYHA 4TLBA 1OH5A 4N5MA 2YZNA 2O3SA 1U8EA 1PV1A 2XBUA 4V39A 4R0MA 2AOUB 3H18A 4ZQBA 2G9NA 3TW6A 4GO1A 1SBNE 2BCGY 4RGQA 2Q21A 1G0OA 2YQ5A 2XW6A 2GEKA 2ZRHA 4WN9B 3VZRA 4LE2A 2JAQA 4PNPA 4ZAWA 5FWXA 2O2IA 3GJ3A 1X2BA 3AKCA 4Y1FA 2J08A 3ZWDA 4RVHA 4PLCA 2FWRA 2GKGA 4EY8A 2NADA 3OZAA 5FD8A 2XVAA 4WXYB 3ND8A 2L82A 2F3UA 1WCV1 5HE9A 1A50B 2I7CA 2NU8A 2HC9A 3UH1A 4KPEC 1M1UA 5J4VA 2Z8ZA 1DFIA 4UW9A 5FADA 2BMFA 4JBLA 2BFOA 3LC1O 3EUAA 5DP2A 1YHZA 1B8OA 1N3YA 2ID7A 4UBMA 4WERA 5CD9A 2QIOA 2P1DA 2C7GA 2ZWPA 3BIJA 1TAQA 3LF2A 4I50A 4CUKA 2VP9A 4BNWA 4URYR 2QM8A 3BIWA 2XTMA 9GPBA 3AW8A 5B64A 4O3MA 4HRAA 1KIMA 2H7XA 2PFGA 1ZVKA 2EWWA 4EDFA 3QNMA 1NHGA 3LUFA 1V41E 5J4LA 2E5LB 4WESB 4TTIA 1H69A 4W9MC 1KK3A 2XYVA 3EE6A 1FFHA 4FILA 1E62A 3M3PA 3GLTA 5B4VA 3N76A 4I3GA 3FZGA 4JLDA 2G4VA 3GEHA 4FN5A 1XJ5A 4IDHA 4O4IB 1EFVB 5LUAA 3PEFA 5DLEA 1F0KA 1RXUA 2GYVA 3LQ4A 1P1FA 1CUWA 1LLCA 1N6HA 1VJGA 2PYIA 1F1JA 3UA4A 3UMVA 1HX7A 1Z28A 5DHFA 3ACDA 1NBHA 1R1DA 2DKFA 1OBVA 2J30A 1BG6A 4AMVA 2PDAA 1GPAA 3DE3X 3V8VA 4B80A 2YNMC 4EZBA 1PNQA 2JKVA 3E8MA 1LVGA 3UMYA 3BJMA 1KK2A 4OFZA 5LD2B 3W5SA 4N7BA 5AK0A 3I2JA 4WCFC 4ZI2A 4Y0VA 3O94A 1P7VA 2WSMA 3T9DA 1O97C 1X6VA 1T2UA 4TRMA 2O5CA 1XROA 2BTEA 3KJHA 1XCGB 1JWAB 2WE7A 3G6WA 1CDZA 4J1TA 1TCUA 3IE0A 2GQ0A 2NYVA 3PGA1 3TIXB 5GVSA 5J43A 1P72A 3L6BA 4W7IA 4DCPA 3A04A 3WQHA 3CEJA 1UBHS 3KWLA 5EWMA 4E08A 3L5KA 4GP6A 4O4LB 4KIWA 5E95A 2MYNA 4BO6A 4B3JA 3JS5A 5FTLA 3CWQA 8OHMA 3O0DA 2OHXA 2RHRA 5D85A 2V7QD 3GVHA 2ZYVX 1T6XA 2XODA 1Y9AA 5DNVA 2DCUA 1MRZA 3M9WA 4X24A 4BO8A 5ELXA 3A7DA 2HA5A 2V54A 1JJIA 3FUUA 4UQPA 2Q99A 3PI7A 3NHKA 1NM5C 3CGGA 5FAKA 1U5BA 1A71A 1T5IA 3LK6A 3BHMA 3B82A 1E2FA 3WP1B 1SJ9A 4PBTA 4E5NA 2P0EA 3OBBA 3D1LA 4UEKA 1X1RA 4RVSA 3ZCQA 3HVUA 4D3ZA 2C99A 2VA9A 1NW8A 1USVA 2VUUA 2CCGA 3FLAA 3A6DA 4IL5A 1GILA 2F4NA 4IV0A 4P81A 4YAWA 2UXBB 3DEJA 3HKEA 4HK4A 3X2EA 1J9EA 1Y4UA 1RKXA 3NCHA 4ZJUA 1YVPA 1K8RA 1DAHA 1K75A 5LLSA 4IJ6A 3RGGA 1G8FA 1USGA 1QIKA 2QZ4A 4PTZA 3MRSA 1I6WA 1S01A 3GLFB 3D1VA 3ABQB 3R5FA 1TZ2A 2BEUA 4QJ5A 3C43A 2O3UA 4LJYA 1G20A 4DSOA 4JN6B 1HFWA 3W3AD 1FNCA 4RY9A 4JB2A 2BPOA 4QOJA 4A2QA 1ZWKA 3FPEA 4RYDA 4BN4A 4KWIA 4EKIA 1D09A 4FNMA 3ZHXA 3NATA 3H9JA 4AJEA 1IRIA 4ILEA 4M9XA 4BZPA 3AOEC 1E4OA 2P6PA 3N2NA 5KYUA 4NR0A 5DH9A 3VO9A 5BMVB 4RGYA 3TFQA 2D5AA 4X6YA 3NHUA 2QUHA 1XV5A 3C1AA 4N01A 3OLWA 1A88A 4EUFA 5CRIA 3ICOA 4P84A 1D9XA 4OKSA 4BMZA 4YV0A 3KCQA 2PU5A 3OT1B 1LLDA 3IV7A 4J75A 4FS3A 3KL4A 4Y1EA 3TXXA 4DMLA 2NUTB 1Y7IA 821PA 3MUNA 1Q0ZA 1YU9A 2BFFB 2Q8QA 2O4CA 4XYBA 5TS3A 4WNAB 4KUEA 1KIFA 1I24A 3SVLA 3ODGA 1HG0A 5F5NA 3ETCA 3VYTB 3KKKA 3S8YA 3U7GA 2FSFA 5E7QA 1BN6A 4AMBA 2NUAB 3OZWA 4XGRA 3DZCA 2YRFA 4GOOD 2CHGA 3HVJA 5DE3A 1XQWA 4CLOA 3OPYA 3RYFA 3T3OA 5BSEA 4GKBA 1A4XA 3RSZA 3DCIA 4S35A 1H2RS 5LVAA 2JA2A 2MINA 1KAMA 3N3AC 4XB6B 4OI1A 1SZDA 3ESCA 3S2UA 3GMTA 5BSFA 3AH8A 4KQWA 5CFPA 4HB3A 3BRWA 3HCOA 2VCEA 4AVYA 1EA7A 3QA9A 4EGCB 1XRPA 3NIGB 3WB9A 5AD1A 3EPLA 1XD8A 2BJWA 1P3Y1 2W98A 3MLBA 4NYMQ 3K7EA 3PEWA 1BDMA 1E7QA 1D07A 3P4UA 2FLVA 4PLZA 4PSKA 1YQUA 2IZ0A 3ASYA 3B5EA 1CIJA 1DS6A 3C24A 3CRZA 3LLSA 1FVFA 4PLFA 5LDHA 4BVFA 3DMPA 1SMKA 2XMPA 1MD9A 4PNZA 1Z0UA 3H05A 2Y4NA 3KZMA 4RVDA 5SYNA 4BGDA 1L1RA 4OJYA 3CIOA 4BDTA 2ECFA 1UJCA 3OQHA 4G81A 1K63A 1SXIA 3DNMA 4KJXA 3JARB 1NRIA 4QECA 5FX2A 2IYPA 2P9FA 4R69A 3L7AA 4PXAA 4CMBA 2XZLA 2YYYA 2ZDGA 2WHYA 3FCUB 1T8UA 1ZS9A 2YTZA 2ZU6A 1CK4A 2FVYA 5LYJF 1UOEA 5FB3A 2XJ4A 3RARA 4HG2A 1PS8A 2EJBA 4KLAA 2WINI 1RP7A 2WZDA 5E2AA 3RSQA 3WLIA 3ZJ5A 1GN8A 1X8LA 1JKJB 2PX5A 3IO3A 1QIHA 3T8YA 3UV7A 3ZE2B 2PZFA 1UMBA 2NAPA 2YXPX 2D2EA 3ZE1B 3QG1A 4GSLA 4AYTA 3V7NA 1XJCA 5AJWA 1FRQA 1GG9A 1SXHA 4EPTA 5ICMA 3K8YA 5IT9A 1W0CA 2ZB7A 5H80A 2GEDA 2JPDA 3EAQA 2HA0A 3GZJA 5TRTA 3SQDA 1C3OA 1AO3A 1XLTC 1D03A 2C4VA 1UKZA 4JI8B 4LSMA 3OECA 2PR2A 4POOA 1GV0A 3RUAA 2GETA 3AY3A 1K08A 3RG2A 3PR1A 2UZ1A 4F6RB 5KYXB 1ZR4A 1A9SA 2YMMA 1WHTA 1WPXA 2QGFA 1DRUA 4AY5A 1LH0A 3DZJA 1WOMA 3KU1A 4X6XA 1ZIPA 2OLEA 2OK7A 5ECYA 3VJLA 5K3BA 2EFEB 3RS9A 3IAHA 1SCUB 4YJ2F 2B9EA 1KO5A 1UCFA 2XEXA 3FLBA 1QUEA 4IP0A 4N5LA 4NTZA 3RUEA 1FTWA 3PHIA 4M7RA 4R40A 4YRPA 1HE8B 4FGLA 4K6MA 5JDCA 2PBLA 3TRDA 4YYEA 3F7TA 5JZ9A 4Q4HA 1NPTO 2X4LA 4HTAA 4UFNA 4D5GA 2FPUA 3SEFA 5B58C 2P67A 4QFCA 4PAGA 2HT6A 1HE4A 4CTMA 1CPYA 4IZHA 2XDQA 3HB4X 2RHMA 3ZWOA 4Y9TA 4YAEA 5AKXA 4EITA 1HOTA 1BXGB 1T34A 1U2DC 2FFBA 2H11A 5ICCA 5FUYA 4IY1A 4XDGA 1DGQA 2BE9A 4A3SA 4BGVA 1KARA 1JHAA 2PVSA 2ZRFA 3TVDA 1IM2A 1LRLA 1L8OA 3I6BA 3N86A 1XEAA 1G60A 1J42A 5HE8A 3ZY5A 2JGFA 2B30A 4R0NA 1B4DA 4QTZA 1ORHA 1H5UA 4Q9HA 3HTXA 1SKUA 4PAMA 4B3XA 1RHQA 2C54A 1FP2A 3D8UA 4KFCA 2XMBA 3HY6A 1ZH0A 3EVZA 3K09C 4CG1A 3WNZA 3FX2A 1G5PA 3HU5A 2YVAA 1H05A 2FWJA 3RBXA 1Q83A 2CBGA 2FB9A 4GMDA 4YJDA 3P2KA 4E7PA 1A0OA 1EEHA 1JAZA 2P2YA 1TADA 4KRYA 1QK3A 1XOIA 3HM2A 5EIFA 2VJDA 4Y9RA 3BQ9A 3ZJTA 5EIBC 1NR5A 4RD1A 3QWAA 1AKWA 3JATB 1D1TA 1VSBA 1KQNA 1LJLA 4BMYA 1ELOA 5AI0A 2CHFA 2VA8A 4WDQA 5HKOA 1IY1A 5NLLA 3EY4A 1Y3IA 3KK0A 4PVCA 5BWCA 2I4RA 2ZJFA 3H1BA 4ICIA 4UREA 4F6CA 3I61A 4MGZR 4K9PA 1KI1A 3JQCA 2HRQA 5IAJA 1T6ZA 2Z8XA 4EMBA 3DAYA 4I50B 4BLOA 1XLVA 4N9QA 1LJUA 5B36A 1GUAA 3JQEA 2EKQA 5CB4F 1CVLA 1B23P 3QWBA 4YH1A 4JBYA 3RKSA 2VNIA 1ILEA 4RS4A 3IPAA 1RQXA 5JIBA 3UKDA 4D6YA 4ZVSA 4U7WA 2EFDB 1X1BA 4ZIRB 1ZOOA 1H4TA 1DADA 2Q9BA 2FJUA 3L6EA 1OI4A 4UXJA 4LF4B 3NM5A 3PQFA 1EYZA 5AP9A 3VUFA 4B33A 1CUYA 1PTJC 3RSFA 4B7UA 4DC9A 2HGZA 1P1CA 4KXWA 1C9NA 4Q37A 4ZTBA 1DHRA 1UBNA 1Q1QA 1R0LA 2RGUA 2YVKA 1EU1A 1Y89A 3D3NA 3OC0A 4REOA 2COEA 3HNOA 3ZJUA 5GY7A 4TKUB 1JAHA 3QQ5A 1RJWA 2JIMA 4PX3A 3EPKA 4YALA 4OL9A 3DE1X 1M7GA 1MB4A 2W2KA 4A0HA 1DFHA 3T3IA 1CY2A 2VXBA 5JU6A 4P4LA 4LBWA 2XUGA 4XKJA 4HDRA 3IV9A 2NX2A 3FF4A 3UAWA 4Z53A 3EXEB 4N8EA 4IFIA 4TWBA 4U5QA 4L6AA 5IASA 4ZDWA 1H0HA 1NVVQ 3QPUA 5HPYB 1Q21A 1NYLA 2ET6A 2FSPA 5K8LA 1AGXA 2D0DA 2IE8A 3BPSA 5KJ6A 3PT9A 1UZUA 1G19A 4HRXA 4M37A 2VDOB 5AKHA 1XYGA 3JVIA 3DV0A 1QYCA 1K3TA 4K9RA 1GGMA 4U2GA 3I9OA 4ARAA 4UTOA 4BNZA 3OU7A 1MOZA 1P81A 4G8BA 4QA9A 4H18A 3EWNA 4DIOA 1GTMA 3K6RA 1VLLA 4DSNA 4ZOQI 3ER6A 4LJKA 3B9PA 4D6PA 4RVFA 5JAMA 1TECE 3W5BA 1Q3HA 2NZVG 5EP3A 4MW9A 4IDQA 1YB4A 3RLIA 1MNAA 5JXIA 1VE7A 2V58A 3OU6A 1RIIA 1CZNA 2AX3A 4FBGA 4M83A 4DGQA 3MOGA 4UFPA 5G3ZA 1UJ6A 5KMGA 1Y5LA 2H4ZA 3RK0A 4U9IS 5HHTA 4MQLA 2WAMA 3KKZA 3EAGA 4EVRA 2QPOA 4HAXA 2YV3A 5HK8A 3SX2A 4DVGA 5KOHB 1Y3HA 4OLBA 5FUMA 2ORED 1O87A 1PGNA 4IF4A 3TZEA 3I6QA 4NECA 2Z9CA 4QYIA 1OX6A 2QSYA 4BV3A 3NH9A 2DWQA 2M6KA 3F74A 1L6IA 3T7DA 4AUEA 2WHRA 4YAGA 5CDSA 1KOJA 2ZSDA 3U5ZB 3IPCA 2C5SA 4PTLA 4PO3X 1RWWA 1O5OA 4ALNA 2VCYA 2HSEA 2X9LA 4XSHA 1EH5A 1VHTA 3R7AA 3ZGVA 3GLFA 1NOKA 2I1VB 2FEAA 4UZSA 1G21B 3OZGA 4IILA 1KJWA 3AYZB 3SXUB 4MYCA 2Q2NA 3ORSA 2NTNA 2JAWA 3RASA 3TIVA 1HYHA 4E21A 1UMBB 2E48A 4V3BA 2DPLA 2JLQA 2R2GA 4TPKA 3EFOA 1NJ8A 4L6CA 2QR3A 2YN2A 4ND1A 1M8JA 3NRCA 4MUJA 5B4UA 1GDDA 4D3SA 3CVXA 2BW0A 2Y1WA 5A4MS 2VTKA 2Y76A 3F49S 1BOOA 3ZWQA 1BEEA 3W2IA 4DY6A 4F6RA 3RS2A 4FX2A 2P2LA 3QG5A 4B3HA 2MMCA 3ZNNA 4ESHA 3B2QA 1OXKB 4J1SA 3Q7SA 4A1FA 4H77A 4LV5B 3R6LA 1YZNA 3D8BA 5HUHA 2ZR9A 1I3OA 1TQHA 2PZEA 5HFAA 1R8JA 2VWQA 4WXMA 4YRBA 1QO9A 1CJVC 3KZ1E 4JX9A 4NHEA 4S1VA 1L5FA 4ACAA 4B71A 3R77A 5AR1A 1ZGHA 1XJ0A 3GLHB 3SU8A 4DREA 4R1UA 4UVGA 4HDOB 1Y82A 3TL6A 5FO1A 3FPSA 2ZUCA 1EJ0A 4HGNA 3CJTA 4XCXA 1OXXK 5E2IA 5ERXA 2GN6A 3WYEA 4HH1A 4M22A 2Y99A 1P61B 2IFTA 1RWNA 3UJPA 4ZDJA 4O4JB 5JALA 5KC8A 2QF7A 3TINA 2Y1CA 3OLYA 2AI2A 3L0YA 1EFPA 4LK2A 4MWGA 3HCDA 4PFJA 1JR3A 3IKVA 1WZEA 2VR1A 1U0JA 2PKQP 2PKQO 5FOSA 4F3CA 3LXMA 1P3DA 3ESBA 5KSZA 4JCOA 1FSZA 5BO5A 2GD0A 4BKQA 2QLTA 3G0GA 5I9NA 4RK7A 5L4SA 2FPGB 4O4IF 1T2DA 3O8CA 2XNJA 2GKOA 1AZWA 1S8FA 2D2FA 1Y6ZA 2XZDA 1SC3A 4D8VA 5ITZB 5LKAA 4ARIA 2OM6A 4NCAA 3O8BA 4MKHA 4OB8A 5MFZA 5G1OA 3BYZA 4ZCQA 1JQ5A 4RNCA 3B1KA 2I0FA 2BELA 4ZZ3A 1H23A 2LBPA 1XX6A 4IHKA 4TMYA 1XRRA 2DXIA 5HMMA 3BE6A 4R2LA 2AYZA 3W9BA 1IRXA 2ZTHA 5FWYB 2FJ0A 1YOBA 2VHYA 4KVGA 1ZR2A 1KEVA 1FUKA 3A1TA 2HRRA 1OMOA 1GSHA 3OJXA 2K2QB 4DJ5X 3ZY4A 1M8GA 1MDFA 4DB4A 2FKNA 1RLMA 2DT8A 3K0FB 1GYQA 4JQOA 3T15A 1KAGA 1ATIA 1YS6A 4QGAA 2UYOA 1EINA 1FSFA 1IUKA 1Y9DA 3H19A 3FPBA 4WVLA 3WLKX 2VUSA 4AULA 4D9BA 5FV4A 3NDBB 4K9MA 4CMHA 4EG0A 1AKEA 4BIMA 4FJ0A 4UTPA 2UZ1B 4DDWA 5KYXA 1RM3A 3PGJA 2A5GA 2NG1A 3A3OA 3G2PA 3L0ZA 4OAOA 2ZRBA 4BASA 4BV2A 3VZSA 3KJNA 1GNRA 3N53A 5L95A 4DLSA 1KAHA 2OE2A 2PX6A 1LVUA 4MWCA 1C9MA 4DNQA 3GLIA 2PQ6A 4E3ZA 4XA8A 3TW4A 4CIVA 1J0EA 1DAKA 3QVOA 1L5MA 4LNUA 4S2UA 4QQKA 1C7IA 4BZQA 4Q9JA 4BJ5A 1LJ8A 3DBLB 3EGEA 4GWLA 4F2PA 4QOSA 1YS9A 4G4SO 4OREX 5FA5A 5BWMA 3Q7IA 3TVTA 1AM4D 4C6TA 2BJVA 3V7FA 3EHDA 2YJGA 3L0OA 3DBOB 1YB6A 3E7DA 2VSNA 3OO1A 2RHCA 5CFQA 4Y1GA 3QEAZ 3PE6A 3EEQA 4F3YA 3K53A 4OHZA 2JFBA 2V7PA 3EGIA 4R1MA 5K0SA 1E3IA 4CKEB 3VSEA 1IVNA 1X15A 5B3LA 4FUQA 5K8VA 2AE2A 1T3GA 4OXXA 1C4XA 4BV8A 4AP5A 3AP1A 3E22A 1CJCA 2VJBA 2FFQA 1X7ZB 3OX4A 3QV1A 4LRWA 1V5WA 2NVBA 4M1QA 5DX8A 3SC2B 3VTZA 3WO0A 2DR0A 2YRWA 5D2CA 2XQFA 2ZYRA 4HR7A 4LXUA 4A2WA 1L5VA 1G2PA 1XMPA 4FP9A 1VJCA 3T61A 2BKEA 4WKOA 2W2NA 5GZ3A 1CBUA 1AQYA 2QXUA 2HDWA 2G5GX 4YCDA 2QM3A 5IK2A 1G8SA 4CFZA 4PYOA 3QMWA 1EFRD 3OHSX 2YC2C 1QXSA 2GT1A 3QNUA 1GG5A 1PT5A 2VDPB 2GCOA 2ZR8A 4OQEA 2AQIA 3SIWA 1P18A 1Z88A 2PL1A 3HLTA 1PKXA 4H4CA 5G4LA 5K4HA 1RIFA 2GBIA 2HIMA 3UT5B 3BN3A 1QWSA 6LDHA 3GN2A 2XDWA 4FYPA 5DNUA 2HJHA 1C9YA 2O8BB 1DCMA 1SU4A 2DKOA 3FGPA 5L45A 5C3UA 1VE6A 1KVUA 3EJWA 3PQEA 5JI2E 2O1WA 4R83A 1DJPA 1CTQA 3KD2A 1D8AA 1MV8A 2AC4A 2PSDA 1V39A 1KYWA 3WMEA 3DZDA 1DXYA 1ZO8A 3BFKA 5TLSA 1KQGA 2IHTA 3NC4A 3R8FA 5F9MA 3SCZA 3CYFA 3UWPA 5KNBA 3ED5A 4C7VA 5F3WB 1UJ5A 1VKZA 3BE5A 4XD2A 3FFTA 4YUYA 1Z29A 3R44A 5E1MA 1PEAA 4MW4A 1A2BA 4MVJA 3I2GA 1G5IA 2ZB8A 1WBBA 3BSSA 5E7IA 4M1ZA 4HX2A 3I2YX 5HCIA 4EY3A 1EFCA 5JXJA 3VR4A 2FPIA 1K0UA 3CUKA 1R5JA 4FD2A 5LZ2A 2YVUA 2J67A 3KKQA 4G36A 1I2MA 4QOFA 2PJRA 1OKKD 3CF2A 5GP1A 1K5GA 2UAGA 4LWOA 3DA8A 1USWA 3IPYA 2JIPA 1YV9A 3F5MA 2JIBA 1C7EA 3F9IA 3PHLA 4OK6A 4OQDA 4UXHA 2O8NA 5AI8A 1C30A 1M34E 1RLUA 1TA4A 2FWAA 5UKDA 4BUZA 3SOPA 2UUAB 3FWNA 1D4AA 2AWOA 3LY5A 2C07A 2PBFA 1LK7A 4U2CA 3IRUA 3RFVA 1B0UA 2X58A 2WU1A 3HN6A 1WDTA 1B6RA 2HU2A 2APJA 3IAS6 1HWYA 2QZSA 1LWNA 2NXCA 2DFNA 2GS9A 1OU4A 1WIWA 2QNBA 4RXTA 1YIAA 2LPMA 1UMDA 1D6NA 4GE0A 2FFJA 4R9RA 3VBCA 3WQSB 2X5OA 3ZGXA 4DBLE 4DQDA 4PCLA 1ZUHA 3DMFA 3QFFA 4RC9A 1E3MA 1JA9A 4BQPA 4R1QA 3L5OA 4JBGA 1RS0A 3JYHA 1MFPA 4YQFA 1EK2A 2XRZA 2B1JA 3HBAA 4KQIA 3M9LA 4D4LA 4H6XA 1K4KA 5EE0A 1IUNA 1IFXA 2XCLA 3R5JA 2CF5A 4ITRC 2HK7A 1JG7A 1H1LB 1O9GA 2QI9C 1V6CA 5ALHA 3KQOA 3URMA 1UDRA 3NTRA 5CA1A 1SUWA 3AUYA 4KKXB 3MTEA 4BBAA 3O26A 5KCZA 2C7BA 1Z6PA 2OHHA 3NS7A 4N0DA 3RJZA 3GI1A 1U11A 1BJTA 2ODPA 1ZLXA 2C4WA 4JC8A 5DYWA 5ESWA 3MWEA 3O4IA 2VHUA 1PJQA 1GCGA 3BAFA 1VKJA 4J1NA 4PYMA 1YZFA 2O07A 4M1WA 4G0MA 4POAA 2JFNA 3ES9A 3RIYA 4QU8A 2OV1A 3HNRA 2JIDA 3LL4A 2DGDA 4AO7A 4ZKDA 2H0RA 4WZBE 2RC5A 3G02A 1KJZA 4LYFA 2O7RA 1O7JA 3IAUA 4PGMA 3W8FA 1HNWB 3S5JA 3C6ZA 4EFKA 3AY0A 1LVHA 1XZDA 5LZ5A 3L6CA 3A4LA 3W79A 2F90A 2F3TA 2R11A 1RYEA 3KQUA 5ITVA 1KZGB 3JZFA 1GPKA 2WZQA 3GGCA 1UJ4A 2B5WA 3UXHA 4RPCA 3RS5A 1Y1RA 1I2CA 4XFDA 4N8SA 4PG6A 5KTKA 1CHNA 3BDAA 1G8YA 2R85A 3F6PA 3U60B 3UK1A 1ZGAA 2ZE5A 2HWXA 3R5KA 1E7SA 3RM3A 1GZ3A 2WWWA 3LDFA 3QKRA 1XN4A 4MCIA 1IN1A 3OOHA 1IZZA 2XPCA 1TL7C 3GPIA 4IMPA 4BYGA 1R5OA 2PZBA 5KYTA 1EI9A 3HCWA 3NBZC 3RVMA 1D4OA 2H54A 2W5UA 4DYHA 2MT9A 1II8B 1JBKA 2E6UX 2O20A 3BTSA 3H5OA 3N0RA 2QZZA 3ON5A 2FR1A 3GAFA 2XTAA 2AJLI 3ASVA 4AQ7A 5E38A 4UCWA 4QEZA 1LRKA 1L5WA 4TV9F 1ABBA 4ER0A 3EWSA 3OZDA 5B6IA 2Y71A 4C3UA 2DX7A 2BFEB 1L7RA 4ZO9A 3GX1A 4IVPA 4N54A 5BY2A 2PUTA 3KR2A 4L3VA 4D8YA 3ZQJA 3CUYA 4G5XA 2ZJYA 1H66A 1U7ZA 2FW6A 1GEGA 4WADA 3G8CA 3NETA 4LHEA 5DXFA 4B6GA 5JVDA 1XQ6A 3A9CA 4FYHA 2BI7A 3T7JA 1IZYA 1CS4C 1XBTA 1YR9A 4HXGA 4PNHA 5DJ5A 4UKDA 3R0ZA 1DV1A 4TLMB 1MEJA 2M1ZA 3D3KA 4NULA 3DBRB 2HSGA 2A84A 3R5TA 2X6QA 1GTL1 5EWLA 5CX1B 1DQSA 2YWGA 3X2SA 4R5MA 4JAVC 1W93A 2WVJA 4C3OB 3PVSA 3IRVA 5K3DA 5M34A 1Z82A 4D80A 3IMGA 2EW1A 5JRJA 1VSQA 3PDIA 2CVFA 4HFJA 4D92A 2BBSA 5IC5A 3MJSA 1UQRA 3THXB 3ADCA 3PC7A 5DCWA 4B8YA 2ZFUA 2WF9A 3KELA 1TM4E 3RSSA 2QLBA 5BT8A 4JVOA 1PFGA 3GLUA 4MB0A 5E9QA 4ECAA 5DFAA 5IF9A 5JLJA 2V9PA 4CLXA 4CMKA 3D4NA 2GXAA 4FYMA 4ZWNA 2CUKA 5KOHA 1UPTA 1E3SA 1FEZA 3REQA 4GBGA 4ZAFA 4C22A 4CF4A 2J9FA 4ZIRA 4IOJA 1BGVA 4IIXA 3SNKA 3ZYZA 3ZN2A 5TGTA 1BE1A 4KFRA 4NONA 5FL7D 4QOEA 4W5TA 5CK4A 1AN9A 4JJZA 2JGEA 2WF8A 1ZJZA 4KDEA 4NENA 4RWEA 4HYTA 1QHSA 1NI3A 1HKHA 2W7TA 5C5CA 3NWPA 4KO3S 3SXPA 5DCLA 3WI7A 4E94A 5K01A 3EFEA 1PSWA 4U6NA 1C7RA 4BNIA 1KI4A 2E87A 1JIXA 3BD8A 3CO5A 4EAAA 3R6WA 3CWCA 1A7AA 4GI7A 5E3HA 3CZ9A 3FPHA 2JK1A 2C9OA 3KQSA 5A4FS 2VKQA 4MPJA 3FRIA 1VGRA 4ZI7A 4R1OA 4NOLA 2FDXA 4QOIA 5FI3A 4KREA 4G23A 4NXMB 4AUMA 1R7RA 3DYBA 2B2CA 5FTNA 4UTVA 2CFSA 2WVHA 1PVVA 1RKBA 3M1LA 4WA8A 3AF1A 3CKLA 4H7HA 4YP9A 2IVZA 4M0DA 4UCQA 1UBLS 1R27A 1FDRA 1WA5A 3JQRA 3Q6MA 1IOVA 3C4JA 5E8JA 5HJ5A 1A96A 1WCWA 4H2DA 2B8EA 2F55A 3ADBA 4ROSA 4X84A 1JZTA 1KK0A 2EC5A 2GZMA 2QRHA 3HNPA 5KJEA 3VV3A 1VKHA 2R8OA 4RTMA 2JIZD 4OJNA 1WG8A 3NYIA 3T5DA 3TEFA 5B37A 2QN9A 2Y1EA 1HL3A 4J1QA 5ALSA 1E1LA 2JGJA 3NWBA 3WZMA 5CDUA 4CKEA 1OPXA 3L8CA 5F2EA 4YP0A 3T54A 3W78A 3WLTA 3DUFB 1UC4B 3HCPA 3FBGA 5H5JA 5JTUA 3CE9A 1UKAA 1DO8A 2Z30A 4WZAE 1JFLA 1NYRA 1V3QE 1SHUX 2IQIA 3PC6A 5JOQA 3PPVA 4ZREA 2FK7A 5CPFA 2XCRB 2G1PA 4N0PA 3L4BC 2O0MA 1B16A 1CZOA 2POQX 3WHIA 4ILKA 1NFQA 2IU4A 2ZI9A 3HYCA 3T1QA 4OGKA 4PLYA 3TQOA 3U3DA 3UC5A 1JMKC 2XB6A 3D3JA 3HYTA 3O21A 4L2IA 3PCXA 3MT0A 4MS3B 1L7AA 3B6MA 2OPHA 4BTVA 3R3ZA 2ZB4A 1JG6A 3DO5A 5IYZB 3ROFA 4QDZA 1OYOA 3WAGA 1VTKA 2G70A 4Z7OB 5CDHA 1RLTA 1YRLA 4PRLA 4D0RA 1ND5A 1WZCA 3PZRA 1VBMA 4RDCA 4YREA 4CCSA 1L5HB 1PZGA 2CK3A 4MYUA 2O2EA 3CF6R 4C4ZA 2Z9BA 4OHOA 2E1PA 2ECOA 4EPXA 7YASA 5EQJB 3K8QA 2PYZA 5KJCA 3LT1A 2IYWA 2EX1A 1NWHA 1P9OA 2VHJA 2P91A 5BRNA 3SDSA 5IXYA 4YWHA 2WJIA 3A6LA 3DMDA 1G3MA 2J7KA 3JQBA 1FFCA 3NHRA 2HDHA 2J7PA 4Q02A 4PSVA 3T06B 4I55B 3UMSA 1TVEA 4J16A 5CBKA 4KXUA 5CHYA 1JH8A 4LG1A 2E4ZA 5CNJA 3O6VA 2BEKA 1KIAA 3SNHA 2HIGA 4MP3A 4B4OA 4RF5A 3MGBA 2ZRJA 2HTFA 3LFHA 2VT6A 3GDWA 1S1CA 3AJ9A 2GPAA 1VCMA 4CHTA 3OX3A 3I5MA 1XZPA 3JYOA 3M0EA 4J2HA 3NAQA 2MJLA 4Y6OA 4EVQA 4JI7B 4K0KB 1IZ7A 2HA2A 2B83A 1AQIA 1ZD9A 221PA 1JSXA 3FUVA 5ECWA 3ZHRA 4BNVA 4OUKX 4PLWA 3PF9A 1V48A 5EIEA 1AMOA 2R1UA 1C0PA 1CF9A 4MVYA 3RQIA 2WKRA 2DBYA 3MRTA 5T64A 4EO4A 1T91A 3R24A 3G79A 3HWX1 4INZA 3CIFA 4Y6SA 1H5QA 4C3ZA 3FB1A 4GOND 2SHKA 4KK3A 4GIBA 5JNTA 1J49A 1WW3A 2QR5A 5EJAA 1YHYA 3V42A 3MGAA 2CBZA 3JALA 3GRYA 2JJ1A 4YRGA 3N5KA 4ZT4A 2JJ2A 4U2EA 4D9MA 4KN5A 3KEMA 4L51A 1GYRA 1P1BA 2BFEA 2HJSA 2ZJ1A 4KC0A 2X76A 1UEJA 5AXAA 5EHXA 1H2WA 2CNKA 3P9PA 5T5QA 5KQRA 1LPMA 1JUDA 1XFAA 3AR7A 3QE3A 4PIPA 1PSDA 2W6OA 2P9QA 1Y0BA 4RQBA 3CFYA 5FHQA 4CL8A 1VIDA 3UW3A 3UTCA 1NTOA 2VDJA 3H5TA 1FYFA 5T57A 3H2GA 3UHPA 3K6KA 5AM1A 4ZPJA 1G8PA 4FEGA 4B3SB 1RCFA 1P3JA 2PWBA 4OHUA 1Q1BA 1SOMA 1ULSA 2B8JA 2GJ9A 4N5NA 2FQWA 1E18A 3U7HB 1OJLA 2D0PB 2GSDA 3ZLUA 2HF2A 4CM4A 1BO6A 2V0NA 1NVUQ 2X41A 3GJ0A 3LAWA 4HEA1 1XXLA 1G3IA 1RTTA 1KI7A 3MWEB 4ZYXA 5DNAA 1MIHA 1QOPB 4YJHA 5MDHA 2HKIA 2JLCA 2WYIA 2V03A 3LH5A 4LVNA 4P58A 5LBUA 4J16C 3OJCA 4AS1A 4UUBA 4B2LA 1EE2A 4LWQA 3FUCA 5B1SA 2FF7A 4JFRA 3PYMA 1BS1A 3QEMA 3M83A 4B82A 2HXSA 1KMMA 3ZGNA 4Q93A 4I6GA 1XXHB 2FPPA 2OGUA 4IGIA 4RX1A 1SULA 5AHWA 3U7EB 5K05A 1UPAA 4ENVA 2V6GA 4PWZA 1H8EA 4XJTA 4JJKA 2J07A 5TT0A 2HO4A 3D31A 3EAFA 3Q11A 2YS7A 1NHWA 4QTUB 1B76A 1TM7E 2ODNA 2WM2A 3AP3A 3Q40A 5TE9A 2FP4A 4NG5A 1TVKA 2X9QA 2OCXA 2OXIA 1Z6GA 1JLLB 3ZLBA 4P3KA 3IBTA 1G1AA 2Q50A 3DVLA 4US1R 2J3EA 2Y68A 4H1TA 5MN6A 3GCGA 1XVVA 1G38A 1BCSB 2V59A 4HQKA 1K86A 4I36A 3P7MA 4NOMA 5JZSA 1I3LA 1SQSA 3OESA 4OQ4A 2OCIA 2RDMA 3FAKA 2IWRA 2FOLA 2W2MA 4UCXA 5HEKA 3PSHA 5CFOA 2C98A 5IZCA 3D5QA 4EHDA 5JNWA 5IN4A 3FDXA 3P5SA 2Y77A 5EMLA 1C1DB 1TTQB 4NH4A 3RBVA 2R1ZA 5K0TA 4J91A 1FX0A 1N5LA 1N4DA 5BSRA 4AZWA 4EECA 5CFMA 1EG2A 1R15A 3ZK8A 3LIIA 1NMSA 1VLMA 5D3MB 1ECPA 4JIGA 1DNPA 4K9NA 1EXNA 3ZDBA 1LV8A 2QDXA 1V43A 1Z5GA 3C7AA 3FVTA 4J03A 3RUCA 1EGMB 2FZ4A 4KQHA 3WLMA 3HWRA 1A9PA 2LE0A 1AKQA 2D74A 3OJEA 1AH2A 3WOVA 3CZQA 1CQIB 1DLIA 1L7BA 3DDZX 3GY0A 4L73A 2PSSA 1D0IA 1B8NA 2QN6A 5I7OA 4G67A 1IK6A 2NZJA 2HZ7A 1DBQA 2JF0A 2QAGA 4RD4A 1Q1EA 4XM0A 3VKVA 4CETA 3O9VA 5JFGA 3KSBC 1IM8A 2Y6VA 3A4YA 4ZCSA 1FXWF 3WA6A 4B1FA 5DHTA 1XRMA 4YPVA 2QVYX 3D1JA 3TM5A 3BSWA 3ESQA 4S1PA 1BMDA 3KUKA 1YTUA 2Q5JA 2ZB2A 3MNFA 2RGEA 3VISA 2HHAA 3DOOA 4JK3A 3ROEA 3OI7A 3SJBA 1J2JA 4CUJA 5HIAA 1VE1A 1UIMA 5B57C 2HFKA 2QR2A 5G2OA 5IYZA 2OVBA 1KFEB 3KTAA 3MRXA 1EA5A 2GNOA 2V6BA 5IEBA 2OOKA 3A25A 1O89A 1RYBA 3ZY6A 1T9HA 2WW8A 1TCVA 2R66A 2TRSB 3MCZA 4IIHA 5IAAA 1C3EA 3A37A 4C2UA 2Q5LA 1DG1G 1XD2B 3AEKA 3D4IA 3C1OA 4O2BB 3I5YA 3HVRA 4GRIA 1RRMA 2HTEA 2J3LA 4J6EA 4JU9A 3W8RA 3BULA 3GDGA 1SUFA 3LTEA 4JP3A 3SLRA 4MS4A 4Z99A 4ANFA 3M4YA 4YN3A 1ZG3A 4FSHA 4FHGA 2NO7A 4C0KA 3UB3A 2ZSIA 4HAYA 1OBHA 1W5BA 2RJNA 3E1GA 4X20A 4EA7A 1NP7A 3IHWA 5MGNA 4KV9A 1GM5A 3LUHA 3PGLA 4BP1A 3RTDA 1VYUA 4B75A 3ICWA 2C2ZA 3DVAB 3FMFA 3NU1A 1TRKA 3O2SB 3CCCA 4XGQA 5HXAA 3JQQA 5DK6A 1T6NA 1YDEA 4AWXA 3LC0A 4XLTA 1YTLA 2H48A 4IDGA 5AI9A 4BGUA 3U4AA 3GT4A 4Q1EA 4MGEA 3W2EA 1UBTS 4EYGA 1SK9A 1GNPA 2OL4A 4G5QA 4FW8A 4NF2A 3ZHQA 4GYJA 2UUCB 2G0NA 1NV9A 1U80A 2VYND 3AFOA 2QU7A 5DBGA 1PS0A 4IEFB 2ROQA 3GUYA 4QRIA 1ENPA 4REQA 4Y0AA 4RJ2A 1EX7A 2PAAA 3R6TA 1QE0A 4M46A 3S1AA 2IOFK 4G1MB 4HDNA 4PW0A 1L4UA 2G7MC 1W87A 3DBLA 4CUZA 5B12A 4IIYA 1EJ6A 2HV9A 2MSWA 3KLMX 3MCWA 2JFOA 2D1TA 1A2QA 1P9RA 3P8ZA 1GNVA 1Z22A 1XDZA 4RPHA 1J1ZA 3HVIA 4MP6A 5A05A 2VATA 1U0LA 3Q8WA 4OTZA 1UDCA 1XO1A 4DLPA 2O5RA 2XB9A 4AIRA 1AMUA 3OZXA 4RPGA 2H9IA 4ZK6A 1EK1A 1R8SA 1KQ3A 1YMUA 2A5LA 3R7WA 2YXLA 1DBIA 2OT3B 4M1MA 2ZBDA 4W99A 4Y2UA 4PZLA 1R4MB 3SHWA 1GU0A 3F9RA 3GLSA 1KETA 4QXRA 1F0NA 3I2KA 4KFSA 1RZUA 1DXQA 1XU4A 3DLAA 1JU4A 2NUAA 3ZXIA 2ZJ7A 4EM6A 1QC5A 3K5IA 5A9RA 1I2ZA 1WF6A 3FKJA 4JXJA 1NFFA 2HAEA 3TNJA 1Z4KA 3LRXA 3ZE6A 1BW9B 3QLUC 4B6OA 4BB6A 1WP9A 3T3DA 5BMOA 4OB6A 5FTMA 4TSKA 5SICE 1ETUA 4NOJA 3D0KA 2EQ5A 1DJQA 1W1UA 1T3TA 2AE1A 1UF9A 1W25A 2R60A 3BXFA 3K9CA 3CM0A 3KQWA 4UDNA 3RSHA 4GYWA 4FDVA 3WIEA 2F9FA 1K8YB 1UIRA 2JCGA 1H2XA 2K4MA 5AJTA 1EHYA 4J9UE 3RG8A 1W8DA 2MIIA 2GJ4A 5CB4B 3K9BA 4TUYA 1FYDA 3MEQA 3ZLJA 2CLIB 1OU0A 3AEQB 2G6BA 3GG9A 4K2HA 3QELB 4PINA 2G82A 1EGAA 3D59A 3ED1A 2ZDHA 4A16A 2IEAA 2YZ7A 1XTKA 4ND8B 3OD5A 4O0MA 3P0EA 3DCYA 3ZQKA 4BNKA 2OBFA 4ARZA 3ICQB 2RH9B 2O19A 5FQOA 3EZYA 1HLGA 1V5EA 5ILGA 4Y7DA 1KSJA 3VJRA 4UEWA 3VYVA 3IODA 4QQNA 3TCKA 3IUYA 4J4BA 3EZ6A 3F6RA 3L1VA 1GGVA 4AFNA 1DCKA 3KEOA 2NYUA 3CQ9A 5GOTA 4YT2A 5BURA 5IWAB 3HSYA 2X2OA 1AVTA 3CF4G 3GA0A 5CA0F 4HMOA 4J3JA 3IP8A 3IB3A 4YACA 3U37A 5AM0A 5BOSA 1A69A 4IIGA 4EENA 3OMWA 1WBJB 2YWEA 4NFSA 1NM5A 5EQTA 4HAOA 1WB6A 1XP8A 2QG9A 1G4AE 1C9EA 5BN5B 3RROA 1ZC4A 1UK9A 1KZHA 4KIJA 1U7HA 2P5TB 4EJ0A 3F5DA 5DM2A 3ERCA 3D7SA 4G1FA 3AU8A 4NZZA 4QLAA 2W11A 2Z58A 3VX3A 3RWBA 1KS9A 2QTRA 3DWEX 3FF1A 1KZ9A 1MC1A 3KRTA 2X19A 5AHRA 3OQOA 1N7GA 2W6JA 3QVLA 2CL7X 3F7OA 1U0EA 2YYZA 3PITA 3TB6A 3TUJC 4FZJA 1Z4JA 3PJGA 1SHKA 1OR8A 2FQXA 2IYFA 4C0AC 1E8MA 1NMQA 3QYPA 5EVCA 3RANA 3RU2A 4V1CA 4BMVA 2VG8A 5CFNA 1M1YB 3JR3A 1EUZA 2J6BA 2I71A 1OIXA 3K9FC 3OCUA 4HNUA 1CZUA 4G0VA 3OZBA 1HT3A 4YP6A 3I9FA 5H3LA 3ZWVA 4A6XA 2FSVA 1J0CA 1Z2PX 1QLHA 4HLDA 3SYKA 3TR0A 3SZRA 3GPCA 1E2PA 4UOZA 4RMHA 1RKVA 13PKA 1GL6A 2WT9A 4BLUA 4CODB 4OUDB 1BEZA 4JL6A 1ZN7A 3AI7A 1U0BB 4I46A 1KJ8A 1PFVA 1MQ9A 2V96A 3DTTA 2OCBA 3O03A 5JH7B 3ZZTA 2Z09A 4W8GA 4DV4B 1YDGA 2HA7A 1FMFA 3DFIA 3ENKA 5C52B 3NR2A 1YA8A 3Q8MA 1LC3A 3FWKA 2XLCA 3GLFE 2VXCA 3GJ5A 3ELUA 3DKKA 5K6RA 1P5ZB 1RM0A 4Q9LA 3BHIA 2AG5A 4PZPA 2CZQA 4K9QA 2D3TA 2JGNA 3EF0A 3UQZA 4DGSA 3MBKA 3KLNA 1E5XA 3OZEA 4QUGA 3RH0A 3EPJA 2O7SA 1YQ9A 2W37A 2ERCA 4QULA 1Y33E 4DNXA 2OGSA 1H6BA 4FKZA 4L3WA 1UC9A 1AOXA 3FMGA 4HGOA 3UGQA 1W19A 1Z2EA 3IKJA 3KKPA 4LCBA 4Q00A 4TM8A 1SO8A 2GPNA 5T8KA 3OFVA 2AOWA 2X7JA 2GXUA 4X60A 2QW1A 2AKYA 4QYTA 4YONB 4P33A 3D6HA 1MENA 1I8TA 1YZHA 4I2VA 5EXTA 5T4FA 5IDQA 2PSEA 2IEZA 1KU6A 2QPTA 4IQ0A 3ER9A 3TYXA 3C3PA 1LCIA 5IT5A 3HUFA 2W58A 3LK7A 4IG9A 2NO0A 3INTA 2QX6A 1WVGA 2XKBA 4GMFA 3J80A 5IMBA 2AFHE 5KWJA 3KSMA 1ZEJA 2CL6X 1PR1A 1C1DA 3JZAA 1EAMA 3ZCVA 4KWHA 2W70A 1NJFA 4H3VA 5EA2A 2H0AA 3C85A 4HI0E 4HUJA 5C8YA 4ALLA 5JMTA 2ACWA 2I03A 4Y6GB 1X7YA 4I08A 4E3WA 1Q84A 2W8BA 4X65B 3COYA 2P78A 2CKMA 3IXQA 4NE7A 2ZYHA 2KHZA 2JJYA 1NE7A 3Q0IA 2VO1A 5KHOC 2ISQA 1P44A 3LPLA 4AS3A 2C3OA 3AR2A 3JYNA 1R74A 3A6GA 5HF5A 3GP8A 4C0QC 4B4UA 4D46A 2O0JA 2PLAA 1GFSA 1GZDA 5ALOA 2AN3A 3UWKA 1K4MA 1KC1A 2HADA 4X8LA 3S27A 3NDRA 2X23A 3UPUA 1OTYA 1E2UA 1CQZA 4EQ6B 3VNUA 4D02A 4J07A 4AF6A 1T0UA 2BY4A 1DOZA 2I7VA 2P2SA 2J59A 3R0JA 4DC0A 3CVUA 1RZRD 2ZTMA 5AJVB 1UWKA 3JVVA 1BE8A 2H5EA 5HTKA 3UO8B 2XUKA 4G0UA 2CLOB 3AHEA 5CVUA 2NVUA 3JCZA 2IYXA 2YWFA 4Z4EA 2F4VB 3ESDA 4E5PA 4P5EA 3PDJA 4FW9A 3VR5A 1ZL2A 2W2LA 4F92B 4ESOA 5E1OA 3RV4A 1OW3B 4HLQB 3C16C 2OXCA 4F56A 2HLPA 2R97A 1YMQA 3DULA 3GF4A 4TKZA 2D59A 3WR5A 5FPKA 5EJ4A 2BFCB 4PYLA 2GYUA 5CGZA 3LSTA 1Z12A 1PK8A 3SJAA 2YMQA 3IR5A 1XVUA 5G0WA 2IXFA 2VP2A 4JSYA 2NVOA 1IHXA 3AIMA 3GC6A 3TTTA 1E89A 3UT6A 1R0CA 4FFDA 5H59A 4FZRA 5TMDA 4BCDA 4X66B 3ZEIA 1JH9A 1BTOA 4QDTA 5EYPB 3MT8A 2D1FA 3SJ7A 1A9TA 1EP9A 2DFVA 2J3HA 721PA 1E9CA 3DF7A 2ZCVA 3HA7A 1ILWA 3KFXA 3FD8A 2Y0DA 1W88B 1OI2A 2D54A 1ZUWA 1H2EA 4H35A 4IWYA 3ZU2A 3WSVA 3AQIA 1BDBA 3FSJX 3NIBA 4H6WA 5F51A 4H4EA 5K3AA 1H94A 1LU9A 2ZS9A 1QCYA 1RVDA 4M0MA 4XPIB 4J0KA 2R87A 3B1VA 1OVMA 1Z4NA 3LQYA 1HTWA 1P17A 3M1AA 4LSWA 4QT0A 4Q19A 2D62A 5BUZA 2QMHA 2JAOA 4CKCA 1ACJA 3SYRA 5AVSA 1IH8A 3HBNA 3MHTA 4ED9A 5CR9A 2VRWA 1ATZA 2Z6VA 2PRIA 1Z8FA 3GZ4A 4M7PA 4TGLA 4HUQB 4L02A 2I55A 4RYLA 3WK7A 2NACA 3RABA 1C0IA 1SFRA 2FUG6 4FGZA 4P7KA 1RXWA 1Y6RA 1W6RA 2MSEB 3IKLA 5BYKA 3QW2A 1QK4A 3JXEA 1TW3A 3EFOB 1VBFA 1M72A 2JDIA 3KWMA 3MW8A 4JDUA 4YRRA 3WQBA 1DQYA 3IAS1 4HNVA 1OFGA 3HU3A 4ZEVA 5C7IO 1EVIA 2JH8A 5KNCH 1O2DA 1N5DA 3TLGA 4B7XA 3MJRA 4EHBA 3AR4A 4CU2A 4JC5A 1GD1O 3UB2A 4HNAA 3NDIA 4F7DA 2GM3A 4O33A 4NLLA 3OKCA 4RAOA 3OX1A 1QIMA 3DXYA 4W7SA 5E0OA 1IG3A 1H8HD 3GMIA 4CQJA 4LXYA 1E3LA 1MF7A 5I3ZA 1O5IA 1TKCA 4KFTA 3K32A 5H70A 1U5AA 1MIOA 1T3SA 3I1JA 4KE6A 3IDAA 2NNWB 3MYYA 4FI3F 2QPAA 2GJKA 2VS1A 3PNPA 3Q4GA 5AM3A 1ENZA 1YASA 2VN8A 3DZGA 4M86A 1W5TA 3WZ2A 3BL8A 4RKEA 2IP1A 2WG1A 3C39A 4B6JA 3WLEA 4G2NA 3P9KA 1ECBA 2HQBA 3AV3A 2EZ4A 1IM5A 2XGSA 5KYWB 3KETA 2AMYA 5JD6A 1K98A 1BU8A 4PC7A 3T34A 3EVEA 2OUKA 4Q9IA 3W6UA 1CYDA 2G09A 1RYZA 4YMHA 3GEIA 2AFVA 4U7FA 1OLOA 3PNYA 1CERA 1W96A 3PFGA 1JGTA 3HJFA 2R6JA 4X44A 2O8FA 1X1QA 4LOKA 4WD3A 2AVDA 3NXSA 4QSMA 1I1HA 1Z4MA 2FOXA 3QI7A 1ZSYA 4U9HS 5B53A 1CRQA 3U4CA 4JR2A 4F71A 5KS2A 1QHYA 4ZCTA 3U44A 3L49A 2IHZA 3D7RA 4RXUA 3KEFA 4EPVA 2FETA 2DWUA 1N4AA 3NIWA 4I1YA 3AHCA 4KVFA 3P27A 1A8SA 3TZBA 1SPXA 5KVAA 4HGQA 4WK4B 5DM0A 1FW6A 4MCHA 3A6KA 3S3TA 4UU0A 1BMFA 5EMJA 3NBUA 1F38A 1GAJA 1RAFA 3RIGA 4H1WA 5C5EA 2GO1A 3PNSA 4ZTZB 4FPXA 4XQCA 1K7EB 4Z9AA 2WD9A 3PNKA 3TSCA 3N28A 3L7DA 2XUPA 1IZ9A 2Q9AA 3NRJA 1DG3A 5CEFA 5H8WA 1GY8A 1K0FA 1NUQA 4AB1A 4BU1A 2HA6A 2OESA 4P54A 1TMOA 4FFRA 1P1IA 3ZDDA 4JB8A 4EJ2A 4KO1S 1GL7A 2J3JA 1I1OA 2KYRA 2YUIA 3KXDA 1DC4A 1I9GA 5CBPB 2DPGA 4MULA 1FYXA 1M73E 1A5TA 5JY6A 2ZUSA 4P98A 1J8DA 5EJGA 1W44A 3FOCA 4FLFA 2C2GA 2FN4A 3TDNA 4Q4AA 1HR0B 4UULA 3ZDYB 5JMPA 4AX4A 3EPHA 2RI1A 2ZKIA 3QF4A 5LP6C 2V3CC 2AXEA 3JY6A 3QFSA 2C3YA 3O83A 4BOYA 4XB1A 5CJ2A 1D2HA 4OH1A 2DF8A 1L5QA 2Q5FA 1ZLYA 4RWZA 4Z1MD 3QEKA 4ARBA 2C2YA 3EW9A 3K3PA 4KODA 1W5FA 3O8NA 3WP0A 4FHCA 2CNWD 5JAOA 4TVOA 2XZPA 4XX0B 3VTAA 1JR2A 1KYIA 4QO7A 5CCXA 4V0MA 2A1IA 2UZ0A 3P71T 4ZEWA 4MGIR 1G1MA 3QF7A 4Q1FA 4BNUA 1GKKA 1TYBE 1Z33A 2AG0A 2O1EA 4UNNA 4BVBA 1XTQA 4NXNB 2PGDA 3O2JA 4ODIA 3TLEA 3PL5A 2PUHA 1E9RA 3BQNB 1JJAA 4JCCA 2H65A 4NK5A 4DSAA 1ORDA 3CLVA 1TMGE 4WBSA 5K20A 1MZPA 2BFDA 3FG9A 4G84A 4ER7A 3GEEA 2HYIC 1NUHA 1ODLA 3WG9A 1VIVA 1OLUB 3JWIA 3N7AA 1UEXC 3PT5A 1ENYA 1B15A 4LXTA 4NCNA 4X8OA 3H6HA 3EGDB 1K4YA 4BDSA 3EMKA 4F84A 5CNMA 2XOKD 1B2LA 3MILA 5TXGA 4GYKA 2O2SA 4MDEA 2QUKA 2PS1A 1C1YA 1T1GA 2AW3A 2ZUVA 2R25B 2IODA 5CIQA 3GNQA 3VDXA 3IP1A 1DKUA 3BWEA 3KQQA 2JCBA 4BMCA 2I1QA 4HSGA 4L9SA 5ER6A 2GJAA 5FBHA 1O8CA 1NDHA 4HFRA 1JE1A 2RJ3A 3NRBA 4KB5A 1O9BA 4BLQA 3K71B 4LOJA 2H1HA 1V0JA 3K09A 1VPDA 4QHYA 3RT1A 2GWRA 3JAKA 3OJFA 2HLNA 1ACMA 1NW3A 3ESAA 3RDPA 5JANA 3U4QA 4KXXA 1B26A 2FHPA 3IJEB 3T41A 2ZOSA 1M8PA 2VQ3A 3AF3A 4OKNA 2FRVA 1Y37A 4TXMA 5BWBA 3P9SA 1QYDA 4FOTA 1Q7EA 4K0RA 3KBBA 5J9FA 2HBRA 3BIOA 1ZM9A 4QUAA 3WK5A 2YQZA 2BRUC 4Z4GA 1JMVA 1ID8A 5C18A 2QY9A 4UHEA 2PWYA 4ENRA 4HDSB 3T9EA 2FQYA 2BM0A 1XNJA 4TRNA 2IDJA 1YRHA 3UUGA 4HNGA 2D8MA 3ZHCA 1S6YA 4J2OA 3W4IA 2GVDC 5J40A 1OROA 4CL3A 2EBHX 3KC2A 2GI4A 4YDQA 2ENUA 4FGSA 1GJRA 1WSAA 3N6XA 4EBFA 6REQB 2I2DA 2QP9X 2HBZA 2WIGA 2XNDD 3KPYA 5K03A 3EZNA 4ZVNA 1K7YA 3N2ZB 2GRAA 2W83A 5EKSA 4V0LA 1AA9A 2O7QA 4LYYA 5CYGA 5CDTA 3DT6A 2IHKA 3OD1A 4EI8A 4CL0A 5HKKD 2IYSA 5DI3A 5IJWA 1WXDA 2VTEA 4GW3A 3EZGA 3FMPB 4MWZA 1R0RE 2VQEB 4M1YA 4YMLA 3HBMA 3V7YA 1WWKA 2H9AA 1AHIA 1W59A 2XUFA 2AQHA 2QMQA 4IPTA 3SX0A 3SS7X 4AMUA 5JISA 1JPUA 2AFHA 1SC9A 4ZI5A 1XMSA 3O82A 3VPGA 3PRKE 1CP2A 2HIHA 3OTHA 5JJIA 1FMJA 4L5CA 1JDTA 1EB9A 4HPWA 1I51A 4BXOA 4JASB 3KFLA 1HORA 3GELA 5JC8A 4EDHA 2XB8A 4L8FA 5KVVA 3VJKA 4BLPA 5KNBH 1ZHOA 4I9FA 3L92A 2PNFA 1G18A 5HUJA 2RHDA 4EHFA 2QBYA 4F9GA 1WAMA 2V45A 2WDPA 3BA6A 3LIPA 2IL1A 1XHFA 1V11B 2CVHA 1U8TA 2FR8A 3HJNA 5EYPA 4PO9A 2BTQB 3VAZA 4DLYA 2I62A 3IURA 2XMGA 2IUUA 4BZZA 2WG2A 3HXMA 4F3TA 2R8XA 2QTMA 3TD6A 2BFBB 3ZBTA 4B6FA 1AF7A 1UP4A 5EKXA 2IYVA 3RJ5A 1E9BA 3DKVA 3WWZA 1FZQA 2W90A 5BOSB 5ADWA 4MRMB 1RPZA 5EUQB 1QPBA 1TUGA 1W85B 4DCUA 3TUZC 1N1GA 3QHAA 3T0IA 4LDPA 3H2HA 1X7XB 1UBUS 3ICEA 4QXPA 1XRLA 4JLJA 4XR4A 3SDBA 2ERXA 1ML3A 2WQ7A 3UMFA 4R84A 1ISGA 4UU7A 3V4PB 1A5SB 4OO3A 4F21A 1ICIA 4ZJZA 1DVRA 1P5FA 5TVGA 1MXHA 1OZAA 5ARDA 5FNVB 4O25A 1KKUA 1LNSA 3JQPA 1O3YA 4KYVA 3EG5A 1C3VA 2ICAA 4C7KA 2XF8A 3TUIC 2XOEA 3PXEA 4CM9A 3O8QB 3DE4X 2IK8A 3QPWA 4MW5A 2XE8A 1EUCA 4MUAA 4HQFA 3H11A 4KO4S 3AM3A 3PE3A 2YQ4A 5GOZA 5JLAA 1U28A 2OHIA 3OUUA 2WQ6A 3HU1A 2ZSKA 3NGXA 2DEUA 5EJ9A 2FMXA 5ICFA 1KXJA 2QA5A 3N07A 1XF9A 4B84A 4KR2A 2Q1SA 2YVQA 2WV9A 4AI6A 5EFZA 3INGA 3EXHC 5LP1A 2X15A 3N7UA 3K70D 4E2WA 3HI6A 3P9QA 3WGVA 1H2AS 2X14A 4P32A 2JL1A 5BR8B 2V3VA 4IOKA 1J20A 1W34A 4YHBA 2IXAA 3EA4A