1QVAA

Yeast initiation factor 4a n-terminal domain
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
213
Chain Sequence
QIQTNYQKVVYKFDDMELDEQLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INITIATION FACTOR 4A
publication title Crystallographic structure of the amino terminal domain of yeast initiation factor 4A, a representative DEAD-box RNA helicase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
total genus 71
structure length 213
sequence length 213
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 1999-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qvaA00
1ZCBA 1XU4A 2CL7X 4ERNA 4MKHA 3AKEA 4PFSA 1EFUA 4C0JA 1S8FA 1N0UA 3WP1B 3A4LA 2QSZA 4I81A 3PR1A 2J7KA 1YRAA 4HB0A 1SKYE 2ORIA 1E9FA 1RKBA 2J1LA 5DHFA 3RSOA 4AIIA 4V0OA 4EAQA 2LWIA 3EZ6A 3CR7A 2H18A 1XEWX 3VU9B 2FZLA 2AL7A 3EZ9A 2GTPA 3QY0A 4HAWA 1AS0A 2NPIA 3DKVA 1DAGA 3GLIE 1OW3B 1UBGA 4O2RA 5EE5B 4QHSA 1NP6A 1ZM7A 5CDFA 5IF9A 1G3MA 1KI6B 4E5UA 1U94A 1E99A 1ESMA 4BASA 3AVVA 1R0WA 3LBHA 5C4MA 4OHVA 3X1WA 1SVWA 1NG9A 3A4MA 4DBLC 4FMCB 1UADA 1XTIA 1EG7A 2GCOB 2XEXA 2XNDA 3FFAA 2FJUA 2IK8A 2VP4A 4C0KA 3MFYA 1VIAA 4NU0A 1XD2B 1XBTA 4LYHA 1KMHA 4DKXA 4ZDKA 4L9SA 4PQRA 4DLWA 5EQTA 1J70A 2BM0A 3RNLA 1YE8A 1BOFA 4WXPA 521PA 3GD7A 3K0FA 1KJYA 4EUNA 2XSZA 2ZJAA 4YONB 1CJVC 3AKCA 2VEDA 5FPHA 4J0QA 2UZIR 5EE1A 3GLGA 1YR6A 2O0JA 1DO0A 5IHPA 4OHYA 4IEEA 4MGIR 4A0FA 4OI0A 4BFSA 3B9PA 1JQLB 4HLDA 3TUZC 1XP8A 1KSFX 1E98A 4MITA 1OH7A 2CCJA 1NG1A 1IBRA 4JBYA 3SI7A 1KAOA 2OFWA 4BZQA 2ZI3A 1R2QA 3GJ8A 3LAWA 4AURA 1V5WA 5TY0A 3M6AA 4DSOA 3T1QA 1Z08A 1JR3D 1JR3A 2N42A 4EFLA 1D9ZA 4DDWA 5CJ2A 2X1VA 1RRPA 1O87A 2G3YA 1M2OB 3GEHA 2H8KA 1NN5A 4DLRA 3GQBA 2ZR0A 3P32A 2ZJ8A 3FOZA 1GUAA 4AYTA 4WA7A 5JEEA 3FVQA 3QKSA 3SJAA 1NMYA 2GK7A 5HE9A 3VU9A 3VQTA 3NHAA 1OFTA 1R8SA 3LFUA 4BFZA 4UKDA 3KQUA 3U44B 4LPKA 4B33A 1T0JB 1H8HA 1G21E 1WF3A 3QXHA 1FP6A 2KSQA 1KOFA 1XCMA 3GLHA 3PFIA 4LX0A 1GNQA 1Z07A 5JBQA 2O8FB 5C46F 3ZH9B 1TF5A 1W4RA 3BERA 3V4RA 4ZIRA 1HV8A 3CNLA 3CF0A 1NIJA 2ZRNA 3SFVA 3AVXA 5K8UA 1L2TA 2GZAA 4MGZR 1MOZA 2ATXA 2ZI7A 1ZNWA 1S2MA 2HCJB 2C78A 3SFZA 4E07A 1OV4A 5H8WA 2NIPA 3FKQA 1XTJA 4ASUA 4UNNA 1P75A 2GA8A 1LFDB 3X2SA 1SHKA 4NYJR 4W9MC 1FMLA 2Z83A 3MLEA 1T9HA 2Q3FA 3U3OA 4DUGD 2P6UA 1Q44A 1HE1C 5LB2A 2NZ8A 2YNMA 4M1TA 4E09A 2WPDA 3RRNA 1C4OA 1LTQA 2D7CA 1BYUA 4MKGA 2PMDA 1S96A 5BQ5A 3LBNA 3K70C 2CLSA 1R8QA 1SVLA 2P6NA 2VP5A 2ZSAA 4LHWA 2GXQA 1OH8A 2FFAA 3IIJA 2RGBA 5FBVB 3LXXA 3I5YA 1G7SA 1UBFA 3U6KA 4Q4HA 4KJZA 3UK6A 2ZI5A 3ZYCA 1COWA 2HV8A 2GVZC 4URZR 1GG2A 2FEMA 3QEJA 3NXSA 4PHHA 2QPOA 1F60A 3FFBA 2HT6A 3TH5A 4D6PA 3OHMA 2ZYUX 3OFND 2GEDA 3OE7D 1JJVA 2YWEA 4Z8XA 1N6HA 4TTPA 3EWSA 1KY3A 1E94E 4A6PA 1OIWA 1E1QA 2YKGA 2DR3A 4Q18A 3VR2A 4G5GA 3THYB 4JJZA 3M1IA 4QNMA 2O8EA 2Z43A 4CZ2A 1J8MF 1C1YA 1CXZA 2AHOA 1PZNA 2XB4A 4XTCS 2AN9A 1OPXA 5DYIA 4Z1MD 1KTVA 3LVRE 2GEUA 1R0YA 3GJ6A 1KSGA 3H4MA 4HSEA 2P6RA 2GNOA 3FMFA 2B21A 4TLCA 4Q00A 3THOA 1U9IC 4OI4A 3K0CA 3RHFA 2WMNB 3HR8A 3MWKA 5FOXA 1BYIA 4CEJB 1PJRA 1SVIA 2ZRAA 1TUIA 1PLKA 3Q7PA 4NYJQ 4NKRA 1P7CA 1S0UA 3C8UA 2ZR7A 3GLIA 4PO9A 3SOPA 2FG5A 2Z0MA 4IRUB 3SQWA 5FTNA 4DRZA 2PEZA 3UG6A 3KXLA 4AY2A 4NYMQ 2NO6A 2QAGA 1AZTA 3TK1A 3L8ZA 1KI3A 4YXWD 4YXWA 3AQ4A 3TAUA 2IF0A 2W83A 3EAQA 4I99A 1Z0JA 5KSPA 3AGPA 5FBLB 4BLQA 1FPMA 5DI9A 1XTSA 3KQHA 4Z8YA 2LKDA 1S3GA 4KFTA 2JDIA 2DHRA 4EPXA 4TSFD 1CIPA 5FTMA 3C15C 2ZYTX 2HF8A 4QHTA 3VHLB 1F2TA 2BIFA 2IYVA 3SYNA 2IXEA 1TL7C 2IYRA 1VYTA 2I1VB 2J45A 5FL7D 3X1YA 2W6IA 3RSLA 2GESA 1A4RA 2F1HA 4ZCMA 3MG9A 2FV8A 2NTYC 1WP9A 1JXMA 2W6JA 1JPJA 1EFHA 2ZE8A 4G0NA 2QRZA 5EZ6B 1XFAA 2YV5A 1Z2CA 2R44A 2F43B 1S9DA 2CEAA 1ZW6A 2V55B 4HAZA 4A0GA 3DM9B 1Q0UA 3IBYA 721PA 1Q20A 2A2ZA 3CONA 4BFYA 4GL2A 4CF7A 1ZD1A 1SVKA 2ZI9A 5AK0A 2CMKA 3THXA 3TSOA 1OJLA 2FGJA 2P3SA 1ONBA 4FMDF 4QBHA 2GXAA 4V03A 1UKEA 4TT3A 3EZ7A 1IAQA 3U3MA 121PA 3LW8A 1G5RA 4Q4LA 2ODEA 4R9UC 1XJCA 5GJWC 3LA6A 2OXRA 4KVAA 1Q1BA 3KJEA 4R7ZA 1DARA 1NIPA 5B2ZA 1H8ED 3L0OA 4BGDA 2JLSA 1A5TA 4M53A 3N70A 4UXJA 4HZUA 2MSEB 2EFDB 1NN1A 3PUXA 1ZINA 3VR6A 1RJ9B 3U3KA 3A6PC 1U0HC 4JVMA 1E2MA 4B3CA 1FNMA 4URWR 5IK2A 1A7JA 1T0HB 2XZOA 1ZVQA 2QY9A 1Q12A 2IEYA 3NG1A 3FYHA 3DPUA 3CM0A 5LBIA 5JS7A 4TLEA 3GLHE 5LPNA 3CRW1 1DVRA 3P4XA 3R9XA 3B8HA 4Q1BA 1LNZA 2QQ0A 1KO5A 1XMSA 2VSOA 3AF2A 3CRRA 4PO8A 3SJZA 2EQBA 1QZXA 1S4QA 4V02A 1KI2A 1XX6A 4Q47A 1MABB 4DCNA 2JLYA 2AWNA 1GFIA 1VIYA 1WE2A 2WJHA 3LVQE 2DWPA 5E7MA 4B2LA 4PZYA 2WAXA 4F7WA 2XTNA 4HAVA 4HUQA 1FUKA 5CDFE 2J0QA 4KI0A 2UZ3A 1C9KA 3Q85A 1KZGB 2C5LA 2PZEA 1GRNA 1Z2AA 3AKDA 1VECA 3I1FA 1RRCA 4YMWA 1P62B 1YR7A 4DLYA 2DYKA 3KKNA 2ZPTX 4DCUA 2G83A 3SJBA 2P65A 5CIWA 1DBSA 1P9NA 2C95A 1KKLA 2RGDA 4QGHA 3IDQA 1CULC 1R6BX 4HZIA 3SS8A 2JLRA 1NVUQ 2MSDB 4ZPXA 2V54A 3RVBA 4CEHA 5FR2A 3AM1A 5FTKA 3AVTA 5KPDA 1E2DA 1LB1B 4O25A 1JR6A 3HWSA 5DLQC 4YMSA 3Q5EA 3GLFB 1QHHA 2AXPA 2A5DA 5TMPA 3GLGE 2IYTA 2YWHA 1MRSA 1ESNA 5L3VA 4MYHA 5KU1A 4LBWA 3HJNA 2WZQA 1Z28A 2BV3A 2GJ9A 2HDNB 3CZPA 5SZIA 2WWWA 5M04A 4GBMA 4P3YA 3K0CC 2HLDD 1P60A 2A3RA 2JLVA 1B0UA 4YQFA 1MO3A 3DMNA 3EIEA 2ZRCA 1CR0A 2DWOA 3AH8A 2J0SA 1VYUA 3CWZA 2G0NA 3GLHB 2O8FA 4ABYA 2KBFA 5K8IA 2IYQA 4Q7KA 2C99A 4JT4A 2F7SA 5K8LA 1MABA 4WOPA 5L8VA 1Y63A 3UMRA 4LYAA 2QNRA 1N6PA 4Q1FA 1U99A 1W4BA 2Z4RA 3IKJA 2OFXA 4KCGA 4KHZA 4MYTA 2C77A 1NF3A 1QG2A 4UNPA 1E9RA 1FQJA 2OV2A 2P0EA 3ZD7A 4TL8A 3K0FB 1BO6A 2FSGA 5JWHA 2IF2A 3WY9A 4LZZA 1KK3A 4X8HA 3W8NA 1W46A 2RGXA 1ZP6A 2VLIA 3FHOA 3H84A 4DDVA 5P21A 5GVSA 1HY3A 4TT3D 1M1YE 3WMGA 2ZRPA 4CYMA 3JVVA 1VMAA 4F92B 2EU8A 3S1AA 5DSZA 3R7WA 4MUBA 3EPKA 1GOTA 2OBNA 4A2PA 4I4LA 5KOYA 1XPOA 5B57C 2CL0X 4IVRA 2GZHA 1W48A 2IYLD 3K9LA 5J4YA 2BCJQ 3QF7A 1E2PA 4IFBA 3SNHA 4IVQA 1ZUNB 3BC1A 1KAGA 1NBMA 2HEIA 1K5DA 3VMFA 2PX0A 4LJ7A 2VQSA 5FUYA 1EFRD 4QG7A 2FE4A 1U8YA 4B75A 2ZJOA 2XAUA 4I1UA 4LV8B 2JLUA 2PZFA 4TTQA 1CJMA 3L43A 1TEXA 4P4SB 5FTJA 4AKIA 1OKKA 2QGZA 4WXRA 1Z5ZA 1YJ5A 1E1QD 5KDOA 1P2VA 2QN6A 4D0NA 2ZSDA 1TF7A 5ELXA 2X19A 5FBRB 2PJRA 2HJVA 2QMHA 3GFTA 5FPTA 5TDHA 4URUR 4YLGA 4A2QA 3QKSB 4D0GA 1II0A 2JAQA 4QXAA 1Z63A 2YWFA 4UXHA 1KY2A 2ZJBA 1VCNA 4IOLA 5G3ZA 4PPNA 4FINA 2WJIA 3MWJA 5CB6A 1T5LA 4MRNA 3QG1A 1I4DD 4GZMA 4PC6A 2NO1A 1OFIA 2R6AA 1E2QA 2VP2A 3EA0A 2ECKA 3U3RA 2G9NA 4XVRA 3HDTA 5KSYA 4CT4B 3ZQ6A 2WMOB 1AJEA 4JS0A 2W2TA 4TWZA 3SDZA 2BHRA 4KFUA 3BE4A 1FMJA 1ZM3A 4X8MA 2FFBA 1CKEA 2EWWA 3TLXA 3EASA 3QNUA 3RABA 3RS7A 1JR3E 2BJVA 3NBFA 1ZC3A 2V7QA 2ZRLA 3B1XA 2JIZA 3D3QA 2V4ZA 1E2NA 4ZDIA 2FDCA 4PHTA 5DE3A 3BORA 5J5CA 4NCHA 2BVNA 3K8YA 3SZRA 4GOJA 4PZLA 4TMTA 1N25A 1Z8FA 1D2EA 2CHGA 4M1KA 1OHHA 1TTTA 3KL4A 5DYGA 4BEJA 3HU3A 3QOFA 1N6KA 2PBRA 3I73A 1VTKA 1QVAA 4DHEA 2ZRKA 4XSHA 5JMTA 5BN5A 3W3ZB 3W3AA 3M0EA 4HAYA 1SVOA 1OHHD 4JIMA 4LBYA 2C98A 4EFNA 2JJ2D 2KE5A 2P5SA 4M22A 5CK4A 3AVOA 5GJVC 4O3MA 2K5UA 821PA 4ARZB 4MH0R 1SVSA 4B76A 1VYVA 3KKOA 1GTVA 4NCKA 3RLFA 2OCBA 3VNUA 2D7DA 1ZD8A 1BIFA 2BEJA 1BMFA 1NY5A 2BMJA 3AF4A 4GPTA 2ATVA 5FL7A 5JSZA 2BBWA 1QHGA 1XRJA 2O52A 2ZU0C 3K0AA 2QP4A 4XSGA 4Z51A 4BE7B 3QI2A 3VKGA 1XMVA 2NGRA 2R6CA 4RD4A 5EP2A 5FOUA 4Q66C 3I32A 3TQFA 3DM5A 5EUMA 4BFXA 3ICQB 2JJ2A 3BIFA 4MA4A 2GETA 4WW0A 1ZMXA 2G6BA 2ZSEA 2VF8A 1F2TB 4B71A 3NEJA 4PX9A 1G3IA 3I3SR 6Q21A 2EFGA 4NE2A 2PMKA 3E1SA 2GZDA 4A9AA 3OIVA 2BM1A 3IPXA 4G3XA 1RVDA 4YMVA 3U6BA 2WWYA 5AJXA 5FPYA 4PTLA 2WKQA 3UMFA 3VFDA 4BWYA 1OFUX 1E2KA 3C5HA 3LNCA 4PR0A 5HE8A 1YZLA 2OAQ1 4YMTA 2WKRA 1MRNA 4QRHA 3RRZA 1X6VA 2J0UA 2ZR9A 4IOKA 5CM9C 4RSGA 4KFRA 1II8A 2RH5A 5IK2D 2VRWA 1AN0A 2YJTD 2ZVQX 4HB4A 1GL9B 4A8JA 2QUZA 1JEEA 1G291 4B74A 4Q4JA 4LHVA 4X8LA 221PA 4TYQA 3ND8A 4URXR 3UPUA 2EFEB 2OSBA 3T61A 3AVWA 2O8DA 2XX3A 3AVYA 4A0HA 2R62A 4DSTA 3O8DA 4P31A 1F2UA 3N2EA 2GAOA 1KDPA 1T6NA 1OLOA 3AVUA 1YR8A 1XXHA 4HLUA 3UWKA 1OXSC 1SXJD 1YZKA 2GCNA 1Q3HA 3NKVA 1G20E 2ZQ5A 2ZJ5A 2AKYA 3VHXA 2PLFA 1CU1A 2OCYC 2PT5A 1US8B 5EE9A 2JATA 5AUPB 3A37A 4U7DA 4DVGA 3QKRB 4G5SA 5HCNA 3ZJYA 4TMZA 5CYPA 4RKFA 1TNDA 4NYIQ 1G41A 4OYHA 3A4NA 5BYJA 1XTQA 4DLZA 2ZETA 3NC0C 1HQYE 3WBJA 4IFEA 3GJXC 4DT1A 3PENA 2VF7A 4LYJA 3F5FA 3R7WB 2ZRDA 1X3SA 1RW4A 1Z6GA 2EW1A 3ZQJA 1GWNA 4K8OA 1ZAKA 2YINC 1TQ4A 4A6XA 4IDNA 4RZ3A 3DOFA 4W7SA 2O8DB 1D2NA 3EA5A 2QP9X 2F1RA 4FCWA 4FWTA 3DZDA 1IN6A 2FX3A 1E9DA 3GLGB 4O0MA 1N2CE 1Z0AA 2JCSA 3KX2A 4NH0A 4HZUB 5H68A 3TVDA 4A82A 3THYA 5AR1A 2PLRA 2QMOA 4PPGA 3AF1A 4EKDA 3O8RA 4CEHB 1W0JA 4NYIR 4ZCIA 2B8TA 3VR3A 1P73A 1SXJE 2QROA 2Q3HA 2IS2A 3LX5A 1P3JA 5EE3A 4M9XA 1SXJB 2DWQA 3W6OA 4BLSA 2CJWB 2H92A 2OHFA 2PCJA 3VR4A 421PA 2ODNA 5F3WB 1JECA 4B34A 2W6ID 4PC7A 4Q1CA 3UWOA 4PHFA 1OXUA 1ZM4A 3J81k 5BXQC 3HPQA 3WNCA 2QPTA 4NZYA 2A9KA 2QM8A 1RFLA 3A1TA 4LJ5A 5GVRA 3RDPA 5JCZA 4UNSA 1UFQA 2I3BA 3W5IA 4CGZA 1CF4A 4KBFA 1AIPA 1AKYA 2FFQA 3TSWA 3E5HA 2VHUA 1VG1A 1RE0A 2CVHA 5FBWB 1IN5A 5JI2E 4P32A 2QE7D 4NCNA 4B3BA 5F9HA 4C2UA 1S3SA 2DFKB 4RD2A 5AJZA 2WSSA 4US1R 5D3MA 5E95A 5FUVA 1IJFA 2QEQA 3VR5A 1V43A 2Y8EA 5JCPA 2AR7A 4TYNA 1CS4C 3O8BA 1SZPA 2KJQA 4OK6A 1F6BA 1AGRA 3IBGA 1N5KA 4P33A 5BN3A 1A2KC 1I2MA 3A58B 3OFNA 4NYMR 1GL7A 2CLDX 3W9YA 4PQYA 1ZYUA 1FZQA 1TEVA 3CH5A 3QQ5A 4PANA 3QJYA 1G9XA 3X1ZA 3GJ3A 2WPDD 2R65A 1GRQA 1JAIA 1G7CA 1VCMA 1QHNA 2VO1A 3PVSA 4LJYA 4N3NA 1MO5A 3DHWC 4ILEA 5AUQA 5CM8B 1G4AE 2FSHA 4FMCF 2Q0HA 4D81A 3EIHA 2AFHE 2QA5A 3B1YA 2PCLA 2QORA 3LQQA 1NLZA 4LBVA 1XEXA 2JIZD 4XWAA 2FA9A 4MDEA 3QBTA 2X2FA 4PPQA 4JKIA 1OIXA 1ZM2A 4NCIA 1GAJA 1II9A 1U81A 1XEFA 5BW8A 4ESVA 3THWA 1KSHA 3GJ4A 5J4KA 2IS4A 2BEKA 4JZKA 3U4QA 1G19A 1D8TA 2F1IA 4TMXA 4B47A 3UMSA 3MCAA 2WOOA 3ZVNA 2C9YA 3BB4A 3B9QA 3D31A 3WMEA 3FMIA 1L8QA 2WHXA 3KKQA 4OQFA 1YZQA 2RKOA 3SEAA 3NWJA 4BFUA 4Q48A 5FOSA 4D4MA 4B35A 2JASA 2IYSA 3PV0A 2VP0A 3KZ1E 3TVTA 4LHXA 1CLUA 5FOTA 2QENA 2JLQA 4EPTA 1LY1A 5KDLA 1KI4A 1G8FA 3FKSD 1M7GA 2RAPA 4P0TA 4QGFA 1WBDA 1IY0A 5KSZA 2IC5A 2GAAA 2D06A 2FN4A 3AEZA 3OEED 4AKHA 3VR1A 1J90A 1G16A 5KDDA 3MMPA 4DB4A 2QMUA 1WBBA 4PQFA 2BMEA 2F3TA 2O8CB 1SQ5A 4A8JB 3NVAA 2KB0A 3VNVA 1SVMA 5FUXA 1XJQA 1EGAA 1XMIA 2IEZA 5JHHB 3GLFA 3GFPA 5L3SB 3C16C 3NC1C 4AKEA 1ZC4A 1IN4A 2OLJA 3QVUA 1R5NA 4KYIB 2WOJA 4GDFA 1W0KD 5F98A 3RAPR 1CP2A 2YVUA 3RC3A 1DS6A 1G6OA 1J99A 4C0LA 2Q6TA 2R8RA 2CBZA 3PJRA 2BKUA 2IYWA 4Q4JB 3K0SA 3WRXC 3K0EA 4C4PA 1UEIA 4OQMA 3KQLA 1FTSA 2ZANA 4N0EA 4UNQA 5B64A 2DBYA 1DE0A 2V3CC 4GP6A 5FR1A 4DWJA 1E79D 1E79A 4L4UA 5G41A 1I4LD 2A5JA 2J59A 1E2EA 4E22A 2REBA 4PC2A 1DAIA 4CVNA 4U5XA 4ZO4A 1WQ1R 1XCGB 2G77B 5JJKA 1IHUA 1TPZA 3Q9LA 4LUCA 1VHLA 2ZRJA 4IDHA 1N6IA 2FPLA 1FP7A 1N6RA 4P4UA 4RD0A 1X8LA 4NPHA 4ZI3A 2GJSA 4MYCA 5J4LA 2IS6A 3WHKA 4R2IA 1XXHB 4LJ6A 1SXJC 1YR9A 2OEPA 4Q9IA 1OT3A 1D5CA 5JJIA 3W6PA 3AP1A 3B78A 3GP8A 2EFHB 4JLOA 2F9MA 3PEVA 2VHJA 3E70C 4FIDA 4IVPA 5FPKA 2JGNA 4MKIA 3TGPA 3ASZA 1QBKC 3P26A 1JPNA 2LCFA 2REXB 3PCRB 4D0LB 3U60B 3GFOA 5JZVA 4QJ3A 4KBGA 1T5IA 4WZBE 1ZUIA 2ANCA 1FX0A 4NL4H 5H1YA 1W5TA 4KVGA 4O2LA 3WRYC 3B82A 4DXAA 1IM2A 1Z3IX 3CNNA 2WJGA 4NCJA 3TUJC 4JLBA 3Q7QA 4YMUA 1KMHB 3JVUA 4DT1B 1P5ZB 1ZD9A 5SZHB 2CJWA 1G3QA 1US8A 1HURA 1IXRC 1YZUA 2QBYB 1U8ZA 5EXPA 4TQUS 1I2DA 2IA5A 2Z4SA 1W36C 4IHQA 1GSIA 4AG5A 4XD7D 1G6HA 2V8OA 3QXXA 1HTWA 2ORWA 3T5DA 4LWZA 4U00A 4A1FA 2J5XA 1P9RA 2DFNA 4POAA 2IS1A 1XDBA 5FOVA 1DAKA 2YHSA 4GI7A 4A2WA 4EJSB 2IYZA 4P4SA 2IUUA 2D2FA 2VP9A 4BFTA 3DVLA 4BRWA 2QZ4A 4JLKA 4GZLA 2KI5A 3U5ZB 1SULA 2CHVA 4LYFA 2PJZA 3MRSA 2D62A 2RHDA 4A15A 3AV0B 4B73A 1Z0IA 2GK6A 1NLYA 5ANRB 4JYCA 4AD8A 4DSNA 1UM8A 2I1QA 2G88A 4B3FX 1ZNXA 1FW6A 2CXXA 4Q1AA 3N5CA 1J7KA 2A7QA 2D2EA 4HB3A 3LLMA 3THXB 3OESA 1S1CA 1YZGA 2FNAA 2UVQA 3KFVA 4CDGA 2RHMA 4WIAA 1JI0A 1G8GA 1ODFA 1R10A 2OZEA 3OE7A 3O8CA 5EP3A 4ZDJA 4GMXA 1P2UA 4TMKA 4DLVA 1KJZA 1T3SA 1XXHE 5AUNB 5CB8A 5CITA 2FH5B 2OUKA 2GCOA 1OSNA 1RYFA 5SZJA 5HPYB 2ORVA 3KQKA 4G5QA 1QRAA 2OILA 1E6CA 3KTAA 4AG6A 4JJKA 1IXZA 3RANA 1M8PA 2P67A 3NIBA 4NHOA 5AUOB 1XD2A 3LLUA 3R9WA 4HDCA 3E2IA 1E0JA 4AC9A 3TBKA 4TLBA 2QE7A 1X1SA 2UKDA 4M8NE 3V9PA 3QPWA 3ADKA 2NOAA 5A4JA 3IIKA 2ONKA 2P2LA 4C0BA 1W49A 3KUCA 3ZVRA 3TRFA 4QOSA 1IOZA 3C41J 2QU8A 3U61B 4LBZA 1N6LA 4K81B 2AD5A 5A5GA 1FL9A 1EFCA 4W5WA 2W0SA 5G40A 2XJ4A 2J41A 4KLNA 1CJKC 2AKAB 4Y0VA 3ZGXA 3ZIAD 5JRZA 1AA9A 3CX8A 3QEOA 3U7FB 3KFXA 4XOIA 3T06B 3QUSA 2GXUA 3AKYA 3RRYA 2WWIA 3ZZTA 4D80A 2OESA 3UIEA 3BD9A 3GLIB 4B32A 1E69A 4RZ2A 4ZCLA 2ZYVX 2ZXUA 4XJXA 1DTSA 1M7HA 3CW2A 3P27A 2WWHA 2AFIE 3P1JA 4PAMA 4ZKEA 5FPSA 1HH4A 2ERYA 3QG5A 4G5RA 1D2MA 1F2UB 1GZSA 3REGA 2F6RA 3TUIC 2NQ2C 2CVFA 3WYFA 3UANA 3P20A 3B1VA 3NBXX 3C14C 1GKYA 1KYIA 4QBFA 3RS2A 3LV8A 4F91B 3ZLJA 1TU4A 3T35A 4D2IA 3K9GA 4V0NA 1R4AA 2EVWX 3GJ7A 1UAAA 3AVQA 2O8EB 1CJTC 3KTAB 3T1TA 2WJVA 4D4LA 1CRQA 2H17A 2V9PA 3TNFA 1KK1A 1LF0A 2ONJA 4GP7A 4KO8A 2JJ1A 2JLWA 2KBEA 5KUTA 1U98A 1F3OA 4C7OB 3C5CA 3EC2A 1CJUC 2E87A 3A1SA 4L8GA 3SN6A 2TMKA 3TJZA 3TAHA 3AUYA 5F2EA 1DG1G 2GJAA 4AYXA 2XJ9A 1XD9A 2ZJ2A 5HKKD 4US0R 4JSTA 3IILA 1T8UA 5FTLA 3KB1A 4RVCA 4ZI2A 2OLKA 1Z0DA 3VKWA 1GKIA 1EX6A 4QL3A 2J7PD 3EPLA 5J47A 2WAYA 3CPHA 4V0KA 2WIAA 3P4YA 4DLTA 1N0VC 5C18A 2ZRGA 4HAUA 2YYZA 3WP0A 3GMTA 4WZAE 3BBPA 4MYUA 3SHWA 3IQXA 3K0AB 4NBSA 2X8AA 4EQ6A 2VSXA 4OI2A 3FWYA 3CPEA 3Q3JB 2OT3B 2FZ4A 1W36B 4OJKA 3VX3A 4BLTA 4MUAA 3FHTA 1EK0A 2GF9A 4XIGS 2DPXA 3TR5A 2ZSFA 4LC0A 2D74A 1DAEA 1OE0A 4NP6A 2GEVA 1MR3F 2VTKA 4D4JA 2J46A 1WMSA 2B92A 2N1BA 4PSKA 3BXZA 3REFA 3BK7A 3IHLA 2QBYA 2H7VA 2XTZA 4GT1A 4A36A 2J3EA 3A36A 2IXGA 1G1MA 1YRBA 4C0SA 1A82A 1N5JA 1U8AA 1Z29A 2MMCA 1NSFA 1X8KA 1IONA 4M1SA 1VKJA 4NTZA 3LWNA 1SKYB 1ZNZA 2E1RA 3BS4A 2OFOA 4LJ9A 4XH9B 4DCSA 2WWXA 2ZRHA 3AP3A 3BH0A 3IO3A 3U3JA 2ZREA 3WNDA 3DDCA 5FFMA 3N2IA 5D3MB 1W4AA 2AXNA 1AS2A 2ODBA 3OF5A 1WB9A 1EWRA 4EPRA 3CF2A 3QXJA 4HB2A 3AP2A 2JLZA 1JQJC 4B6EA 2PH1A 2V1UA 1VCOA 1P6XA 1J2JA 1ZIPA 2ZUDA 1G8YA 4XTRA 1RYHA 1OYYA 3ONWA 3L82B 2Z5FA 4KODA 2CE7A 3QPVA 4FD2A 3QF4A 1Z6AA 1RRFA 1XWIA 4KYUA 3CPJB 1R0XA 3FMOB 4IW3B 5JFGA 1PV4A 4UNRA 3I8XA 3TW8B 1E2JA 4M0LA 3R8CA 1S1MA 1G5TA 3RC8A 3ECCA 4C0HA 1Z6YA 3L0SA 4HI0E 4OKSA 2H1LA 1W36D 2ZTSA 1K8RA 3GJ0A 3BWDD 3W5JA 3U2QA 2NO9A 1W2HA 4Q02A 2EWVA 2GCPA 4BEBA 3EZFA 4TLAA 4TZ6A 3KDSE 2WSMA 3UATA 5CLLA 3SBEA 5DGXA 4CEIA 4DCTA 5DNYB 4D82A 5HTKA 1P4SA 3U7EB 3DMDA 2C04A 4CT5A 4A0RA 1HT1E 4FWIB 1SGWA 1G4UR 2GBLA 3CR8A 3WNBA 3BAFA 3IHWA 3DZ8A 4IEIA 5J40A 3SYKA 4DCVA 3HU1A 4EPWA 3OIUA 4ZIRB 2ZAMA 2Q9BA 2J87A 4MRVA 1N6OA 4GMDA 4KAXA 1E0KA 3KXIA 2NO0A 3FDIA 2WBLC 5AWFC 4DB2A 1UKVY 2DB3A 1Q1EA 4LJAA 4L5BA 4JLVA 2R9VA 3T12A 2RGAA 3EARA 5LDDC 1G7RA 1GIAA 5E3HA 2FPMA 4PXAA 2GF0A 4B3XA 2BBOA 1E1RD 5A0FA 2REOA 3PIRA 1KGDA 1MH1A 3RYTC 3HP1A 1XTKA 4Q19A 5E7IA 4HATA 3I61A 2AX4A 1R0ZA 3B5JA 3KKMA 5EP4A 2XZPA 3ICEA 3FKSA 4V0MA 1M74A 5DN6D 4Q9HA 4AI6A 1NJFA 2GDJA 1IN8A 1U90A 2GHIA 4TQAA 5K8TA 2G1KA 5CK5A 4EFMA 2FSFA 1PUJA 2VIIA 1SXJA 2VYFA 1VG8A 4KFSA 1N0WA 3OAAD 2VHQA 4EDHA 5JRJA 4OQNA 5C2JB 1JNYA 1MV5A 2BOVA 1KO8A 3PEUA 2QI9C 4CEIB 1Z6TA 4H9GA 4B2IA 5TV2A 4N0DA 2W2XA 5KO2A 4Q5IA 4OK3A 1FFHA 4Z1MA 5TARA 4C30A 4BECA 1W2GA 3FE2A 4JMPA 4DIEA 3ADBA 1RPZA 2VA8A 4OK5A 1JALA 2BDTA 1KJWA 5SZKB 4OHWA 3DL0A 4TL7A 2QTHA 1GDDA 2Q3MA 1AKEA 2HLDA 3PUYA 3A1UA 5TB5A 2RGGA 4GRAA 3TKLA 4OJQA 2IBMA 3KXKA 1L4YA 5C4GB 5JJLA 4RCYA 5EJEA 3RS4A 1KI8A 2XOKD 2CK3A 2J0UB 2VP6A 1KZ7B 3NTUA 4RY2A 3B6EA 2IWHA 1G64A 4M9ZA 2FU5C 1E2FA 1YVDA 3SC3A 4DJTA 4RD3A 4KLZA 4TSFA 5LD2B 2ZRIA 3HR7A 3QKUA 3OEHD 4B48A 1EXMA 1ZRHA 1UPTA 3OIYA 1CEEA 3M4YA 3T5GA 1E4YA 3BRWD 3NDPA 1YHNA 2NG1A 4HLCA 4LSGA 2PX3A 2L0XA 1DO2A 2HYIC 4WBSA 2Q9AA 3IIMA 4JVSB 1PLJA 1ZU4A 2LKCA 4JBWA 4L15A 4JL6A 2ZRMA 1AM4D 1P2SA 4WAUA 2MSCB 1CRPA 3WXMA 4LRWA 1ELOA 5GADl 2R2AA 1L4UA 4ASUD 1R7RA 1O3YA 4V0LA 2XOKA 1E0AA 4HAXA 3FB4A 4TYPA 4GNKA 3LY5A 3PEWA 1NBME 4EPYA 2IYUA 3GCGA 4JLPA 1NMZA 2RGCA 2CNWD 2B6HA 3I4LA 4RZUA 1BKDR 1N5LA 1SHZA 2H57A 1VCIA 1GVNB 2IHBA 3K1JA 3QENA 1WCV1 3IQWA 1UKZA 2YC2C 4RD6A 3W90A 2F9LA 2OBMA 2QAGB 3V4FA 3T1VA 1GRRA 1OYWA 2IL1A 1RRGA 1TQ2A 3LXRA 1H65A 2FPKA 4KITB 3MAAC 1XCPA 2ZS7A 2WWGA 1XPRA 5KNDA 5LB4A 2ZSBA 3VTKA 4IDPA 3HYRA 2ZU6A 3FPAA 4H1VA 3KQNA 2WKPA 2ZRBA 3RS0A 4XWOA 4BLPA 2XGJA 3I8SA 4C2TA 1XZPA 2PT7A 2CHQA 3CUEF 3EW9A 5DO9A 3RS5A 3B1WA 5CIQA 4K46A 3FGNA 3QE0A 4CW7A 3D7MA 4DLXA 5IT5A 4LJ4A 2BBTA 1UKYA 1TADA 2X77A 3MWYW 4S2EA 3PXGA 1NN3A 4EQ6B 4UQOA 1OH6A 3NHBA 2ZE5A 4DLUA 3RRMA 4MRRA 3QF4B 4MQBA 3H1TA 5JWOA 4PAQA 3TW4A 2H16A 5UKDA 4LC1A 5CJPA 3KUDA 5KTYA 4M9SA 1X86B 2YC4C 3F0TA 3ND9A 4FCVA 2OCAA 3CRMA 2FSIA 5AJYA 1ZNYA 2EYUA 2QRNA 2ASEA 4IOJA 4MRSA 4HUQB 5DISB 4QJ4A 2VHTA 5KHOC 1WA5A 1KI1A 1RIFA 3IO5A 5DN6A 2AWOA 1ANKA 2AD1A 5FL3A 2JEOA 1B23P 1NVVQ 2J9RA 1DAMA 2QL6A 3ADCA 4BLRA 3ZZ0A 1GM5A 3D6TB 5FUWA 5HKKA 1IN7A 4UJ5A 2O0HA 1OFHA 3AUXA 3HYTA 4JVLA 1KI7A 1TAGA 1Q1ZA 2HXSA 2KWIA 1DEKA 3EIQA 2MMGA 4NDZA 3CLVA 3TIFA 2ZITA 3KB2A 4Q9JA 4RCZA 4XVUA 1KKMA 1NRJB 3UKDA 2XTMA 4LGMA 5HZHA 3U44A 1II8B 1DAHA 2HT1A 3KKPA 4UJ3A 2X2EA 1NL3A 2ZI6A 1XPUA 3V00A 1CR1A 2QAJA 4B2PA 4BFWA 4OQXA 2CK3D 5JSZB 2IUSA 1G3UA 2DFLA 4PO1A 1YQTA 3K9NA 2D4HA 2NMVA 4FI3C 2GJ8A 1KI6A 2ZROA 2QQEA 1LF5A 3NBZC 2OBLA 4QFMA 1TQDA 1ZM9A 4WVFA 3PG5A 4ZKDA 2QT0A 1KSJA 1BMFD 1Z22A 4CRWB 2C9OA 4S35A 3NH9A 2FEOA 1Q21A 4ON9A 5G53C 4GOXA 5JWRA 3AGQA 2G0TA 5EZ5A 2W00A 3BFXA 3LD9A 3LBIA 1OH5A 3QVVA 3EZ2A 1GNPA 3NH6A 1CTQA 4BRUA 2BJWA 3EX7C 3G0HA 2O8CA 3ADDA 2A30A 1G18A 1LS1A 1DPFA 5F9FA 2PZGA 4B3DA 1G7TA 1UBEA 2WIBA 3BB1A 3AF0A 5LD2C 2F3RA 5CYOA 5H70A 2XZLA 5HR5A 2C2HA 5IRCD 4TYYA 2IHYA 1DADA 3B13B 1QHXA 5EXXA 4A4DA 2WVJA 3DO6A 4M1OA 2OXCA 1QVRA 3CRVA 3BFKA 3SR0A 2Q21A 1MO4A 2ZVPX 2O8BB 1NLFA 2XNDD 2IWRA 4RFVA 2C8VA 1W4CA 5FI1B 2W6JD 3LX8A 4JLMA 2D3WA 5FI0B 1JEDA 1S9HA 1UF9A 4URVR 4DLSA 4US2R 2CCKA 3CX7A 3QPUA 3Q5DA 4PC3A 1PUIA 3W34A 1OB5A 3WBKA 3ZDQA 4TYWA 4LK2A 5DI3A 1A2BA 1KK2A 1T91A 2ZYWX 4L16A 3IEVA 2QTVB 2OM2A 2BMFA 1TX4B 2C9CA 3VX4A 3GEIA 1E9EA 3G5UA 3TSZA 2W0MA 1MT0A 3PUWA 3R20A 2WWFA 1NJGA 4EJSA 2IX3A 3H86A 4P4TA 4YC7A 5GJCA 5D3QA 1KMQA 3EC1A 1XJ0A 5L3QB 3LDAA 2QG6A 1Z0KA 4GOKA 5BWMA 4DC9A 1AZSC 3KJGA 3LW7A 1W7AA 1D9XA 1PLLA 1Z6XA 2FF7A 4I1OA 3CIOA 1P2TA 1A1VA 4M4SA 2DY1A 2O8BA 1E9AA 3X1XA 1IJEA 4DEXA 3KJHA 3ZD6A 3IEUA 4Q03A 1D6JA 3ASYA 4QGGA 5L3SA 3H0KA 4TZ0A 3EWAA 3L8YA 4CIDA 1G8HA 5L3RA 3PEYA 2BKEA 2GXSA 3IGFA 2ZS8A 1MKYA 4X8OA 3TE6A 3RWOA 1E0SA 1ZUHA 5EXSA 3W8RA 4LCBA 4F93B 4RKEA 3MWLA 3CWQA 1EX7A 1EFRA 4HDOB 3F8TA 1Z47A 1F48A 4LV6A 4B44A 4D4KA 1E2GA 2B7BA 3IUYA 1RZ3A 3U7HB 3BJIC 1XEWY 4BFVA 2IYYA 2XSZD 4C0QC 4R2HA 4RFSA 5DI3B 3FTQA 2WV9A 5KSOA 4TQ9A 1LVGA 1XMJA 2VHCA 3EPJA 4QM7A 4PC1A 1NKTA 4JLAA 3ZS8A 621PA 5L3QA 4OBEA 4HLQB 5JS8A 1EWQA 1FX0B 3LQRA 4FCTA 3QBVA 1J8YF 4LJ8A 2W58A 1N5IA 1W0JD 4NONA 1K6MA 4Z54A 4MGKR 2HYDA 3T15A 3A1WA 1T3LA 2A5FA 3CF6R 1ZU5A 1OXVA 1HE8B 3EPHA 2N46A 4Q7MB 1VDZA 2F1JA 2FMXA 4RZXA 2CE2X 4M1WA 1Q22A 4LY6A 4QC2A 2WJYA 1YU9A 3QXCA 2IW3A 4M21A 2RGNC 4TN1A 3WHLA 3PUVA 1FQKA 3L0PA 1XEXB 2HCBA 8OHMA 5TXGA 4IDQA 1Z06A 3DOEA 2V1XA 4MGYR 3C4JA 4BPBA 1EESA 1KIMA 1T8TA 2PL3A 1XZQA 4IKEA 4IDOA 4DSUA 2VSFA 4PPFA 2NO7A 3CH4B 4Q01A 4Q7LA 1XNJA 1W1WA 2FOLA 2SHKA 4F4CA 2GJKA 5KPJA 2CLCX 3W6NA 1Y3AA 3DKPA 1SKQA 3I92A 1ZBDA 3FHCB 2ZUCA 3RS3A 4BZPA 3B60A 1CR4A 2W2VA 1E9BA 1KDRA 3H2YA 1G8PA 1DELA 2YOFA 1WDTA 2J0VA 3CX6A 4M1YA 4PSAA 1LV7A 4HYYA 4LHYA 1H8HD 1E1RA 3I72A 2ZJYA 4RD1A 4FMBB 2WICA 1LW7A 1OXTA 4ACBA 3TQCA 5AJWA 5JI3E 2Q9CA 2ZE6A 3ZVLA 2ZS9A 4XVQA 1OKKD 1NY6A 2RGEA 4DIDA 1XF9A 2JJ1D 2F55A 1AS3A 5IDVA 3TMKA 2RCNA 1QG4A 1AQUA 4KSCA 1KDOA 3CO5A 4N1AA 2XXAA 1F5NA 3LRPA 5CLQA 4JBXA 5J4VA 1Q3TA 1Z83A 4JL5A 2B8WA 4BUJA 1E96A 1HQCA 2IXFA 4QBGB 4GSYA 3EXAA 4Q4AB 5GJBA 1ZCAA 4WZ6A 1WXQA 1E9CA 5JECA 3Q8XB 2V6IA 4RJLA 2R6DA 4JT2A 4KSBA 3OEEA 5EXTA 2J7PA 2HUPA 3MGCA 4TMWA 5BYKA 4XWKA 3B1ZA 4URYR 3A1VA 2ZUBA 3L2OB 1GP2A 4TL9A 1NBMD 4TTRA 3SQXA 1QHIA 2ZIAA 5B30A 1KI9A 1Q1QA 1JJ7A 3AB3A 1Z0FA 1GKUB 1P9WA 4OHZA 1E4VA 4ESHA 4JLDA 3OAAA 4KV9A 3ETLA 2GILA 2OCPA 4HDQB 3SU8A 1AGPA 3EG5A 2DCUA 4ZDWA 1KO7A 1COWD 1FUUA 1KHTA 5TVKA 1UDXA 3K09C 4DDUA 4ZV4A 2E9SA 2ANBA 2FWRA 3IPYA 2ZRFA 3NDBB 1KNXA 1NVVR 4A92A 1G3RA 2XB2A 1RJ9A 1M34E 1EFTA 4FN5A 3WMFA 4JYBA 1E2IA 1W5SA 2OE2A 1TU3A 4QKQA 2BCGY 4QNRA 1YKSA 4C0AC 2YOGA 1OIVA 2NZJA 3VAAA 2WTUA 3WYAA 1ETUA 3JZMA 2A5YB 1LS6A 2BC9A 3PQCA 2QMEA 3K9HA 1E32A 4IXNA 5FOWA 5B58C 1XB2A 4PSVA 4M1MA 1U0JA 4F4JA 2NPFA 1R5BA 1W47A 3MJRA 5E4FA 3U7GA 1H8EA 4HLUC 3AF3A 2OAP1 2GKSA 1ZIOA 5E7JA 3TR0A 3R8FA 4EIWA 2ZM5A 1T4GA 1HT2E 2ERXA 2HF9A 2XXAB 4FW9A 4NMMA 1QHHB 3PITA 3QSYA 2C96A 3GEEA 1NVWQ 2GWHA 2ODWA 1T3HA 4G1UC 1X8JA 4UXIA 2R6GA 1JXOA 4DDTA 1IXSB 3MSXA 4R71A 1VPLA 1U2RA 4AWXA 2P5TB 3A8TA 3WYGA 4M9QA 1KK0A 4IXMA 3ZIAA 4DEYA 4HEJA 4OQLA 3SBDA 3GJ5A 3SE0A 4B6FA 3BGWA 1KDTA 3CB4A 3LH5A 3U4QB 2CCGA 1G17A 3UG7A 1DOAA 3I62A 2GBLC 2EYQA 2YOHA 3HU2A 4BQSA 3CRQA 2JJ8A 3BFVA 1NMXA 4CEJA 3OZXA 3CZQA 2C03A 4Q4AA 1Q57A 3FMPB 2OG2A 1KO1A 1RC8A 3QKTA 3QKRA 2RMKA 2QP3A 3THWB 1FTNA 1GNRA 1QF9A 4V0ME 4FXPA 5DIFA 4OL0A 2BMDA 4LI0A 1N6NA 1GL6A 4FMDB 3SHFA 4YDSA 4XD7A 1IY1A 4HUTA 2A78A 3CNOA 1U9IA 1M6NA 3B7GA 3OIWA 1JBKA 3K09A 4JVNA 4OHXA 1U0LA 3K70B 1QHSA 4DUGA 1P61B 1HA3A 1AQYA 1TQ6A 2XITA 1G5PA 1NSTA 4KXFB 4C9BA 1KO4A 4AK9A 2WSSD 1BS1A 5G3YA 4E03A 1QDEA 3SJCA 3KJIA 4AKGA 3R9IA 3QXSA 2QPAA 4L9WA 4C3ZA 4B43A 3Q72A 4D26A 3BB3A 1W44A 1NI3A 1DAFA 5AJVB 4Q9LA 5DH9A 2I4IA 1UBCA 1GITA 1JB1A 1HEIA 4JLJA 1E2HA 1JAHA 5EE0A 3T1OA 1PVOA 4H1UA 2O0KA 5JLJA 4PAOA 2QT1A 1YZNA 1YZTA 2F43A 1OXXK 4OI1A 2XNSA 5C1BA 1CR2A 3G82C 5FBQB 4II7A 2HXYA 3K53A 3UXMA 4R98A 2AK3A 1AK2A 1E3MA 3QIAA 1I4TD 2AK2A 2A5GA 4LDJA 4EJSC 4QM6A 4G01B 1VG0B 2GVDC 2Z6VA 2JA1A 3X1DA 4MKFA 2FGKA 2V6JA 2VPPA 3ZS9A 4Q4HB 1TF2A 4B3GA 4DZZA 3O47A 4PHGA 4Q1EA 1VG9B 3F3YA 3CBQA 1CBUA 1BH2A 4Q7JB 1X1RA 4U02A 5EUQB 1VHTA 4LPSA 4BZXA 4F4IA 2JLXA 4YDHB 2R6FA 2OO7A 3HPRA 4JLNA 2FFHA 4QHYA 4ACAA 2ZJZA 5KYKA 4JKYA 2YWGA 5J4HA 4I1VA 2IUTA 5EP1A 2QM7A 3GPLA 3K70D 3NBYC 1OF1A 1E2LA 2ZAOA 4GFDA 5JHGB 4I1SA 3PUZA 4TL6A 1HYQA 1NN0A 4M2LA 2CL6X 4PZZA 4EPVA 3S1AB 4Q21A 3B2EA 4QJ5A 1R5OA 3JZAA 1QHYA 4MDFA 2VBCA 1IQPA 2CDNA 2RB4A 2BBSA 2IT1A 3SYLA 5JEDA 2BWJA 4F38A 1UDWA 2ZEJA 5DHAA 4Q1DA 5BN4A 3ZVMA 3NEYA 4C7OA 2VH5R 2WJJA 2EFCB 4IOMA 2ZI4A 4LOAA 2H5EA 2G1JA 2QTFA 3LO5A 1UJ2A 2ZE7A 4TMVA 4IJMA 4D25A 1XTRA 3B85A 3BH6A 5HZKA 1XD8A 3T34A 3L0IB 3MD0A 1DG3A 2QSYA 5HCIA 3ZZUA 4LV5B 5KNBA 4G5OA 3BH7A 1NVXQ 1WRBA 4A8JC 1UEJA 2HJGA 1OB2A 2O5VA 1P72A 1IY2A 2RGNA 4Q9KA 3C7KA 4JSYA 2V7QD 3DEFA 3D8BA 2DFTA 3MJHA 3OEHA 1KNQA 1FNNA 2B7CA 3MUFA 3GLFE 2QAGC 3I5XA 3CKLA 1TUEA 2IYXA 1M7BA 4W5HA 4RFSB 4QBIA 1W0KA 1L7VC 5FH9A 4W5JA 1NNEA 4Y0AA 4MRPA 1FOEB 1TMKA 4BLOA 2JDID 1K5GA 2CNWA 2WM9B 2PEYA 4AYWA 2QGNA 1MO6A 4ITRC 3BOSA 1E9SA 4JL8A 3RWMB 1ZJ6A 2GRJA 2VL7A 3AVPA 4KU4A 3VKHA 1N3BA 4QGAA 4ARZA 1NKSA 2YZ2A 1GILA 4TLDA 1HUQA 5KNCA 4LHZA
chains in the Genus database with same CATH superfamily
4P34A 3X1KA 2CL7X 1XU4A 4ZQIA 1VP9A 3VR6D 1MAHA 4EYOA 5T4EA 1L4FA 4OFWA 3HACA 1DINA 1EFUA 1FJHA 4C0JA 4P5PA 3WYNA 3IQEA 2OA0A 3MJFA 5K3EA 4IDGA 3PR1A 5BSFA 1YRAA 4L4RA 3BULA 3UWPA 2QPLA 3GQBB 4L0CA 4GPAA 5BWOA 3RSOA 4ISBA 4ZVRA 2IDKA 3AJ8A 1E77A 5CBKA 1RSZA 4LZJA 1ILEA 3BJMA 5JNLA 1QH9A 3JQGB 4K05A 4FKMA 4P7GA 1Z8DA 3QY0A 4O4IF 4GOMD 4E5VA 3WGZA 2P77A 2XUHA 2NPIA 4IFIA 4HGYA 1IK6A 3NKLA 3GZJA 2XVYA 1YVEI 3JQ9A 3VOTA 1AXRA 1FFSA 2BMAA 2BFAA 2R8XA 2X7XA 2ZPAA 3FWPA 3D3WA 4LSZA 4O2RA 3GCWA 3HXPA 3NC4A 3O5AA 2C5GA 4YECA 4ZAVA 5CDFA 4XVCA 2XCSB 1YIAA 4E5UA 1X39A 4RVDA 3C4QA 2ZDQA 1HZJA 2GHTA 2JBWA 2PQMA 4IDFA 2ES4A 5EJAA 4BASA 1QRSA 3LPDA 2E37A 3IUNA 3LBHA 4OHPA 1YS6A 4PRYA 2FPGA 3O4IA 1BJTA 1DIOB 3DQZA 1F1BA 2VAVA 4FLEA 1WVMA 2WB4A 5FWDA 5BSGA 1CS0B 2GCOB 2XEXA 4GUDA 1TPYA 1Z0UA 2IK8A 1T4MA 3T6KA 4Q9AA 3AIKA 4MAMA 2YICA 1HDZA 3O2QB 4E6PA 2ZIUB 1ITZA 1CUSA 4MVXA 3VMMA 1DV1A 1XBTA 1EUCB 4N0PA 4ZWNA 1AKQA 4G56A 5BNIA 1VZ3A 4DLWA 1JYEA 3MN1A 3E7DA 2ZUFA 3RNLA 1I5OA 4NSNA 5DX1A 2BH2A 3QLTA 1M34A 1LPBB 1YS9A 521PA 1RWOA 4EW6A 1CYEA 2BFEA 5A04A 3FPGA 1NYTA 4XIJA 2XSZA 2XGSA 3AKCA 2VEDA 4J0QA 5G1NA 4ZYXA 4ENPA 1DO0A 1QV9A 3PDCA 1JHAA 5HS6A 2O3TA 5CVCA 2X0RA 5KYGA 1JQLB 1CZOA 5GV7A 1LK5A 4UAVA 4MITA 4XFJA 1L8AA 5TF0A 1HTTA 1TLTA 4QTYA 4WFJA 5KTKA 1WNFA 2AFVA 2GA9A 2AJTA 1K2WA 3VA7A 1KAOA 1MVNA 1XR3A 3CC8A 4HPXB 3MS4A 1R2QA 3GJ8A 3LAWA 1RVV1 4DPLA 1V5WA 3MGGA 1GZ5A 3W5CA 5TY0A 3DZBA 4WFKA 4G0XA 3VGJA 2AOTB 3O3NB 4DADA 5IG2A 5ICMA 2X1VA 5FLXA 4RK1A 2QGFA 5C8XA 2PHZA 3ADOA 1JS1X 1C3OB 2YIMA 3OT4A 3QMVA 2Q1XA 2GFHA 4CMEC 4G26A 3C7DB 4KH1A 4REQB 3P8ZA 3FOZA 1YQQA 1IYZA 1QM5A 1GUAA 4Q1VA 5JEEA 4RULA 2XA2A 1D6SA 4Y3UA 3R0VA 3VU9A 4PCLA 1SIWA 1OFTA 2Y1FA 2QLMA 4GLBA 3REQB 4B6SA 1KFCB 3I9OA 4HUJA 2VHZA 3BRSA 4KNWA 1H8HA 3F5DA 4JOBA 4MO9A 3U37A 1ISGA 5EIXA 5JAHA 3UPTA 2QD4A 2EP8A 5D7BA 3KVOA 1RS0A 1XCMA 4LX0A 1Q0QA 3WMWA 1Z07A 2HZ7A 3ZH9B 1FU8A 5E1DA 2Q6VA 3HKCB 4RHFA 4DV7B 1B8NA 1J9GA 4ZIRA 2OP0A 2DUMA 3DWFA 1D2AA 4WOKA 5K8UA 1CVRA 3PHLA 1B2RA 1J23A 1TKRA 1Q1NA 3G2NA 2K7FA 4RY0A 1WHTA 1MOZA 2ATXA 2IEBA 4GS5A 1AOXA 1ZNWA 1AH2A 1S2MA 3AEKB 3K8ZA 4J9UE 5H3HA 1E1MA 3OQBA 4MI6A 1HKHA 1C1DB 1GL3A 1OV4A 1RXIA 3GJQA 2INGX 1VFNA 1P75A 3DGEC 3WWDA 4J0CA 5DYNA 5BNFA 2FPOA 4G8BA 2C1EA 1MENA 4FCCA 3DZGA 1MCZA 4FVTA 2LE0A 3ZCRA 5HJEA 2WU8A 3DUWA 2H1HA 2Q3LA 1SQSA 3G0CA 4KK3A 2C7BA 1G2IA 1Q44A 1DAOA 3R7LA 1YTLA 4PGHA 5JZOA 5GIOE 4M1TA 4I1IA 2A92A 1LTQA 4MKGA 1BYUA 3F1LA 4OM7A 2PMDA 3FPJA 2IPNA 5BQ5A 2CLSA 3UUFA 1LBQA 1SVUA 2D8MA 1WTCA 1UMCA 3Q12A 1TCCA 1ZW1A 1I5EA 2FFAA 3PD1A 4E32A 5LFAA 3FUUA 4RV4A 1UDRA 3O1JC 3I5YA 2QJWA 2WDPA 1L5QA 5D85A 4JOSA 1WHSB 2DECA 4Q4HA 1TM7E 5COAA 5LUBA 3M3DA 3UK6A 3UWSA 1J09A 1XK6A 2MR6A 2HV8A 1QFZA 5DRYA 2JW5A 3NBAA 2GVZC 5EMMA 5EMLA 4I4CA 1KA9H 1QAMA 4J7AA 4L50A 5LKAA 2A1TS 2FE1A 4TLLB 2WYVA 3JW8A 4M1QA 3FPSA 2QPOA 5C1DA 4XOUA 2AG8A 2WU4A 1JJVA 3OZDA 3RSZA 4LGCA 4WKGA 4CWAA 3FSGA 2F62A 4Z8XA 3VU8A 1RWWA 4YGYA 1F8XA 1E94E 2X1LA 4KPFC 1JH8A 2YS6A 3DXYA 1D03A 1EB8A 3DYIA 3FOWA 3G6WA 1PJ2A 3M6XA 3QU7A 3L6OO 4MV5A 4TZKA 4L6CA 4CZ2A 1C1YA 1L1QA 2XB4A 4YALA 2N1MA 1N7IA 1S2IA 4I9UA 4Z9FA 1A9ZA 2VK2A 4BVJA 5DYIA 3BKWA 5IVIA 4Z1MD 4E11A 3A1NA 2VXBA 1ZK0A 3WB2A 3LVRE 3RVSA 1XDGA 3I34X 1KSGA 3OJFA 4LHEA 2GYYA 3D2BA 4ZV9A 3RTGA 2P6RA 2PSFA 4Q00A 2O05A 1AKTA 4OI4A 1FS6A 3PNYA 2IE0A 1BXGB 2UYYA 4F96A 1FIUA 2DERA 1BMDA 5HOQA 1VE5A 2HQSA 3ZZMA 1KEWA 4YR7A 4J6FA 5JRDS 1JIXA 1S0UA 1VXOA 3RM3A 2V74B 2LZ0A 4UFPA 1D04A 4YCMA 4RTPA 3R23A 4EG0A 2FG5A 2Z0MA 3QVMA 1RI1A 4K9DA 1FTWA 4AJEA 2QW1A 3HJRA 3VGPA 2XOEA 4DRZA 2QUIA 4HNVA 1MU0A 4AY2A 3HJAA 5DNVA 3WKEA 2ECFA 3QVKA 1L3CA 3L8ZA 2Q5LA 2XVAA 3B1JA 4NAUA 4YXWA 4YXWD 5KYUA 1RMQA 1BD3A 2IF0A 3EAQA 1ZR4A 2H2FA 1BD4A 2JIBA 3ZWCA 5CYFA 2HHAA 4RESA 2ZXEA 1LTKA 4IJWA 4D9GA 3KQHA 2XUOA 4FYWA 3X1JA 3ZCXA 1M6WA 5LP6A 1QE3A 2LKDA 1PK8A 1S3GA 4MV8A 3RT1A 2JDIA 2DHRA 2O1EA 3MFQA 2GTIA 2WA2A 3F96A 3O2NA 2WHPA 2ZYTX 1X7ZB 5G0SA 3TQSA 4PRLA 5BV0A 4RTNA 4ZJZA 3O8QB 3SYNA 2HIHA 2IXEA 3QMMA 1PT9A 3HMQA 1IHOA 1WU8A 4ZMSA 5FL7D 3H5TA 1IN1A 1FTYA 1M73E 2YUIA 3RSLA 3S1SA 4N8DA 2H1CA 4DHWA 2GESA 1A4RA 2F1HA 3ESDA 3FJYA 3TJMA 1TCVA 1FS4A 1WP9A 2W6JA 3C6XA 1JSCA 2QN1A 4N4AA 3T7IA 2QRZA 1ZMRA 2YV5A 4HDRB 3F73A 1Z2CA 1QH8A 4H0CA 2WW8A 1L5ZA 4EZEA 1DEAA 3DM9B 3KEGA 1BFKA 3B3FA 4U7TB 3IBYA 1TA9A 4QVKA 5TQ2B 3CONA 3BN3A 3MINB 2XH8A 2W6ZA 3K73O 2C07A 5DV9A 3G9UA 4BFYA 3K6SA 3O7WA 3A1EA 3K94A 3THXA 2GYUA 4N5MA 2P3SA 3YASA 2GXAA 1ONBA 1Z8HA 1ZJ5A 3DAHA 3Q3GE 3EZ7A 2EWMA 3HXKA 4QXPA 5DOZA 121PA 1JJFA 1X9GA 2GYVA 3MBIA 3OMLA 3B1KA 1G5RA 4J90A 3OPQA 4G86A 2DPYA 3DONA 1RPAA 2OXRA 3W5DA 4OBXA 4R7ZA 4JYAB 1NIPA 2DTXA 4J1TA 1A5TA 5A9SB 3INRA 3MAGA 3O83A 5GWXA 3N70A 5ULLA 3CLUD 4HZUA 3PWSA 4X71A 2MSEB 3OPYI 1YBMA 2G9QA 4IO0A 3U3KA 3K6SB 2B9EA 2X1HA 3MERA 3DEKA 4JVMA 3LK7A 1FTGA 4B4WA 2OCKA 4L5JA 1GGHA 1U3TA 1RXEA 1ZVQA 2QY9A 4PLYA 1K63A 4WY5A 4A03A 3FYDA 2IRWA 3FYHA 3DPUA 3NG1A 5P8WA 3TTVA 4D8WA 3GLHE 4I08A 2QLTA 4J94A 4HNAB 1DVRA 3ZW8A 2A9PA 4E5PA 4EEXA 3HJHA 3KQVA 5REQB 4KWTA 1JA9A 4QO8A 3FZQA 3FCYA 4Q1BA 3AF2A 1XIVA 4LTDA 4WLUA 4TXMA 5EQJB 1PJ3A 1ZN7A 3WAKA 2JVIA 3THSA 5CB4F 1H2RS 4O1HA 4V02A 3HI4A 3ZC3A 5KS2A 3IAHA 2E5WA 1TAHA 2BM8A 2WJHA 3LLCA 2O8VA 2DWPA 4NDAA 1YV9A 2NTNA 4IGIA 2WF6A 2H0AA 3PXEA 4TXNA 1HO3A 5CDFE 2A0UA 5FA5A 4AWBA 3NAZA 3S2FA 3CIFA 5TF4A 1DBIA 1BN7A 3UJCA 3MBKA 2HJ9A 3Q85A 3HVRA 1Z2AA 3AKDA 1NFRA 1P0MA 5CW1A 5AHXA 5IJ0A 2AUMA 3RTEA 2YMLA 1ODTC 4J03A 1S3IA 2Y1OA 3ACBA 4TWBA 4DCUA 2VHEA 1K7XB 3ES9A 1GUFA 2ZT5A 2AX3A 3FRJA 4KQJA 5ARBA 5JZBA 4QGHA 4DS3A 1O94C 5ALMA 1CUFA 1NVUQ 2F2TA 3NVDA 4RDXA 2ZCJA 4KH0A 4Y6PA 2GK4A 3F2VA 3STVA 1XDWA 5JDIC 5KC8A 3EFOB 4RPCA 4S1OA 1T34A 2YZ7A 4ZYWA 1E2DA 3L3BA 1JR6A 2Q8QA 3HWSA 1I9GA 1EVZA 3G68A 5IVDA 1S6YA 3HJBA 5K3DA 4AZVA 1PX2A 4G4JA 3GLGE 1F0KA 1NF8A 3KYDA 1NI5A 2GAFA 3T4XA 3ZCQA 5KU1A 5HUQA 1VXRA 2X40A 1Y5IA 1YZYA 5LZ5A 3AYZB 2LIVA 2Z8XA 4GBMA 1Q0ZA 1KE1A 3V33A 1IOVA 4YNBA 3AHHA 2A3RA 2H8GA 1YR3A 1B0UA 4OOEA 5ALLA 3H2ZA 3CJTA 1TUGA 3FCSB 1JDPA 4MUXA 2Z09A 2NZUG 5F7ZA 4ENRA 5CXQA 3EIEA 2ZRCA 1KP3A 3L7LA 3GXOA 3VRHA 1QDUA 1NF9A 2RK4A 4ADSG 3QVGA 2IITA 3ESBA 2DJ5A 4LHSA 2IYQA 5JSFA 1J1UA 3CLTD 4KO3S 1SM4A 4IAOA 3G89A 1ZGAA 1A88A 1MABA 4WOPA 5BV7A 1CUJA 3B6JA 3GT4A 3I4FA 4WEQA 2DCMA 2E4YA 1A8HA 1UMBA 3EIUA 3N1UA 1U6IA 4TWRA 4BQOA 5EJ9A 3TNYA 1OR8A 3IIIA 4EI2A 5J2UA 2H2HA 5ER9A 2F3QA 4KCGA 1U65A 3JQBC 3A0RB 2LCQA 5CDHA 5KKCA 1CQJA 1X7HA 2H4XA 2PVPA 4KR9A 1QCCA 3PIIA 3EH1A 2OYRA 4E15A 5IDWA 1OLXB 4F3NA 1ZONA 2VYQA 3DOHA 3JWJA 2MJLA 3DBVO 1V7QA 5NLLA 1UPAA 2NV6A 3A26A 3AHGA 4DV6B 3PT9A 4G23A 3QRWA 3K05A 5JWHA 3WY9A 3G5MA 1YJ8A 1KK3A 1QDLB 2BRUC 2AZ4A 2J3IA 2PV0A 3QX7A 4KDEA 4C76A 2W22A 4IWNA 3E58A 4LJSA 5CCBA 5JXGA 3IB6A 4KK4A 4MK4A 3GYBA 3LHKA 1U02A 1HY3A 1EB9A 3ABZA 3CZRA 3TRKA 4Y2JA 5HG0A 1C3XA 2ZRPA 2ZXFA 4EGFA 4EW1A 4Z7QB 2J4FA 1PVDA 3RFTA 4F92B 5DSZA 1BZYA 4MUBA 2XZDA 3GCXA 4YQYA 4P82A 5LVAA 1GOTA 2YDYA 1PQUA 1PR6A 2Q3EA 1N1EA 1OWOA 2CL0X 4CV2A 4KPEC 3ETEA 4P2BA 1W48A 3K9LA 3U16A 4HFMA 2X5NA 3M82A 5J4YA 3GLUA 2ZK7A 2QN3A 1E2PA 3ETJA 2I7VA 3PGKA 5FJIA 4BBZA 3M81A 3GOQA 1FJGB 3HDQA 3DR3A 1WBJB 4HC4A 4IVQA 1ZUNB 5HMMA 1NBMA 2FETA 1NFFA 1NVFA 3DTTA 1JGTA 1I36A 2JGJA 2WJ6A 5CCEA 3A3OA 3RFVA 6PFKA 1LNSA 1H0KA 1NXOA 3OE5A 2PX0A 4KXWA 3U9LA 1I2AA 1QH1A 3M89A 4D9BA 1NTRA 4DVJA 1ZVMA 4RAQA 2IXAA 1H0HA 3TS1A 1N7GA 1W8IA 4I1UA 4BQPA 3O9MA 2B8EA 2ZJ6A 3IUEA 3O9VA 3S3TA 4PM4A 1CJMA 1FP2A 2A33A 3H7AA 5DYTA 4IHKA 4UUBA 5FTJA 4YA6A 4WXRA 5KOIA 2PNJA 1YJ5A 1SU7A 3JQRA 5DVZA 4Q7QA 3N28A 3EUEA 4IGFA 4RTQA 1L5HB 4HWGA 5JMPA 1ST3A 3AFIA 3FGPA 1DSSG 2X19A 3RQSA 3ANMA 2PJRA 1V1RB 1N8TA 2BL4A 5K45A 1CE8B 4X0EA 4MR7B 3CTMA 3R0XA 4ILKA 2GNPA 3V80A 5TDHA 4NECA 5CW2A 1Q74A 4YLGA 5JY6A 4D0GA 3G2OA 3TPFA 3IP5A 4BQIA 1A8SA 2WB2A 3GN2A 3BIWA 3GA0A 4G41A 2ZJBA 3I37X 2VK8A 4S1WA 5DT2A 1X7GA 1BS2A 3G59A 2NV2B 3MB8A 4TV8F 3PPYA 2ZBUA 1OZAA 1I4DD 3AESB 3QG1A 3HUDA 4Y2YA 5JATA 2BE9A 3R09A 4R01A 1T9GR 4C01A 1LBHA 3INYA 3L02A 1NZJA 1SOWA 1VKRA 3EA0A 3EZYA 3L7NA 5F3RA 5LQMA 2XMQA 4GSLA 3UJ8A 3HDTA 3L0DA 4M0CA 4V2IA 2IYPA 4UEQA 4B5KA 4J0JA 2WMOB 1MUUA 3ZQ6A 1HG1A 3QHQA 4JS0A 5BN1A 3R6GA 3SDZA 2BHRA 3STTA 1H2YA 2LGJA 2R1UA 3BE4A 3JVIA 4W9NC 4X8MA 1FLVA 1CKEA 3MELA 3WGVA 2GLTA 3IB3A 4LJKA 4BNIA 4BMVA 2BR3A 1VKOA 4JENA 4ZT2A 3NBFA 3BGVA 5FUMA 1ZC3A 1PQWA 4WNYA 2JIZA 1E2NA 2J32A 4XVHA 1TIPA 4L75A 3UC5A 3V9AA 2GN0A 2WNHA 4F12A 2FB9A 4ZDJA 4QARA 2HA5A 2F8SA 1UQRA 4OQEA 4PY2A 4KGVA 3V8QA 4QOFA 1YCFA 5ALTA 1D2EA 4DKJA 2P2CA 1SK8A 4F72A 3A9VA 4EB6A 1BW9B 1MGOA 3MC1A 1XA3A 3HU3A 1JG2A 1N6KA 3FIJA 4MVJI 1QVAA 3WLAA 4BEJA 5CFQA 1FNCA 1YQ9A 3G0GA 4XSHA 1XI2A 2PFKA 2V0CA 5CLGA 4B85A 3KFLA 5BN5A 5L4NA 3C6BA 3DTVB 3IPLA 3G9TA 3JQGA 2NO4A 3MNFA 4HAYA 3OCUA 4HOYA 4MLCA 5G4KA 3X0DA 4JBLA 4YHHB 1J5PA 3DJYA 3M7IA 3GVCA 1T6YA 2KE5A 2ZLBA 2HD4A 2CN1A 4EY3A 2H5IA 2K5UA 3K8OE 821PA 2R47A 3MRTA 1JSZA 4AVYA 4RGQA 4YO8A 3TI7A 3DXZA 1Z0ZA 4DUZB 3WXBA 3LYLA 4I5FA 1GTVA 2CFCA 3F2IA 5IXYA 3VNUA 1ZD8A 1JG3A 1V39A 2E4WA 1L7OA 2O23A 3IEXA 4RADA 4B6QA 1AKNA 4ZV7A 2AF3C 4YRFA 3KQTA 3P71T 5YASA 4KZPA 5JTTA 1ZD4A 1VJCA 4AJJA 1SKMA 3MUOA 1S8NA 2PXXA 3EMBA 3IMKA 4KVZA 1JYSA 4RAOA 4QXMA 4D7AA 3IJRA 1GHTA 4FFLA 4OHCA 2IYAA 5JCOA 4ETIA 2CV2A 3NPMA 4GM4A 3PHBE 4XCXA 4RD4A 5F76A 2EHDA 3COPA 3I32A 1LI7A 4Q66C 4ZANA 5FOUA 3RB8A 2P2SA 5H02A 1E3EA 3TQFA 3HWX1 4UTZA 2QVGA 3EWIA 3OLCX 4BFXA 2Z58A 1Y9DA 3ICQB 5A5EA 1WXHA 4TM7A 4ZAZA 4BBJA 1GCIA 4WLOA 2GETA 2VATA 4R1PA 5L3ZA 1YBFA 4BVEA 2BUAA 3WGJA 2G6BA 1M6EX 2VF8A 2ZSEA 1D07A 1YD7A 2PA3A 4FZ5A 4B7CA 3T3IA 1G3IA 4GC9A 4KXLA 4MWCA 5BV2P 1E3TA 3PQ8A 3N86A 5DK6A 1KE2A 3IPXA 4G3XA 4YMVA 4MLZA 2H59A 2A58A 1GSHA 3KQSA 3P0HA 4PTLA 2WKQA 4R69A 3VFDA 2ZM6B 3O21A 1T13A 1OFUX 3QPAA 4Q15A 3AR4A 4YVFA 3LNCA 4GWLA 2OAQ1 2C88A 3G8YA 3A6KA 2H0RA 2OAEA 3SS9X 4E31A 4HGRA 4YMTA 3CT6A 1Z88A 4NJEA 1MNQA 1OGYA 1ULUA 2XNJA 4FGLA 4CLDA 1SOAA 3H65A 4NQRA 2VXCA 2WMDA 4QRHA 3CE6A 3LGSA 2J0UA 5LR6A 1KAHA 2FAXA 3AM5A 4RSGA 4X3OA 4CMGA 1WO8A 3EFOA 2Q4RA 1C3OA 2QYSA 3NHWA 2PTGA 2ZVQX 4HB4A 4MQEA 1HFJA 3VZDA 2VDUE 1K6XA 2L69A 3AY6A 4NJEB 1ZK3A 1FLAA 1LI5A 1SUBA 1B1AA 3WHPA 1YBHA 2CXUA 1Y1TA 4D8UA 4NDNE 3ONDA 3VR2D 4GQIA 3IKVA 2DC1A 2GS9A 4Z3OA 4RHEA 2FZ5A 3ZDFA 1HNXB 1KH3A 1N4DA 2O8DA 2EFEB 4P81A 1BTOA 2XX3A 1SBQA 4A0HA 5T41A 2D5AA 3AVYA 2X3YA 1CHDA 1VMEA 1VJ0A 5AVTA 4P31A 1XHLA 2YASA 1FRFS 1KDPA 3I04A 1OLOA 3DMTC 4YRNA 3R4VA 1RXWA 3IKMB 3V8BA 4LZPA 1JE1A 1OXSC 3FW1A 3R5TA 5TJHA 3V1UA 1XMOB 4LK3A 2ZJ5A 4XEHA 3F6SA 3H13A 4N41A 1IH8A 2OCYC 4LGVA 1ZUD1 1YA4A 3A14A 4BB6A 5FBHA 1J0BA 1FFXB 2XUJA 4CCSA 3FI0A 2QZZA 4P22A 5AUPB 5L45A 3FYUC 3C3KA 5A62A 4G5SA 4CM4A 1YR2A 1V6SA 5BYJA 1T3TA 2HMTA 3ROTA 4II2A 3SZUA 2IUEA 3RCBA 4D9MA 4GLOA 1OC2A 4I50B 2AEMA 2C7VA 4NZZA 3TRDA 2I6XA 3FVWA 4N7JA 3NC0C 2JFZA 5CLIA 1YFZA 1IG0A 3H99A 2PMWB 4BX0A 5IJXA 1Y6GA 3ZGZA 2BMWA 2OV8A 4WWHA 4LYJA 3AF6A 1NNLA 3F5FA 5DRTA 5EIHA 5CPFA 4I8IA 3X43A 1XDUA 2JFGA 2D1QA 5IU6A 2YMPA 1KBZA 5K5EA 3IV9A 2IP4A 1RW4A 3ZNPA 1Z6GA 2I2AA 2FDRA 2Q99A 1J8DA 1ZAKA 2CF6A 1TQ4A 2NN3C 3H8JA 4GX1A 4RK7A 4IDNA 5GOTA 4M7WA 4A6XA 3NYWA 1XO1A 1JFLA 2FQYA 1C0PA 2YFQA 4W7SA 2XCLA 2PX8A 1DIRA 2G71A 2NU6A 5THQA 1JZQA 2D5BA 2QP9X 1GAQA 3BXOA 4JQCA 5AJTA 2XKJE 2O20A 2CXTA 3KX2A 4LQLA 1DIBA 5H68A 5KTNA 4EELA 2GPJA 2XRYA 1ZL0A 4V3CA 5MF6A 3AF1A 3SJZA 1CK4A 1F20A 1ECBA 2HRRA 4YRBA 2H5JA 1MH9A 2CFRA 2PLWA 3L5KA 1G20A 1V2GA 2O1XA 3E2PA 1GQRA 1SXJE 2QROA 2Q3HA 3C98A 2PPVA 2AEFA 2A4KA 2WE7A 2WHRA 5G02A 3K30A 4FWBA 4QG3A 2QR5A 1EIWA 4RDCA 1EDEA 4KN9S 4BLSA 2OHFA 5F3WB 421PA 3GRAA 4ENTA 4B34A 2FZEA 1QF6A 3RSHA 5KNCH 3NO4A 1QAOA 4KDRA 4JJ8A 3HJCA 3IBTA 4L9RA 3OF2A 4BVAA 4C6TA 1BXGA 1KVQA 3RR2A 2QPTA 2A9KA 2VS1A 1Y6ZA 2CNOA 4U6SA 3UB2A 3WIVA 4WBNA 5GVRA 3RDPA 2CFTA 2KHZA 2A9QA 5CB4A 5JCZA 1GPMA 4MZDA 5JV5A 5J2TB 2EW2A 4HWPA 3NHZA 4C7KA 1AIPA 1AKYA 2O5RA 1OPRA 3PLRA 1H2AS 2CZGA 1LQUA 1VG1A 2CVHA 3D0QA 3H3FA 3OQIB 4O2AA 4RVGA 2IH4A 2QE7D 2Z08A 4O4JA 3KTDA 1VI2A 3S28A 3FUVA 5FFNA 4B3BA 4E2YA 2HSEA 2W70A 1GQSA 3W2IA 1GQFA 5KYUB 4C2UA 5F9HA 1YZFA 4ND2A 3D4LA 2IHNA 2WSSA 3HJGA 5FUVA 2LRHA 1NURA 3T94A 1IJFA 4IDEA 5DCYA 2C5SA 1YRHA 8LDHA 1ECJA 2NSDA 2AR7A 2WUFA 2ZYAA 4PV7A 2FJ0A 2JIOA 1YJXA 1VLMA 4HGQA 1AGRA 2V0NA 2FQWA 3UUEA 2VP3A 5CB4B 1XZJA 3DEAA 3G5AA 3TINA 5JAPA 1MOSA 1U3UA 4PQYA 3LPLA 4E7PA 2JH9A 4QDUA 3CH5A 4ZVVA 4IUDS 1T9CA 3INTA 3QJYA 4KEAA 4FKBA 2ZG6A 3X1ZA 1TZCA 2WPDD 1HQDA 4K28A 4LZOA 4AJLA 3L1JA 4AX8A 3EGVA 4QUIA 4LJYA 3DW3X 5AUQA 4ILEA 4MUEA 5CM8B 4YRPA 2R0QC 2FSHA 4WL0A 3PXAA 4XM0A 4FJ2A 1PV2A 2X7HA 3MPOA 4H4DA 4UTOA 4B87A 4I6JA 3LC0A 1MDFA 1EP3B 4R1QA 3HV2A 4LBVA 1YHYA 2O19A 3LQ2A 3AFNA 1W34A 3A6LA 2P11A 1OIXA 3DL2A 3Q3HA 4JKIA 4N40A 3VYSB 1QK4A 4F1WA 3BXHA 4PNPA 2BDUA 1XEFA 1S01A 2X8JB 4JUCA 4RQBA 4BNKA 3THWA 3QU5A 2XTAA 5DB4A 5J4KA 2XT9A 1TB4A 2JGIA 4B4VA 4JZKA 4EJFA 1YFKA 4HPWA 5LU9A 2F1IA 4D3DA 4B8ZA 2FI1A 3TBHA 1A98A 2PYZA 1OGIA 5F51A 4C4XA 2NZXA 1KZHA 4R41A 3B9QA 1P0CA 3HFSA 1L8QA 3B3GA 1FFDA 1UBRS 4K6MA 3S2YA 4QUAA 5DKFA 5F2KA 1HDXA 2RKOA 3PNPA 2CT8A 4JB8A 1IWOA 3EGEA 1PTJC 1ND6A 2GT1A 1T8SA 4IV8A 4Q48A 4XQ0A 4PSUA 5LXTB 2PUCA 2JASA 1N9GB 1TA4A 4OJNA 2O0MA 3TVTA 5L6MB 4NPAA 4JD5A 3WGHA 4EGSA 4EPTA 4U4AA 1IUKA 1LY1A 1RDFA 2Q7OE 2CDBA 1CPYA 5DYYA 1FLDA 1BCSA 3U5TA 1NDQA 4JJGA 1P29A 1IY0A 1X2EA 1GGVA 2D06A 3AEZA 3OEED 5JMOA 1LC3A 3BUSA 5KNBD 4AKHA 1G16A 4OFZA 5J9FA 2AE1A 1TW3A 4BNWA 4II3A 2H54A 4CUJA 4P86A 4ER7A 2OOSA 2F3TA 2QS9A 3NYIA 1V2HE 2AFHA 1SQ5A 4P8RA 5GOZA 1X0XA 1Y3HA 3NVAA 5IX8A 1J9ZA 3UV3A 2R84A 2EZ4A 3A1FA 5HF8A 5U1PA 1PU2A 3GLFA 3LU1A 1E7WA 1V48A 1QQTA 4OJYA 2CLMB 2E21A 2Q5JA 3L4JA 2B2NA 5THKA 1Y98A 3NC1C 4CR6A 4AKEA 1NVAA 1BDBA 1ZC4A 2CSUA 2V7WA 3ZI0A 2OLJA 5CG1A 1R5NA 1DCMA 1YQEA 5JXJA 1E58A 1EK5A 1GGFA 1FP4B 2NXWA 1UWVA 3E22B 4PIPA 5EWMB 4EVRA 5F98A 1M2KA 3HLKA 5J43A 1MEOA 4UUQA 2YVUA 4C0LA 4F6CA 5K0SA 1J99A 1T35A 2Q6TA 2R8RA 1FSSA 3M4JA 2CBZA 5LOVA 1CLEA 3PJRA 5FPQA 4Q4JB 2GBFA 1UUFA 5B55A 2L42A 3ZWKA 3K0EA 1KIFA 1QCYA 3H1PA 3I9NA 4OQMA 3KQLA 5D3ZA 1ORRA 1P4AA 4J76A 3UNXA 1DE0A 2P79A 4BC1A 3CUSA 1E4EA 4Y6RA 2V3CC 2AN5A 3GRKA 5ENZA 5IXJA 3IAM6 4Z3KA 3PL1A 6AT1A 4IPTA 4E22A 1S4MA 1E2EA 2JZCA 2W11A 4PC2A 1D7AA 1FA9A 1VMIA 2H7YA 4Y1EA 1FNDA 1GPAA 4X7BA 1XCGB 1SUWA 1LDGA 3OPNA 4MVJE 3LC2O 3GG9A 3ZU3A 4UDYX 2GCGA 4PVCA 4P80A 4P4UA 1FP7A 1YF3A 3N58A 4JT8A 4EUFA 2O6LA 3HZOA 2G4LA 1RKVA 2CL5A 1BWRA 2GJSA 3KOZA 3D81A 5EEGA 2A14A 1N2BA 1SXJC 4MZXA 1OT3A 2O2XA 3AV3A 4GW3A 5JJIA 3B78A 1PFWA 3ROQA 2EFHB 3SBXA 4BNXA 2VHXA 3BRQA 3R0ZA 1OX4A 2DQSA 3MK31 4FIDA 1PGQA 4IVPA 5J2UF 4CCAA 2JGNA 2Z5GA 3I64A 1JPNA 2FOXA 4L6IA 3I05A 3EWNA 4ZVNA 1MG0A 5HYVA 4Q3DA 1GYRA 4IZHA 1ADFA 4J91A 4N03A 3U60B 2F4VB 5DM0A 5JZVA 3DSRA 1GG9A 2XAAA 3IOEA 4F2PA 3IBFA 2ANCA 1JFRA 1P33A 1F51E 3D7KA 1SU4A 1IPHA 5EHGA 4DG8A 4V1CI 1TZ2A 1Z3IX 1J8QA 2GO1A 2WJGA 4IUCS 4NCJA 2QRVA 4AF8A 4QBKA 4F4HA 1VIMA 1EJ2A 2FWNA 1P5ZB 4YCDA 1TTHA 5AJUA 2Z2KA 1V4BA 1OROA 2A9VA 4U3JA 1U3DA 1US8A 5M34A 2FUNB 3TWOA 4U2EA 1RU3A 3L8HA 1MAWA 3H1FA 3JQ6A 2DHDA 2H2AA 2Z4SA 4C3VA 1SBNE 3RYHB 4DCGA 1A8UA 5E6UB 3C1OA 3KDPA 1I3LA 2FUKA 3V4VB 2WJZB 1VHQA 3HNRA 3ZE8A 4POAA 2IS1A 5EMKA 1DAKA 4GI7A 5ITWA 3ONEA 2IHUA 3F46A 4P4SA 2VP9A 4MEJA 5ALKA 3NTLA 2XGOA 3KZKA 4G24A 1XYYA 3L77A 1OA1A 4R81A 2Q8PA 4BRWA 4PTYA 2YN0A 3CLRD 2XCQA 4BMOB 2CHVA 2BGRA 3BK1A 4OGKA 3MMXA 4LYFA 2NADA 4RPGA 5KZMB 2RHDA 3NJ8A 3TTYA 1QQ5A 1Z0IA 3B52X 4HQ0A 1NLYA 5ANRB 5KQRA 1H6CA 4JUFA 5MN5A 2CXXA 2QUJA 4Q1AA 5GONA 3VPFA 1J7KA 2H3HA 1PGOA 4HB3A 5EJGA 2JB9A 4H1HA 4EK9A 5HSGA 4D0SA 3KOOA 2E85A 1L7DA 1KH2A 2IPXA 3D6AA 3HWRA 3K72B 3ZIDA 2FR1A 3LT2A 2RHMA 2IHKA 1PQ4A 4MWZA 1WUJS 3RWBA 5CU7A 2XYGA 3F7TA 3HXQA 4ZEMA 3S8MA 1EM8B 2ICAA 1FXWF 5CH5A 2FH5B 2OUKA 5CITA 4JX8A 3TQHA 5HPYB 3SY8A 5ALFA 1PWHA 2DXIA 2O7RA 4Y9SA 4BVFA 3O90A 4BNLA 4Z4HA 4AG6A 4JJKA 3FHLA 3RANA 1M8PA 3SS7X 3NIBA 1BX3A 1NTOA 4LDZA 3LUJA 4KP7A 3RVMA 2A67A 1W59A 1E0JA 2N3ZA 4JJ7A 2RHTA 1I0IA 1GPLA 3HNPA 5SY9A 4D6YA 5ADWA 1JDNA 4RF4A 3L7IA 4TT8A 3QPWA 5CVDA 3CY6A 3ADKA 4RJKA 5J1TB 3VTZA 1JLKA 1X1CA 2J9FA 3SC6A 4C0BA 1ZR2A 3FRIA 2OYCA 3CZMA 5K6TA 4YREA 4QOSA 3TRFA 3LT4A 4KI7A 4GI2A 2QU8A 3G1TA 4XLLA 2GBCA 4LBZA 3UJ6A 3T99A 5I8ZA 1ZXXA 1EXWA 3LFHA 2XJ4A 4KLNA 1RI2A 4D5EA 2AKAB 4BE4A 5JRZA 3U7FB 5AO9A 3QEOA 1NU8A 1LWOA 2FN3A 3KFXA 1PS9A 3ZN2A 3PA8A 1CUGA 2PMCA 1P2FA 2AMYA 2XMSA 3QUSA 1T2EA 3ZZTA 4EMSA 1YGPA 2OESA 3C3XA 3ZY3A 3UY4A 3L1UA 2OQRA 4RZ2A 2ZYVX 1XVVA 3L1KA 2W8BB 2RC5A 2H51A 5K3SA 3CW2A 3IQHX 2WWHA 2N47A 2CXQA 1BA2A 4F2HA 5FPSA 2Q7XA 5ICSA 3FPFA 3BWCA 1D2MA 1RAEA 1F2UB 1GZSA 4EKEA 3TUIC 10MHA 3A7DA 3LXUX 4D98A 3KE9A 2X8BA 3P20A 5H80A 3C14C 1KYIA 3ZLJA 4R5HA 3RS2A 5FRDA 4AY3A 3GYGA 2VJYA 4M89A 2WHYA 4GI3A 4KN5A 2SICE 4L76A 1UAAA 3AVQA 3GHYA 3H8VA 2FRVA 3KEQA 2O8EB 2L2QA 4E70A 4UEWA 3DBHA 2VH1A 4NV1A 1LNQA 4TRRA 3UAWA 3RYCB 2V9PA 2C97A 2ACWA 3KVRA 1KK1A 1BE8A 3KUUA 2IY8A 5BVGA 3EXHB 1F06A 2G9VA 4GP7A 4IGAA 2JJ1A 4KO8A 2B98A 2KBEA 4XDZA 2JLWA 3P0FA 1E3DA 4OGGA 2XCRB 4NWIA 4M37A 2E87A 4HQLA 4LKRA 1UFRA 4EGCB 1PZFA 2TMKA 3N75A 1QS0A 3CVVA 4PIVA 1KYTA 4P98A 4AYXA 2V0GA 3N0RA 5K8JB 1XD9A 4US0R 4JSTA 4RPHA 4YJ2B 2VSYA 5ALRA 2IU3A 4Z1OA 1RLMA 4AROA 4HG2A 4RVCA 2Y0PA 3BSWA 4XYMA 4A73A 2WVHA 4NMLA 3EXFA 1EMDA 2PRIA 1E4EB 4IXWA 4IV5A 2OD9A 4R6WA 1TK9A 3T4UA 3KSAC 3EPLA 2J7PD 4CMJA 3NANA 3A9RA 2V7VA 4DMUB 4UU0A 4ER6A 4BRZA 1Q0TA 1N0VC 4FDLA 5C18A 2VYND 2PD6A 1DDOA 1O77A 4CLXA 1SEPA 1L7QA 4DQVA 5J3JA 1YDHA 4L08A 5EINA 5KBYA 4KYTA 3V42A 4BO5A 3SDSA 1UWCA 1LGYA 3NZEA 3VO8A 4C4TA 2J6HA 1DMRA 2JAHA 1IVNA 3BBPA 4MYUA 4DM7A 3KT8A 3JQFC 5DNCA 5HUJA 4R1TA 1L6IA 2V8BA 4U9UA