1S4MA

Crystal structure of flavin binding to fad synthetase from thermotoga maritina
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
288
structure length
277
Chain Sequence
MVVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVHKFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRPTDARNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKFDSIEELKAAIDQDVKSARNMIDDIINSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords riboflavin kinase/FMN adenylyltransferase
publication title Crystal structure of flavin binding to FAD synthetase of Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 82
structure length 277
sequence length 288
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1s4mA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1s4mA01
4G5YA 3I05A 2CYCA 5IJXA 3N2YA 1Q15A 3HFJA 3K32A 2DXIA 3SP1A 2D5BA 4ZT4A 4J75A 1QRTA 1JEEA 1QNFA 2A4MA 3BL5A 3ZUGA 4CDNA 2VBVA 1N2HA 3FDXA 1O95D 3ND5A 4GRIA 2VBSA 2CUZA 2Z08A 4EF6A 1N2OA 2A1TR 2J4DA 4DDMA 3CLTD 5DASA 2X0KA 1O0BA 2EL7A 5EKDA 2I1LA 3A04A 1JIIA 3CA8A 1Q9SA 4WSOA 2HGZA 3MMXA 1F4LA 4ARCA 3NV7A 4MVYA 5JBNA 3ZJVA 3H97A 4ARIA 3MXTA 1NYLA 4MWBA 4R2LA 2A86A 2AKEA 1QU2A 1EFVA 1N3LA 1OBCA 3P52A 4MW9A 5F23A 1WXGA 3P0IA 1T9GS 2OYNA 3CVXA 5KWVA 1JZSA 1MOPA 4HJRA 4R2MA 4KR9A 1N77A 1EFVB 3ZGZA 4I6JA 1VBKA 3FH0A 1Q11A 3IVCA 4ZT7A 1EUYA 4F3RA 4YBRA 1KKUA 1DNPA 3CLRD 3GLVA 4ZT5A 4MUFA 2WSIA 1Q19A 1YUMA 2J09A 5FNZA 2DPLA 4UZFA 3ZJTA 1O6BA 1KQPA 3UC5A 1D2RA 1NZJA 1ZH6A 1K92A 3ZIUA 5J59A 3KFLA 2DERA 3H05A 1ILEA 1OWOA 3IUEA 1JECA 1KP3A 3VU8A 1NSYA 2H2AA 2Z09A 4HPWA 1MRZA 5K0SA 1NUTA 1GZUA 1QQTA 2QJOA 3IOCA 1MB2A 1MBZA 1X6VA 3AIIA 4EG3A 1YIDA 1J70A 1VBNA 1O97C 4XFDA 1O96A 3UK2A 2DETA 1O94D 1BS2A 3MLBA 2E89A 2PFSA 2QTRA 2X3FA 3FG9A 2JA2A 1KORA 3KT0A 4KR6A 4MW5A 4ZCTA 1T6YA 1YI8A 4E1AA 4UZEA 1GLNA 2YWBA 2V0CA 3IOEA 4CQNA 3LCJA 3ZJUA 1V8FA 3X1JA 1F7UA 2PZAA 4GU5A 1NUPA 3GUZA 3D6VA 4AS1A 5DK4A 3KT3A 2AG6A 4MUJA 2GM3A 3UMVA 1J20A 3FHJA 2X1MA 1OWNA 3FOCA 4MW1A 1WKBA 2X1LA 3KT8A 4ZT2A 1JILA 2CFOA 3TS1A 5LM3A 2E0IA 1OD6A 4S1OA 3INNA 4ND6A 2J08A 1O0CA 5TGTA 4DDHA 4EFKA 1LW7A 4JXXA 2R5WA 4EG1A 2RD2A 3COWA 3BNWA 3FNRA 3SZGA 3UOWA 3FI0A 2HMAA 1ULHA 1G59A 1XNJA 1MAWA 3TZLA 1N2JA 4U63A 1WXHA 1WXFA 2J5BA 1S4MA 3P0JA 1WXEA 5FO0A 1H3EA 2IP1A 1K4KA 1M8FA 2A1UB 3DPIA 3RFFA 2OQ2A 1I2DA 5A89A 4MUHA 3SZ3A 5H7XA 1KH2A 1WQ3A 1MAUA 2J07A 3HGMA 4NAHA 4QREA 1WY5A 1O94C 1H3NA 1U7XA 3G5AA 3IMGA 1X8XA 2ZUFA 4HK4A 2V0GA 2A7XA 3UY4A 1OBHA 3CLUC 2CSXA 1TYBE 1M8GA 4ZCQA 3COVA 3VRHA 3K9WA 3CVUA 3X1MA 2D54A 4KPUB 1M8JA 4NAUA 4ZCSA 1Q77A 1EUQA 1P7PA 2CV0A 1WZ2A 2VBUA 5KCMA 1LI5A 5A8AA 4MWEA 1R6TA 2AZXA 3QTTA 1ZH0A 4KPUA 4DDKA 2WQ6A 3AG5A 3FWKA 4MW7A 3IOBA 3AFHA 1J21A 3PNVA 4ND7A 2QTNA 4OUDB 5J5AA 5HUHA 1TQ8A 2DR2A 4MWDA 2YXNA 4WNYA 2WB2A 1JHDA 2Z3VA 3RJZA 1R6UA 4MVXA 1ZJWA 1N06A 4MW4A 1N2EA 3SEZA 1O97D 3IODA 1F7VA 3PNBA 4NZPA 4MVCA 1B6TA 1N1DA 1XNHA 3CLUD 4FZJA 1HYBA 2ZUEA 1XNGA 3X1KA 4Q93A 3CLRC 3HL4A 1GPMA 1T6XA 4EGAA 4EG6A 4NDAA 2D13A 3HV0A 2A88A 1IRXA 1G8GA 1MB9A 1H3FA 1XJQA 1NURA 3FETA 2CV1A 2PZBA 3RK0A 3ELBA 3MUEA 1N2IA 3CR8A 2O5RA 3GMIA 5TS2A 4EG5A 1GN8A 3VGJA 1KQOA 5DEOA 1N05A 2NSYA 3LE8A 2QUIA 2A1TS 1VL2A 3DO8A 4ZT6A 4DJAA 1WXIA 3L93A 3U1VA 2E21A 5HUJA 4OUDA 3HZRA 1M8PA 4U7JA 4MWCA 1EE1A 4F4HA 1PFUA 1QU3A 1H1TA 4CT0A 5BNZA 1TYDE 1PFWA 2A1UA 3Q4GA 1OWLA 3PRHA 1LI7A 1N07A 2VBTA 3CVYA 1YIAA 1EJ2A 3OTWA 3HMQA 2OV4A 1QRSA 4YP5A 2PXHA 3ND7A 3ND6A 2P3MA 1JZQA 3ISJA 4QBTA 1PFYA 1WJGA 4ZCRA 1PG0A 2XRZA 4MUEA 4MW2A 3FIUA 1VBMA 4I6EA 3TNJA 2RE8A 3MLAA 5LLTA 3AL0C 1R6XA 4U8HA 4MUGA 4Q16A 4L2IA 3NBAA 4HJXA 3JXEA 5DB4A 4JYZA 1I6KA 1IQUA 4EG4A 5K0TA 1IH8A 5FO1A 2BYTA 3RBAA 2XRYA 1GTRA 4PBTA 3QTBA 3FY4A 4H3SA 2BTEA 1G8FA 1N2BA 4MUKA 1KH3A 4ZCPA 4KR7A 4MVWA 3SYTA 4YMIA 4G6ZA 2GOYA 1P4MA 1NUSA 3CLSD 1J1ZA 1EFPA 1OWMA 1IQ0A 3P0HA 1NB0A 3H9CA 2VTBB 2JANA 1N75A 1NP7A 4MQ6A 3N8HA 4MLPA 2TS1A 1IVSA 4MW6A 1FFYA 2GKSA 3AKZA 3DLAA 5LFAA 5TRDA 1O96B 2DLCX 1PG2A 2QUJA 2E18A 1JIKA 1GAXA 3Q10A 1UFVA 2B7LA 4L2IB 3S3TA 3TQOA 1COZA 3CLSC 2PG3A 2QUHA 1U3CA 2IJGX 4EG7A 2NZ2A 1JGTA 4MUNA 5J58A 1IFXA 1EXDA 3E27A 2A84A 4K0RA 1KP2A 3D6UA 1KAQA 1MJHA 2YY5A 1KAMA 2H29A 1TFUA 3IDFA 3F3MA 4I6GA 4JFAA 1ZUNA 2O8VA 3ZXIA 2DEUA 1NI5A 3SDBA 1I6MA 4YP6A 1G8HA 2QJFA 4DLPA 4XSVA 3CTAA 1EFPB 1JIJA 1IHOA 3CVWA 4YP7A 3C8ZA 4AQ7A 4QRDA 3IMCA 3ZXSA 2CYBA 3IVXA 4K03A 3ILVA 2CYAA 3G59A 1JEDA 4MULA 5TEWA 3CLTC 4ZT3A 2EJCA 1KQNA 1J09A 2G36A 1N08A 1NUUA 3H9BA 3G6KA 1WQ4A 3PNYA 5AHWA 1T6ZA 4MAFA 3DV2A 4J76A 2DUMA 3CVVA 1RQGA 1TEZA 1K4MA 4EG8A 1KH1A 1U3DA 3IMEA 1V47A 5HG0A 1PFVA 3LOQA 4MW0A 1K97A 2HZ7A 2QUKA 4CDMA 1GTSA 3AG6A 1YUNA 2QJTA 1MC1A 3SEQA 3TZEA 1M1ZA 1O5TA 4BWVA 1NUQA 2PZ8A 3PXUA 4A91A 1TYCA 1F9AA 3H99A 1WOYA 2IELA 3IH5A 3KT6A 4G5FA 1SURA 4NATA 3RK1A 3IVGA 4R0NA 5H16A 2JAXA 1M83A 1Y42X 1N2GA 3A05A 1JMVA 1U0BB 2YWCA 3COYA 3IUBA 1N78A 1QRUA 1FYDA 4XFJA 3QE4A 4RPIA 2VXOA 3COZA 2CV2A 4PBRA 4NX2A 1M8KA 1YULA 1O95C 4JXZA 1TYAE 3N05A 2C5SA 3Q12A 4DE5A 5TEVA 1J1UA 1U7DA 5A88A 4PBSA 3TQIA 2PIDA 3L92A 1VLHA 4PY2A 1T9GR 3OP1A 3A4IA 2VTBA 3M5WA 4X0EA 3RHSA 4P2BA 3N9IA 4RUKA 5KHAA 5IHXA 1QJCA 1OWPA 2ZP1A 4DNXA 4OJMX 2QTMA 2WQ7A 1CT9A 4JZYA 1NB9A 2CT8A 1IQRA 1KR2A 1QTQA 3A2KA 1I6LA 3NBKA 4TS1A 4KKVA 4MUIA 1A8HA
chains in the Genus database with same CATH superfamily
2JFHA 3GJ6A 3ISXA 2HRCA 3GEGA 5T67A 3T1TA 3QNUA 3ZDXB 2VK4A 1C3LA 4TMTA 2ZIEA 4RA6B 4BVFA 4ND5A 4UMDA 1ZGAA 1JU9A 3O4HA 3PDHA 3FNBA 4N0DA 1UL1X 1QWSA 1LSOA 1EUDB 3FSJX 1OYYA 3H17A 3LZCA 3CUEF 5DWDA 4ZIRB 1YBVA 3JRXA 2A5DA 4V39A 4M1QA 4ZU1X 3TG8A 2DPGA 1NIJA 5B1EA 1JF8A 2P2DA 2B9EA 4OJTA 4QYWA 4K9PA 1G5IA 2J4DA 4DDMA 4OLBA 4DBLC 5C81A 1E3IA 2EL7A 3FFTA 3JV7A 3O0TA 4HNAB 4LJYA 2JFOA 4IGKA 4H4EA 2G0TA 3DMFA 5I9BA 2VVTA 4U7WA 3OPVA 2BFCA 4CLXA 3WBJA 2VF4X 2FK7A 2ZYWX 3JQAB 3LCCA 2CMKA 1YBAA 1PR4A 4KFUA 4AC9A 2JFPA 4EQZA 3QKRB 1JX6A 3FB1A 1VB3A 1N3LA 3M33A 3TF5A 5HZKA 5FBVB 1XYYA 4CF3A 2PLAA 3KEWA 3RRXA 4B2IA 4BDSA 4LHEA 4CM7A 2XMCA 1MOPA 1W75A 1FXSA 1G6HA 1P1KA 1PBNA 1XMVA 4K3UA 4JHXA 2I55A 2FSHA 3NFRA 1NJ6A 3KD2A 1KHHA 2IE0A 3M9WA 2ZYHA 3BK2A 4ZT7A 4E03A 3OHMA 4KLNA 1JDNA 3CR7A 1ISIA 1H9BA 2VLIA 1EA5A 3CCFA 5H81A 1WCIA 3GEDA 2ZK7A 2F17A 2IHVA 4FWIB 1C7FA 1WDTA 1XQXA 1WOSA 3F2IA 3OEYA 3OQNA 3ENQA 3TLGA 3K1ZA 3GMDA 3H05A 4JP3A 4E5YA 2EBWA 5HP4A 1MRSA 3OEHA 4MWTA 5FPSA 3VU8A 2HK7A 3T4XA 3OJCA 4N8DA 4JGBA 4PSUA 4ZHQB 2IY8A 4Z1OA 5JY6A 4QDKA 2QMQA 2XCOA 1COWA 4AROA 5IJZA 1TB4A 2AW5A 1D07A 3H1EA 2CC2A 2RMKA 4AYXA 4D9JA 3GLGA 3PVSA 1YC5A 1A9OA 1PQ4A 3ZK7A 1JQ5A 3W2TA 1KU6A 1BO6A 3W9YA 2ZE8A 3ZV6A 5JC1A 1FB5A 4O4JF 3T52A 1E2UA 2CEAA 4R2XA 5DHTA 1XLTA 4F85A 3C16C 2XDWA 2AVDA 3QXGA 4IH1A 3EXHC 3CJQA 4R1NA 3ZU6A 5LIPA 5G41A 1KZ7B 1NW8A 2CXRA 3R5TA 3CP2A 1EIZA 1X8LA 4X71A 4EYEA 1WZIA 5B6IA 1OTHA 3AF0A 5B3AA 1G2QA 1N2XA 3OF2A 5I4BA 2CF4A 1AO3A 3NM4A 4RMGA 3SMQA 3WGJA 4EKGA 4X8HA 1EB9A 1RMYA 3VTAA 4O4IA 2DHQA 4ARUA 3ZU3A 1NMEA 2VDLB 1TMGE 3V6MA 3P9RA 4B85A 3RS2A 2IPLA 3UMVA 2HWYA 5HDQA 1UD3A 2H51A 2ILVA 2QEXB 5KOJA 4G1BA 1KU0A 2LXNA 3CONA 3CZ9A 4WOCA 5DYYA 5K3BA 5K7SA 4RHYA 3HK2A 1DSSG 2UV8A 3HCFA 2H57A 4ZOCA 5JSFA 1T9ZA 1E0AA 3SDSA 1ZWLA 1JB9A 3O73A 3M2PA 1H1DA 4CM3A 4EHAA 3FROA 3R4CA 3EPJA 1JVNA 4OGKA 2A9FA 3DEKA 4W63A 4DLVA 1JNXX 1E2GA 2WF9A 3WGOA 1II0A 4G4SP 3V97A 4X7MA 1U3GA 4Q21A 1EEHA 1UFKA 2YHIA 3F5FA 1KFKB 4IFBA 4B09A 3NDPA 3K2QA 2GZ1A 2NYAA 2FPLA 1PUJA 1N5KA 3GUCA 1V9SA 2VJPA 3QUTA 5CITA 1ZIDA 1XZFA 4NCHA 3L0PA 4B3SB 3QBVA 2HLPA 3TL3A 4HDRB 4P58A 2HMVA 2F8LA 4RHEA 3RFFA 1E79A 2H54A 4RLSA 3A11A 2PZLA 3QFHA 5EP4A 4XLAA 4B8YA 4JMLA 4UEKA 2ISSD 4MS4B 3ZD6A 2PKQP 2OHVA 3PB3A 1R88A 4ARSA 1EK1A 1U8EA 9LDBA 3L43A 3TINA 4A15A 3BFPA 2C7RA 1Y82A 4JMPA 3WGNA 4R51A 2ANCA 4F3TA 2IVFA 4BS9A 4NCAA 4W5QA 1BW9B 1Z8NA 2P9TA 4MV0A 4WZTA 4U00A 4WT7A 4XXHA 1P2DA 3PQ4A 1AQLA 4DNOA 2H2HA 5ERYA 1CVIA 2I7TA 2XMQA 1VHTA 1GGVA 4OL0A 3GRVA 1Q1ZA 1L1QA 4NAUA 4MYSA 1F4VA 2XJ9A 3CRNA 5DHRA 1P7PA 3BE5A 3HUEA 2IV2X 3IT3A 4M0LA 2V8OA 3EAFA 4UEJA 4C5BA 5IDQA 3HPQA 3G1UA 4N40A 2F4VB 4BPRA 5FWXB 1SB8A 1XVLA 3O1JC 4CN8A 3T3GA 1USIA 2QEQA 3GZJA 5ALNA 2C82A 4PYMA 4CMIB 1TJ3A 5HCNA 4CUZA 3ET4A 1W6RA 3ESBA 1LEHA 4IUBS 1HEIA 4ND7A 1K8AD 2WZCA 1GL9B 4PAMA 5HGXA 1KMQA 2DR2A 3WRXC 3RROA 3CPHA 2PWZA 2QTAA 4FSHA 1R5JA 1RI2A 2X77A 4Z4SA 5DHFA 1JHDA 2O2SA 2Z3VA 1DJLA 1XZQA 3C7CB 3NGLA 4M87A 1R6UA 4A6XA 4TTJA 3TSOA 4XKWA 4MW4A 5IG2A 4AUEA 4QQRA 4Q34A 4LHVA 2CLDX 4RA9B 2XCQA 3W4JA 2DM6A 3FPAA 2C1EA 5KI6A 4R05A 2UYGA 3LDFA 1N1DA 2CL0X 3NNSA 3S27A 1RRKA 3SIXA 4PHCA 5F4JA 3ZDEA 3ENWA 4Q18A 1D9ZA 2WPDA 1UXIA 2BLNA 2ZT8A 4QATA 3C1OA 3GH3A 2D7DA 2Z4RA 1GUYA 1M1NA 1VYHA 2VJJA 2QTFA 1ARZA 2QN2A 3RPEA 3X1ZA 4RULA 4BFTA 5I4CA 1B4DA 4LJAA 4O4LA 1U1CA 2K2QB 3EC7A 1E0KA 4WINA 4AKTA 3U3JA 2ONKA 5BPHA 3IQXA 4O2AA 4O4IF 4CKWA 5JNRA 1FBTA 2Q1UA 3NATA 3GJYA 1MEJA 5AKGA 3L5KA 2WU8A 2FSIA 3IE2A 4KTTE 5ELMA 1WUTA 5LKRA 4O3MA 1N1EA 2A9OA 3Q9NA 4QG3A 2GN4A 1RI4A 2OAQ1 2ZS8A 3OPYB 2AOUB 1LB1B 1BHQ1 1Z68A 1XQ6A 3BAZA 3F7OA 5TR9A 1I01A 3M70A 1XCPA 3I4FA 4L4YA 3A1SA 4LYJA 4KX5A 5E6UB 4ETNA 4NZNA 3ANNA 2XPCA 5FPYA 1GPJA 5JFGA 2C3PA 3GGSA 3ZWBA 1K6JA 3DZ8A 2C9BA 2DHCA 2BEWA 1Q0ZA 4DCGA 5LWQA 4AWXA 4BKUA 1LLDA 5L51A 5F3WB 1EE9A 3DV0B 3R6LA 2EX1A 4HWGA 4WUTA 1F0PA 2OCBA 3L93A 1I14A 4NJEB 3ZHQA 5A9SB 4DLKA 3BQJA 4KKUA 3KQNA 1GQSA 4LSMA 2C4NA 5ERXA 5HKOA 4J29A 2JRCA 4HB4A 3IUJA 3QEBZ 2PM8A 1MC8A 4H0NA 3EZ2A 4Y9TA 4RSMA 1TYDE 2FX3A 1D7AA 1QR6A 4NVRA 2Y2UA 3UMFA 1F8YA 3IP8A 3RJMA 4UJ3A 4A9AA 2X7XA 4P3KA 4UVHA 2WOJA 3FSGA 4YP5A 4D9EA 4DR3B 3E2IA 1OXSC 5JWOA 4QULA 4ESEA 2P9YA 1QH1B 3GVHA 2BZGA 1SHTX 5BQXA 1I3LA 3ZDDA 1UD4A 4YGYA 3B78A 4FUTA 1D1TA 1HLGA 3EH2A 2RE8A 1F51E 2HD4A 4QJ5A 3RQIA 5L6LB 3GRKA 2VOJA 3I9KA 1OV4A 2HCFA 2JHGA 1QPGA 2VBCA 4JHLA 4P4LA 5LB4A 4G4JA 3R7DA 3UOAB 1KYVA 4MGIR 4EQ6A 1XPUA 5EOVA 2D1YA 3DR5A 1FTGA 3SHOA 4O02B 2XI4A 4WKNA 5ITZB 4AY4A 1JKJA 1PT8A 2EFEB 2XQVA 2XUIA 4JMQA 1NWHA 3E15A 3GYGA 4OY3A 5HIJA 1YFLA 3KSDO 4Y2HA 1HEYA 2FEMA 3D31A 3RTDA 3RC2A 3DDZX 4PINA 4LNUA 4OHUA 3UT0A 5JPCA 1CF2O 1DXYA 2K5UA 3DVAB 1N8KA 3GX1A 4PBTA 5JJ5A 2V9PA 1OLUA 1XZKA 1M1YE 1KH3A 2PL9A 5LA6B 3U3DA 4D0GA 1ORWA 2GPWA 2WJ4A 5AKKA 3T6KA 2F48A 1FFHA 2I87A 2J9FB 5KTNA 1J1ZA 1C0EA 5GJVC 1XDGA 1OWMA 3NV9A 4AG5A 3H9CA 3GCGA 2IYAA 1QG2A 3V1TC 3Q39A 3RU3A 1XN4A 2PKEA 5CA1A 2BGTA 3FPSA 4GQNA 3DFZA 4HO1X 4WD3A 3RT7A 2Q1YA 3LOPA 4R1PA 4OSEA 2PSDA 3JU4A 3EF0A 4WNAA 3WYBA 2HMUA 4BB0A 1M1NB 5JAZA 1CKEA 1L8LA 1EVJA 1SU7A 4GPAA 2QN7A 3CCMB 4KVZA 4NZOA 3S2SA 4B17A 3AKZA 2I4OA 5JNLA 4E2WA 2BR4A 5K03A 1PG2A 3QSYA 4C14A 1LX7A 2J30A 2QUJA 5HK8A 1ZD8A 1W4LA 1PJ8A 2B4TO 5CT9A 4QUGA 3Q5GA 3IQWA 5JAPA 3WWDA 1JHAA 4LXIA 3NE5B 4K9LA 1Y8RA 2JAWA 1U3CA 1L4MA 3SM3A 4GPZA 5KVVA 3FSGD 3GJ5A 2C5HA 2OZPA 4QAQA 3I23A 3INTA 5L9AA 3VU9B 3WLTA 2F3RA 4D9GA 5C3MA 4F9FA 1KJ9A 4XX1A 3THOA 2R87A 1U6KA 1T5BA 2WHPB 2VA9A 4D9CA 5JWRA 3JQBA 3PPIA 1E59A 3IP5A 4BBZA 4BX0A 1R10A 3B53X 2B6NA 3IDAA 2I54A 2H29A 1Z88A 4LV6A 4LSGA 1Q21A 1TZKA 4K9SA 1QVVA 3K31A 3TQSA 1EFKA 3UJNA 1Y4UA 3ZTTA 5AKEA 2G77B 3KWMA 1FTYA 3FKSD 4OH1A 2B1QA 3RSCA 3U3OA 4CKYA 3PFCA 1X7XA 2Q3HA 3F74A 3KYCB 4OQYA 4QSHA 2OE2A 3WIOA 4YACA 2F4NA 3OM8A 3F8WA 4KAAA 3PL5A 3BX1A 2C4HA 3C3WA 4R1LA 4B34A 1FDVA 1OXTA 2R3SA 2VPQA 1Y7PA 2VNIA 2V97A 1SNYA 3CW9A 3GEIA 1L5KA 3G59A 4LZPA 2RCNA 4UBMA 1HZZC 3FNIA 4CLDA 3FPPA 3AL2A 4PPQA 3VXKA 5CDFA 3RI3A 1E1YA 1U81A 4GC5A 2J31A 1MVLA 1V7CA 1RWMA 2WKQA 4I1IA 2VDWA 1NUUA 4R9SA 1XVUA 2NYUA 2VWHA 4X8LA 4UUQA 3B3FA 4MGZR 1U0LA 2HJSA 4UPVA 3V3TA 5BR7A 4HQRA 1T2AA 2EWWA 3B1XA 1P5HA 3EGIA 2WF8A 3EC1A 3QVSA 4LSZA 4URHA 3VX4A 2ORIA 1KOGA 3TIGA 3RK4A 4DCCA 1KDPA 1SKYB 4G9EA 1OPXA 2JRLA 1RQRA 1P31A 3F96A 3BGVA 3DKPA 1H1LB 3EIHA 3BCRA 4R8RA 4AY5A 1HTBA 1OLXA 3E22B 1Q3KA 3LPMA 2C61A 1HE3A 4HDMB 4Z3DA 2FN3A 2N0SA 5CIQA 3O2QB 2I65A 2Y05A 3I76A 2H00A 3E9DA 2F3QA 3IUYA 2AMYA 1K97A 3CTPA 2OZVA 1DG1G 3FTCA 2DHDA 2MWMA 4Y30A 4B44A 3EUAA 4C0LA 5AW0A 5K0BA 1UM8A 4ZAVA 1KZYC 1H8HD 3PNPA 4GG1A 5JH7B 1AKUA 3NNDA 3G88A 1NVVQ 2FE1A 3A1NA 2VPTA 4XPIB 5KU7A 4QU5A 4PXYA 3VNAA 2P2CA 2HK6A 4KIJA 4O2RA 5DULA 1O5TA 1QG4A 2TYSB 3RF6A 4BWVA 3IKJA 1T3ZA 4N6GA 2B6HA 1F9AA 5JMPA 1DTSA 3VHLB 3KNZA 4CKXA 1CRLA 1WOYA 4XQCA 2DR0A 5AOCA 2I4MA 1EUZA 3GOQA 3RK1A 3K71B 1M73E 2GD2A 3ZWYA 2JZOA 3EAGA 4HDNB 2ZYVX 3HJRA 2D2VA 1FBNA 3CKLA 2AN3A 3NLLA 1NP6A 2GN6A 1NONA 1RI5A 3OLYA 2FX2A 1CUEA 3COYA 1A3CA 2YCLA 5D6NA 3RLFA 1J07A 3R7AA 1F06A 1XVTA 1KMIY 2ZWMA 4C05A 1BEEA 3O03A 3H3JA 2C7OA 1JJBA 1WMSA 3ESZA 3VU1A 3LYHA 3IAM1 1ND6A 1UZAA 4KH0A 5FBHA 5KYUA 5EJEA 3OHSX 5JISA 3BH4A 1J5XA 1NVDA 4HH4A 1T0IA 3OC0A 4IDBA 4BAZA 1CUIA 5FR1A 5BUSA 5AP9A 5JJIA 2NTEA 5CLJA 5BQPA 3ZE0B 4CXMA 4HGOA 4G0VA 1VLHA 4IJUA 2QMZA 2H85A 3THYB 1DP4A 2C5AA 2YRWA 3M4YA 4RFVA 4YCSA 1BDHA 2B8TA 4Z4UA 1NHGA 1DBIA 4FSDA 4WY5A 3S1AA 5HIIA 4DADA 1LZLA 2YXBA 1PO7A 3SLRA 3RJ5A 1PWEA 5KQPA 5ES3A 4NXNB 1EZZA 1CEEA 2EKDA 4XQ9A 3UENA 5K8VA 2BTEA 4X3OA 1O08A 1QTQA 5ALSA 4TRRA 1W5SA 1ISSA 4XPIA 3T1OA 1T13A 3LHKA 3VR4A 3T51B 1U8CB 1ZUD1 1Y5IA 3X2EA 5I3ZA 5EE1A 4B35A 5T8KC 1A9XB 4GICA 3L8ZA 5FRDA 4ZV9A 1L5WA 3D7LA 2WAYA 2WHXA 5E9WA 3MHTA 1U0OC 5ESDA 3QBTA 2Z3ZA 4JY7A 2JDIA 2GJ8A 2NLOA 2WAOA 1K75A 1YUBA 1H0KA 4J1NA 3SBEA 5BMVB 4ZEXA 4UTPA 1RQPA 3O2SB 4N65A 4WZBA 4O4HB 1QCCA 4UU1A 1R2QA 3BWXA 2ZJ2A 3IFSA 4K1XA 2JGIA 1V45E 4FZRA 4EZBA 2ZZKA 1LDYA 2JZCA 3AKEA 3KHTA 3UH1A 3W78A 5ED4A 4ZVTA 4H4DA 2X0KA 1IPFA 1S3GA 2O2XA 3IQHX 4RPBA 5H02A 4PCVA 5IAGA 5JAMA 5L4LA 3T54A 3A04A 3Q11A 4BFVA 2HRQA 2IOHA 4ND2A 3RC7A 4IH9A 3CA8A 3AM3A 1RYFA 3N8IA 4MWGA 4JI6B 1KJQA 1PE0A 2XRFA 5JUWA 5DM2A 4QQKA 1Z4JA 4F4UA 1CY8A 4N41A 2X41A 1TIKA 1V4NA 2AKAB 2FPPB 2J4FA 3IX7A 2EWMA 3WR5A 3DEHA 2CHUA 4F06A 1BXGB 5KNBD 3ULKA 4Q9LA 3VKWA 4GWGA 1V8OA 4DV4B 1Y8QB 1E6WA 2A5LA 1E9CA 2VH1A 3EMDA 2IHZA 3LQ4A 5K0GA 3TSYA 1JT9A 1RWXA 2JCYA 5U4QA 3T0IA 1A8QA 3TWOA 2J3IA 4DMMA 3FCAA 3CH5A 3TD2A 2Q3MA 4KGZA 5EWJB 2Y68A 3HCOA 3IVCA 1WF3A 4GMFA 4WXHA 3MTIA 3KLOA 3O95A 5KREA 3KOUA 1LPAB 1M2VB 3AR2A 3EY4A 4Y6QA 5F73A 3KAPA 5BOSB 4LEIA 1QR2A 1YUMA 3L0YA 4Y6GB 2I22A 1ZJ4A 5BRAA 1CUXA 4N49A 3J7AC 1VLVA 4OPOA 4B83A 4GLJA 2XXAB 3BQNB 3E7XA 4ZU3A 1GGFA 2VJAA 3BRCA 4X7CA 3LSYA 1IPHA 3ZY4A 5I3CA 3FTDA 3RBXA 4Z4RA 1L1FA 3BT7A 1OZ0A 1KAHA 2AJDA 4XH9B 2QQ0A 2YTZA 5ALLA 3SAJA 4A0RA 4OYRA 4TV8A 5FPKA 2A7QA 1ISGA 2WJHA 1K0UA 4I0WB 5F4MA 2O2CA 2C4KA 2X14A 5TPZD 4DC0A 1HO3A 4OPVA 4FR2A 2ATXA 4I2NA 1MRZA 3UMSA 1QGZA 2J85A 4RELA 5I7AA 3UOGA 2IPAB 1D5CA 3TLZA 5JASA 1TT5A 2YRFA 3JWEA 3JYHA 4FCCA 2XUJA 3VKFA 3PV0A 4M38A 4C4AA 1YDGA 4RU1A 1PV2A 2GPYA 4UQLA 1QH8B 3KSAC 3FI9A 3BXEA 1HC7A 4ROTA 1POXA 2XB6A 5CM2Z 4INAA 2FTKE 2WUFA 1ICEA 3EVFA 5JROA 2GBPA 3TLXA 4YMSA 2FPKA 2H11A 2P68A 2WSYB 4BJ6A 5DNCA 3QPWA 3U7EB 1NI4A 5EJ9A 4NYJQ 1VIVA 1L8XA 3B7GA 2FPOA 4KGXA 4MUAA 4UAGA 3S40A 4G3XA 4YT8A 1U2QA 1KKLA 4UZEA 2WWFA 3PR2B 5BSGA 4KLAA 1FSPA 1NNLA 1VLJA 4K8RB 2VP6A 2X8JB 4RVGA 3W8FA 3ZI7A 3NANA 2HQBA 3OIDA 5AHKA 3E2PA 3U16A 2WYUA 4BUZA 2JFVA 3DLHA 4AS1A 3OPMA 1UC9A 1X1CA 3ENNA 4MQUA 4Q37A 4E5KA 2HCJB 2AG6A 3ZE8A 1RWVA 2Z3WA 1PD0A 2XF8A 1TM5E 1E2LA 3I1JA 4M1YA 3IQZA 3EZFA 3GJ4A 4YLGA 3EY9A 1Y6ZA 2PL5A 3LNNA 1S7GA 1L5RA 4J3NA 5I7VA 5KEIA 1T36A 3DSRA 2P9BA 3KT8A 4MRVA 1HPLA 421PA 5LPNA 2QV7A 3RSLA 4NFHA 1DOZA 1V6SA 5LM3A 2Q9AA 3RTAA 1UWCA 4Z0HO 1OD6A 3DZBA 1T24A 3K35A 5ESXA 4BWYA 2ZTNA 4MZDA 4IKEA 1WOOA 3AEKB 4GRDA 3ERCA 2I7DA 5AW7A 3AJ9A 4ZANA 3LBAA 1FRFS 2IZ7A 1YR9A 1J2JA 2FHPA 1XU4A 2MSLA 4IHQA 1M9NA 1W4ZA 1YA4A 1UH5A 2ZJZA 2OBLA 4EI8A 3SZGA 3D59A 3KUCA 6REQB 1JHMA 1GR0A 4F71A 1SIOA 3IURA 1G63A 3A4VA 1J33A 1FMFA 1UPBA 3EVNA 3K30A 1U0NA 5JVDA 3OIYA 1Z36A 3PA2A 1R0SA 3HCBA 4X41A 4B3XA 4YV1A 4PIVA 4B47A 4ZVLA 4PPYA 3H1GA 1RLJA 4L8VA 4F11A 1Z5ZA 1Y3AA 3QKWA 2ZJOA 4ZAXA 1VCHA 5KIAA 3VI3B 1XE3A 4FHCA 5F5LA 4EY5A 4OP3A 4Q4JA 2JGDA 2HHAA 1LS1A 4UREA 3S70A 3DCJA 2A14A 4TGLA 3DDCA 2QX4A 1KMMA 3OQMA 1LS6A 3TW4A 2GARA 1GSAA 1UT6A 1Z47A 1R6AA 4D79A 1UKZA 4MV8A 4PTZA 1KI6B 1U4SA 3KFVA 1TZ2A 2FPIB 3M8KA 4FPXA 1EHCA 5C9ZA 2NTVA 5I45A 3EGXB 3RNOA 1GJRA 1AQUA 1PQPA 2PA0A 4JR1A 3CVUA 3HKEA 3QEAZ 4RA6A 1MJ5A 1SXJC 2I4LA 5KTTA 1Y6JA 4LDZA 3LWBA 4JJ4A 2G07A 2F62A 4LZAA 4FMBB 4CM4A 3CBGA 3NWBA 3O3NB 5A8AA 4U5XA 1Q7RA 5FOUA 3WWEA 2ACVA 2XCLA 4C20A 4QVJA 2LE0A 4YUZA 2XNSA 2JCVA 4UC0A 4DDKA 1HE5A 1L4BA 5IHPA 1QZUA 4BFCA 2RGAA 4FTWA 2A5JA 2HWKA 4C6RA 5A5DA 1QIDA 1V39A 1E1MA 1H2YA 1Y5MA 2E4YA 3H11B 5GGYA 4EEXA 2WVJA 3RVRA 1N6KA 2XMDA 2SCUB 3UT5A 4AJKA 5JHGB 5CB4A 3WLJA 4UUMA 2ENWA 3AW8A 2AFHB 3Q98A 4BUJA 3GAZA 2PUGA 2CWWA 3T7IA 4NSNA 4WL0A 1YDMA 1H6BA 4MVCA 4QVIA 3ZGVA 4OXQA 3GAAA 1R15A 1O8BA 5BWOA 3CLUD 1G7SA 2CB9A 3DUWA 1MMFB 3SC2B 5H59A 4D0LB 1SCKA 4IXMA 3EVZA 4Q93A 4F2DA 1TJ4A 2HCTA 3ZX4A 4KSCA 4EL0A 4KCGA 3AJAA 4P2GA 2GK6A 1W94A 2P1ZA 4UDYX 1IN5A 1Z6GA 2XDAA 4N76A 1BE8A 3DXFA 4XOIA 3KLPX 4B45A 3QPVA 3IC5A 1QF7A 3FNGA 4E5NA 1LFDB 3K1YA 1L7DA 2I9PA 2C57A 5IBQA 4F5DA 2MTBA 5LZ2A 1J7JA 1XJQA 3R7WB 3A6JA 3COJA 1A8UA 4QBHA 5TX7A 4MKHA 4DCJA 3ELBA 4YCNA 2O1EA 2Q1XA 3A1TA 1SC4A 1DPGA 2OUKA 4TXNA 3N2IA 3OM9A 4U9UA 1YZVA 3ZBPA 1JXQA 4OXNA 1AU9A 1YD7A 3U2QA 3IEIA 3FA2A 1W9XA 4L75A 1N05A 2VT6A 4H1VA 3CCVB 4ZAZA 1N3BA 1Z5VA 1JVSA 2CK3D 3FMIA 4D2IA 2PS9A 4H7KA 5F76A 2NUAB 4BAUA 4BVLA 3QITA 4L73A 4QLAA 4R1UA 3C4VA 3HKDB 4BGUA 3R77A 3S7TA 4YAIA 2ZB2A 2RJOA 3EGDA 2OZKA 4QQ8A 1V1MA 2YHAA 1XRRA 3EZXA 4UBIA 5ENDA 4OUDA 3HZRA 1M8PA 1Y7HA 4IRMA 3KVVA 4W99A 1KO4A 2I29A 3HP4A 2FUKA 1PFUA 1SBZA 3JU3A 2YJGA 2FPPA 4I7EA 1PFWA 3FYUB 3TTUA 1A69A 3IR7A 3HO6A 1Q91A 4EW3A 3NGXA 3K20A 2A5GA 1SG6A 3A9UA 4XUCA 1OJ7A 1QFSA 3VH2A 4E11A 4UUPA 4D44A 4P5PA 3RVNA 3LFUA 5A3QA 5BSEA 3A1VA 1TUBB 3R3HA 1M0EA 3LY8A 2XXAA 4NH4A 3ABIA 3OKCA 4CI0B 4NF2A 3TQCA 1EVIA 2Y1DA 4KQGA 4LCEA 4MQMA 4MRSA 1E9RA 3MLAA 5IBPA 2XT9A 3G23A 4AJ2A 5EJ4A 3ECSA 3IP6A 1VKRA 3ZNQA 5AIAA 4HR7A 1S2MA 1TUGA 2AYYA 4IDNA 3WSTA 3P9IA 5JSQA 2FZLA 3ZEAA 2HPHA 3L6BA 5AKXA 3SX0A 2B8WA 3AHIA 2V5VA 3PFBA 1R27A 5HZAA 2F59A 2XWPA 5B2EA 1CQIA 4UTNA 1KAEA 1YASA 4EG4A 5JZBA 2HCBA 2NUPA 3L8YA 3PEEA 5J2UF 3D54D 3WLSA 2FXIA 4OHWA 4PSKA 2XA9A 4ZQBA 5EGNA 2M32A 1OJLA 5DHPA 3D8HA 3C15C 4HGYA 2ZROA 2CFTA 3NYQA 2YINC 2H2WA 4DQDA 3QFCA 4CKCB 4ZQCB 4YJHA 2C04A 4ERXA 4NBVA 2WJAA 3BOSA 5FP0A 5CYGA 4L7QA 1O6FA 1P9LA 1OU4A 1ZG3A 3UO8B 5BN4A 4D45A 1G8PA 3OA2A 1WBBA 1EQAA 1GT91 3WKCA 4BE4A 1IVSA 2P35A 2A0KA 3U4HA 4M0DA 4YELA 2QL6A 3BD9A 3QJGA 2XRMA 4AZ3A 6GPBA 2ODEA 5TJHA 2YIJA 4TMXA 2XE6A 4DSNA 2R5NA 3W5SA 1HMYA 3OVMA 3C7AA 4Y2UA 4FQ8A 3PBKA 4OKSA 3NHLA 2G1JA 4EHDA 2XVZA 2OTCA 4XWTA 1WSAA 3S3TA 4ZMBA 3MT9A 1TCVA 5L4SA 1O58A 3TDKA 3W5CA 5IUKC 1QTIA 3EHEA 3RREA 1XL0A 1LLFA 2JAPA 4PN3A 3WNZA 2EOAA 5J58A 2I6SA 4JJ8A 3BCFA 1MJFA 3MCZA 2GI4A 3NEYA 1H05A 1PFKA 3D6UA 4FGKA 3P7MA 1RXIA 4DHEA 4WXYB 1U0TA 4BOYA 1GFIA 4NHOA 2E48A 2ZYGA 3DE5X 3W79A 3PJGA 3PICA 3SQMA 1NL3A 5KNBH 3WGZA 3ZTWA 1A9YA 2JH8A 3AUSA 1BWSA 1Z4NA 3CX4A 3V1YA 2YJ6A 3OFKA 3QXCA 4K81B 4J4HA 4LPKA 5JD4A 1D2MA 3N2EA 5LOVA 5AVZA 4ZJUA 4XSVA 3R3VA 4MTLA 4EEZA 3INRA 3X44A 5IDYA 3ZS8A 2HPVA 1EP3B 1JI3A 2B30A 1MU0A 1PT6A 4GI2A 4UNNA 5IF9A 4AQ7A 1OASA 1BQ3A 4CU5A 2P4UA 5M7EA 5EAIA 4OGWA 4NBLA 1Y80A 3Q6MA 3ILVA 4PX2A 5TEWA 3SIRA 5LQKA 4ZFNA 3VPFA 2C4WA 3HCDA 3ENKA 4GMHA 1IWBB 3RANA 2AFIE 4QOSA 2BE7A 1NTRA 1G19A 1ODCA 3W3AA 2B5VA 4G0WA 1U2ZA 4INZA 4YAOA 3KPUA 1SUWA 3AP2A 1I4EB 1P7VA 2GASA 3H9BA 4QLOA 1QQ7A 3SNKA 1P44A 3OMLA 1BH2A 3JQGA 1E6MA 3CW8X 3LLVA 1HE1C 1C2YA 2AF3C 3OZCA 5JCJA 1K7FB 3DV2A 4QXQA 1N36B 2JJYA 3OZDA 5L7TA 2WTNA 3QLTA 1K4MA 2HYDA 3OO1A 2BGRA 4LKOA 2GRAA 4EG8A 3GLHE 4KN5A 3FLBA 4REOA 2UZ1B 4EVQA 3SK0A 3EFOA 4B0PA 1DJOA 5AM5A 2RGNC 1I0ZA 2SNIE 2OC4A 3QLUA 2AE2A 4BCDA 1GR1A 1VJRA 1L4HA 2J59A 3NW9A 1VIMA 3DVSX 3EXEB 4NV0A 4G9BA 2MSKA 3RKUA 3Q0TA 1N4AA 1K8XB 4FOLA 1V48A 4C0AC 4AY3A 2OTJB 1REQA 1T8UA 5G40A 3T7AA 5GVSA 1C9DB 2DUNA 3QIVA 5DSXA 1YACA 2XD4A 3LUHA 3DKRA 4D9NA 2FG5A 3VPHA 5BO5A 4PHHA 4RM3A 5JSHA 4PS0A 2JH9A 5JG7A 1PTKA 4L4SA 1XNQB 4B71A 1JAXA 1KS9A 2HBYA 4AS3A 1IIBA 2H3EA 3ER8A 2VHVA 4UW9A 4C7OB 5KDDA 3R7NA 4F1WA 1E9EA 3RC3A 4FDVA 4QXAA 5KJEA 5BSXA 4HGQA 3H18A 4JVLA 5L46A 3A2MA 3COZA 3M6UA 4Q9JA 4QG7A 4ZO8A 1WVIA 4PO3X 4Z4HA 2PUDA 1P3JA 2B69A 1CJSA 1M7GA 3EIFA 5EJIA 2OYCA 1ATIA 1OF1A 4CJXA 4B6GA 2P2ZA 4JB2A 2PTGA 2VSOA 2OQVA 3OQVA 3GIDA 3BRWA 5FI5A 5CT5A 3KAJA 2BP7A 5A4FS 3R0VA 3N8NA 2Q4EA 4N6OA 4EYKA 2YZGA 5DOZA 1QFJA 2YXPX 1Q6ZA 3HR7A 1DEOA 4MA4A 1ULUA 4O2AF 1HG1A 1H85A 5ILQA 2WD9A 2FPIA 4B6QA 1I9CA 4OHZA 1AA9A 1FFXA 3UC9A 2VWPA 5KMGB 2QTMA 3BBLA 3B1VA 3H1FA 2PLNA 1A76A 1IAQA 5JCJD 1Y9AA 4M2LA 3QKTA 5IS2A 4BLVA 4Z4YA 3E35A 3CZQA 1QRAA 4KNWA 1YB6A 4R2WA 4B4OA 2CYCA 3N5KA 3P9QA 4HADA 2MCFA 3TEFA 2JN9A 2A59A 3VJKA 3RYCA 4O2BF 3ACDA 4XJSA 4BEJA 4NFSA 1GQOA 2JBWA 5AKHA 4LQ4A 1KMNA 2HLHA 3OZIA 4LYGA 4KITB 3MRSA 1SEVA 1X1EA 4RDKA 4FFLA 5LP6C 4DIBA 4JL5A 2D00A 5KSYA 3AU9A 3QTLA 4NONA 4BQFA 4H7DA 4U9IS 1UBHS 3LBFA 2C0QA 1YC2A 4C6TB 5J4LA 1FRZA 3C8DA 3ICVA 4Z1MA 3ZK9A 4BNNA 2GN8A 5IM5A 3NBQA 1WEHA 4OHPA 5GAJA 4OJQA 5AI6A 2QG9A 3VOSA 3PTAA 5TY0A 1NBHA 2J0EA 1JP7A 4HWPA 3AY6A 3EA0A 3C7KA 1N5RA 1DELA 3DZHA 3JSXA 2J6BA 2DFVA 2ODTX 3ME5A 4LRXA 3NBFA 4TWIA 1FDOA 2VHUA 4AJ4A 3BCHA 1UBNA 2GN9A 3A6HA 4RK5A 4YO8A 2QGFA 1NT2A 3AB7A 3EZYA 2VDRB 1ZSVA 1NPDA 4MYUA 3GZNA 4HWKA 3IUNA 4D0NA 3OU6A 3P52A 4JU8A 3VPCA 3MNFA 4RY9A 3VOBA 2PX3A 1GZ7A 3BIFA 4QFCA 5A6SB 1DPFA 4ZKEA 2FW8A 2VTDA 3EIOA 4B79A 3H9NA 2REQB 3CBQA 5KKAA 3P2IA 3PK0A 4KR9A 4DV2B 3G2HA 3HY3A 4I6JA 1MA0A 4NE2A 1KDRA 2QZZA 3GVLA 2HSJA 4XJVA 5JT1A 1W8DA 3NVKI 5DHQA 2P91A 4MVJA 3VHRA 1FUEA 1Q19A 5EXDA 1VKJA 3IALA 3D3QA 4UTZA 1JUDA 1GPBA 1Q22A 2COKA 2EJTA 1P7ZA 3SSNA 2WG0A 3FR7A 3K3PA 2J6CA 3MWJA 3PL1A 2VSFA 4ETWA 5AM1A 3M4XA 4JQYA 1VQ1A 2NZUG 2PXXA 3ZWPA 1WUHS 4YPFA 4LC9A 2AC2A 2B61A 2YNMA 4LGCA 5DYTA 3UG6A 4BKMA 2IYRA 2BVNA 3PSHA 3C4JA 2OXTA 2O8FA 3L18A 1TO6A 1TU3A 2AN1A 1H5NA 2VDMB 3EIEA 3KJZA 5JR3A 4KQ6A 1I1OA 3TI7A 3K9LA 1Z8DA 4X7BA 2IIVA 2WRZA 3FRHA 4BNWA 1P33A 3UK2A 2GN1A 4DCUA 1MPTA 1XFAA 1E96A 3Q2IA 1CUYA 5KX5A 2ZRAA 3NHSA 4PSDA 2V7WA 3TZQA 1ZRHA 2EJBA 3UUEA 1WETA 2NNWB 4L74A 3I2FA 5IW8A 4YFVA 4P83A 4GBGA 3WKEA 1GYPA 5A2QA 2PXAA 3NTOA 3AW9A 5D5QA 3VV3A 4IRUB 3WIBA 4DQXA 4O59O 4ZCTA 2CE2X 1JNYA 3LX5A 5AICA 5IN4A 2MYPA 4DG9A 1ZHHA 5ICMA 3AR5A 1L5NA 1E6CA 2YX1A 4JGGA 3WHLA 3E1GA 4JS0A 4YJ3F 3RFTA 3USCS 4X90A 3KT3A 5T4EA 4RE5A 1RJDA 5KOYA 3D6NB 2CL7X 3U1TA 2QAIA 2VDQB 3Q3EA 4MIKA 4C4RA 4R1TA 3OAAD 4OYHA 3OTIA 4J7CA 3DAFA 3K15A 1UKEA 1C9KA 3QBDA 1PDWA 1NUHA 1ORIA 4JH0A 3WHPA 5D8DA 2RHCA 2ZEJA 3HEBA 3NWJA 3D7MA 5DX0A 3ZK8A 4LDRA 4RQUA 5ALVA 2VPXA 3KUKA 2CLCX 4JVNA 1V11B 1Z75A 4R4JA 5D3ZA 3CESA 2OFWA 1LLQA 1DB3A 5DW3A 3O84A 4NG5A 2WA2A 3ASPA 3C1UA 1RJWA 4P33A 5TC4A 4MGHA 2R5WA 1OAKA 3GRUA 4AMYA 1FFEA 2OXCA 2TMDA 4FGLA 4ZXFA 3HBAA 5J3OA 5TXGA 1ADBA 3P9KA 3WMWA 4UBLA 3GN2A 1SK9A 4WZAA 5LQRA 1CJTC 4QBFA 2Z8XA 2EG5A 4MQBA 2HK9A 4PLTA 1VJ0A 3ISTA 1C9MA 2QRMA 3VNSA 5HVNA 1MC4A 1RYMA 3S2YA 3HCCA 3LY9A 2NAFA 1DBRA 4ZYYA 5CLIA 10MHA 4BVEA 5DRTA 1IZYA 4RQBA 1E9VA 4DAOA 3IHKA 3EFOB 1TD1A 5AI8A 4RTPA 2H4WA 1VYUA 4NAHA 4Y0NA 1KI2A 1EP1B 3O2NA 3S81A 1L7VC 3DM9B 1JG1A 5DYIA 1V16A 5AFSA 2XBLA 3RADC 3IRUA 4N5IX 3UY4A 1NW4A 2A57A 2ATVA 4IOMA 3AJ8A 1XJ0A 2XUQA 1HYQA 4MP6A 2BM1A 5P21A 1Z6QA 3LWDA 1MCZA 3PEUA 1OH6A 4JA2A 3RHZA 1K8RA 1TM1E 2AI1A 5CG2A 1IDN1 3MMZA 2P0EA 1PR5A 3KLMX 1PQWA 1U0EA 1TTQB 1K66A 2UXDB 1U5AA 2BGGA 5I01A 2C2MA 2FLVA 2NVOA 2PUCA 4J7AA 3L0ZA 2GMWA 2OZLA 1FVOA 3A1EA 3FWKA 1P4HA 1HNNA 3ASSA 2FG6C 5F7ZA 5A06A 1J6UA 2AG0A 1UOEA 3O3MB 1Q50A 1TJ5A 4W1QA 2ZTUA 2C20A 3L8HA 5JYCA 1KZHA 4ZEWA 4FI3F 4XCQA 4WNYA 2IYOA 2BLLA 2X86A 5MHTA 1N2EA 3U3KA 4NJOA 3TQRA 4XX0A 1XCJA 5LQCA 5KJCA 4KGVA 1W1UA 2WJVA 2R7LA 1DEXA 3NT5A 4NNOA 4JXKA 4V0KA 3RARA 3PT5A 1HFJA 4FR5A 1KO8A 1A71A 2D2XA 2AOWA 1P91A 4NARA 4OHYA 2PKRA 2BFEB 2P27A 1MUUA 3K05A 1U04A 4GXNA 2DQZA 4GSYA 1H0HA 3BIWA 3GLIA 1FRVA 1WPXA 2LTAA 2FCRA 3CLRC 3F5QA 4EM6A 2W8ZA 3TRFA 1CY4A 1K5DA 1TM2A 4AJHA 5TQ2A 1LZKA 1Z18A 4REMA 1DWUA 4KFTA 3OMXA 3VGPA 3W9BA 4EQ6B 5FTJA 1J8QA 3WIUA 1MFZA 1LU9A 1UPXA 4OHBA 1I4LD 2HEIA 2DH6A 2VRWA 2BCJQ 5H0IA 2JJ2D 3EBLA 3EW7A 1RTKA 3PFHA 3I12A 4DUGA 1BMDA 4IYRA 3VZQA 3E4DA 2CMFA 4I50A 2V7TA 3KCQA 1X7YA 3AR4A 3SEJA 4N8SA 3CPXA 4GZLA 3HE3A 4IGEA 3T99A 4KSBA 1SH7A 2CBGA 4RD4A 3JQFA 3OQBA 3IOYA 4QTZA 4WNCA 4UZSA 1WCIB 1PSWA 1XXLA 3FUVA 1SC9A 2PKWA 4TUYB 3KVYA 1GUFA 4ZJYA 2OXEA 3D0RA 5IULC 4ZT6A 1JA9A 4NCXA 5ALTA 5KYYB 4L9RA 3SVTA 1J49A 3QLVC 4AZ0A 3BHJA 1TC2A 3PUVA 4RJIA 4B81A 2ZIXA 2BJVA 1YS4A 1DC5A 3DHEA 1EFCA 5G02A 4LGMA 5A02A 1DC3A 1GAQA 2XMRA 4WA8A 3TPZA 3TK1A 3EPHA 3PD0A 3GLHB 1GAEO 1DHRA 1U1DA 2HSEA 1C1XB 3HBNA 3IXMA 1SBYA 4I2VA 4LHZA 4YWHA 1YJ9B 2MIIA 3D6JA 1DLJA 4LBWA 1A9RA 4V0OA 4F4DA 1TM7E 1X1AA 3W5VA 2K7ZA 3EX7C 1JW9B 2TMGA 2V3VA 4GE0A 1DRVA 1TPYA 2WSMA 4WK0B 1JQEA 1VE7A 2G4VA 1AKQA 3I56B 3EZ6A 4I08A 4RX1A 2X8JA 3TLEA 9MHTA 1Y8RB 4HVAA 4MYCA 5HIKA 3W5JA 1XWFA 5C8YB 2EHDA 4W8HA 1ZKDA 3CNNA 1QRDA 5JNTA 5ECYA 2FWAA 1BHJA 4F0JA 4QT4A 4IICA 2YZMA 4YJFA 1GPH1 2E1RA 3O94A 1PWYE 3V1NA 5I7RA 4URWR 1TQ4A 3N8KA 1SOVA 1CUBA 1HYHA 2IDZA 3FCXA 3FGOA 3FWYA 5AD1A 3E1KA 1P5ZB 1XXHE 3B2QA 3DMDA 2HHLA 3HYSA 1P73A 2IIPA 1VPLA 1SJ9A 3TBHA 1LY1A 2XGSA 1RLOA 1WULS 3GDGA 5AHRA 3I39X 2IF2A 3TLMA 1V1JA 4NCNA 1SBHA 4YRMA 3GFBA 3W2FA 5F1PA 3H8VA 4RA9A 1Z2OX 1NUAA 4TL8A 4H2DA 2YRXA 3QTBA 1ZRSA 3GFVA 3KFXA 1EU1A 2I3AA 4PC6A 1IHMA 2R25B 4UNQA 3F1KA 1T2FA 4GYYA 3TMKA 4M1EA 5EWMA 5AJHA 2WJ6A 4BECA 3QEOA 1E8MA 1E8DA 1SU6A 3EVBA 2YIDA 3CISA 3EPRA 3UK6A 3VC1A 3LAWA 3CC7B 5DF1A 4BX3A 3ZE1B 1A5AB 2DG2A 3QSGA 3CUUA 2YOHA 3CCRB 2VH5R 3L8MA 1ZIOA 5DM1A 4I1YA 2X76A 1UBUS 2XTJA 2W98A 1V41E 1EG7A 4H77A 4PQRA 5KQSA 1AXGA 2Q2QA 3CVOA 3R6DA 2WVHA 3CRMA 2HUPA 2G0NA 2ZREA 3DUFA 2ZAGA 5C8ZA 1U6IA 1KIAA 3H1AA 4JLVA 5JXGA 3VKGA 2F1LA 3N2NA 3MJVA 3LC1O 3MRVA 2HV9A 4MLCA 3UKJA 1ZEMA 2NP6A 1KIMA 1VE6A 1OGYA 2PR7A 2RG7A 1GVHA 1TTTA 3PC4A 5G3ZA 2EQBA 4AF6A 1N9KA 3SHQA 4EHIA 2PYIA 2ATCA 4KIGA 2FR8A 3CKKA 2Z6BD 2ZJ1A 2C94A 3I73A 1H4VB 2NO1A 2E85A 2D1RA 5EFOA 3OT1A 2DPYA 3QEMA 4TUYA 2YWEA 4Y2QA 1QGUB 3IE0A 5P8WA 4YRKA 4OHCA 1BE6A 3BWDD 3QF4B 5KNDD 3IDFA 3FPEA 4LZNA 1Y5RA 4F1JA 3AO0B 4LVOA 3PXBA 2ZUTA 1EMDA 3T95A 4HTAA 3LG2A 2R7AA 4WZBB 1JIQA 2PU5A 2ZJBA 3AR7A 3I5MA 2VP0A 5E4FA 4ARZB 4LHYA 2AJTA 1V6AA 2V0NA 3MGKA 4EAAA 3B8HA 3BA6A 2I2XB 5CDFE 1BRMA 4C21A 4NABA 2OCLA 3WK7A 2JARA 4G5XA 5KC9A 1T0BA 1FQKA 4TX1A 1TYZA 1OUMA 5T3UA 2ZUBA 4BJ5A 3HKDA 4MULA 1F14A 3CLTC 4GZ5A 3N8DA 3UGQA 4XEUA 4DWJA 3G89A 3B70A 3WDMA 1EA7A 1EWKA 1WSRA 1GQQA 1SVMA 3PEWA 4CM9A 3E18A 1PK9A 4QIHA 2Q6KA 3IESA 3JD3A 2G17A 1KD1D 4C2AA 3CCSB 1E5QA 1JEAA 5IYZF 9ABPA 2I4TA 3ZDZB 4EPYA 3AEQA 4YXWD 2NM0A 2QUAA 5EMKA 4J0HA 5KNDH 1OIWA 2CHQA 1UODA 1D6JA 3L6EA 3BSYA 1NSFA 3I42A 2XLCA 4LF6B 2K87A 4RF4A 3PUMA 1JSCA 1U7HA 3LBHA 2VBGA 3A0UA 3SI7A 5EWJA 1RLUA 3F9RA 3QV1A 2R2GA 3C85A 3EGOA 2JBAB 2AQ8A 1QVZA 2YOFA 1M7HA 4PIPA 3NX4A 5EKXA 3M3DA 2P5SA 2DT5A 3LQEA 3QWFA 2Z2XA 4J2HA 3WADA 2IWRA 4E2ZA 3IT1A 2FSVA 3M0EA 4KVFA 5C80A 1P9WA 3BFVA 4TYYA 2CVOA 4TZ6A 3D8RA 3IO5A 3OLQA 3PHGA 3WLAA 1ZN9A 4YRSA 1EFAA 1HA3A 4CMJA 3HVJA 2LKCA 4RGYA 3M6FA 1V11A 1X7ZB 5KNCD 1M1ZA 4ZEOA 2YC2C 1W6UA 1L9XA 1Y4AE 2NO7A 5G4KA 5B4VA 3PXUA 5B64A 3LUJA 2BGMA 1WD5A 4RIEA 5F1YA 3T5GA 4E88A 2DZDA 1XAJA 4MI9A 4ZGQB 3R0JA 1TT5B 4DIKA 1SURA 5B1YA 5CCBA 1G20B 4BATA 3KQSA 2B92A 2DTXA 3BVPA 4Z9FA 5J5VA 1PKEA 1XJWA 1JMVA 2Q0SA 3UJCA 4KZPA 2QP3A 5BN3A 3IUBA 5KNBA 3GP3A 3O8DA 3RRYA 4NJEA 4WCFB 4Q12A 2WLTA 4D4JA 4G86A 1M8KA 4YMGA 1ADFA 3VSAA 1P6UA 5EFZA 4K28A 4YUAA 3N7TA 3SVLA 2UVQA 3T7CA 3GLFA 4CMKA 2AD5A 3PU6A 3SOPA 5M29A 1I1NA 1WV1A 3BERA 3COSA 3GVCA 2JJ2A 2LVBA 3G4SB 2X8AA 4I5FA 4DUGD 2A4KA 2ZTVA 3DZFA 3ESCA 4IIYA 1XD8A 1GUDA 5FA6A 5A3JA 2ZBGA 5K4GA 1CF4A 5FWNA 3ED5A 4NYIR 4GZMA 4DUPA 3AFOA 1E3XA 3MUOA 4FFVA 1PZFA 4M9XA 3LUCA 2X5JO 3TW8B 5KHAA 5IHXA 1OWPA 1G6KA 5LOVF 4PAAA 1YZYA 2H4XA 5BT8A 5ELLA 1KYQA 1PGOA 2RHMA 1IXSB 2OR3A 2R6FA 1TCAA 4J7XA 2GO1A 2PX5A 2WVAA 2EVWX 3L7IA 3AIOA 4WA7A 4WKBA 3U49A 3SYMA 4UHBA 4DPLA 5IJXA 4BWGA 1U4NA 3V4FA 1LNSA 2V3WA 3BCDA 1SVLA 2GO7A 1YITB 3N2LA 4MRMB 4RV5A 3PQ6A 3RYTC 3SP1A 2I1QA 2YMQA 3O8NA 4J75A 4X3PA 1HDEA 5AUQA 2HRZA 1LD3A 4ZT4A 4MP8A 4ZGNB 1RP1A 5FL7D 2IUEA 2REXB 4RDHA 3U4AA 3ND5A 1U8XX 1YR2A 5JATA 3MJSA 3VI4B 2IUSA 5HZGA 3DMPA 2FOLA 4IHJA 2WI8A 3OU2A 5E9AA 5KVQA 3H16A 5CNIA 5BYJA 5JV5A 1OV6A 1SPXA 3T38A 5KNCA 1QQBA 2BELA 2PH7A 1O0BA 4GSLA 4X1IA 4C08A 2I8LA 1AUOA 4EB3A 1N2CA 4MKFA 4HGRA 2OO7A 4ARCA 3NOXA 5LD2B 1N92A 2VA8A 2AN9A 3NV7A 3OCXA 4HQLA 4KQMA 3TM4A 5BVGB 3H97A 4WLFA 5A3RA 3GLFB 4CR8A 2ZIXB 5BV7A 2D5AA 1G3IA 3SX2A 4J94A 5FNVF 1QO0D 2BGNA 3MWDB 2FPGB 5EMJA 3GNQA 3V8BA 1F20A 5F23A 4BY9E 3HM9A 2M1XA 3MRXA 3NNNA 4OOFA 2I1WA 3CVXA 3EC2A 1OLSA 4MR8B 5FX2A 1I30A 2QXTA 1N77A 2LWIA 5KC8A 4JB3A 4E51A 4KGDA 2JIQA 1W581 2PRJA 3UHFA 3X1KA 4BYGA 2CLEB 1T8RA 4LWOA 1F8GA 1GL3A 1DNPA 2PX8A 3R0QA 4HAIA 3QU5A 4U5QA 2Q3LA 1ZNWA 2WF6A 3CPEA 5E9QA 2QU8A 4NMXB 3WHKA 4JDPA 2EKQA 2N3ZA 1U80A 4QBKA 4UZFA 5TQ0A 2O3SA 2Y0DA 1KQPA 3VC2A 4N39A 2GAOA 3I2HA 3I6YA 5AKIA 1FX0B 1P1BA 1OCEA 1UXOA 3EJ6A 3RG8A 1U0JA 2VHZA 3QVTA 5ETJA 4YCAA 5SV2A 1XDZA 2QLFA 2ZBDA 4XQFA 5ER6A 4EOGA 4CBVA 1GWNA 5HJEA 5HTKA 1NKSA 3ONEA 4HPWA 3NM6B 4NOMA 1QGAA 2Z2YA 1HT1E 4AIIA 3PITA 1J0BA 2F3UA 1DQZA 2G1AA 3VPAA 5GMOA 5IEJA 1JYEA 3RWMB 3HEMA 1VBNA 2ABWA 1NQTA 1LBTA 3O2JA 3T53B 1VQMB 3DL2A 3OPNA 4PVCA 1L5OA 1M2GA 3N7UA 2QTRA 3ZCSA 2QAGC 3NHZA 3AVYA 1EAYA 2NVWA 1Y33E 2WE8A 4ZO7A 2C2XA 1YJNB 4EPRA 2IUFA 2R00A 2BHRA 4L08A 2IFTA 1ZUIA 4HDKB 5EA2A 2ID7A 3TUIC 4G5OA 4FJ2A 1DV2A 3TYXA 4B3DA 3BSFA 4DY6A 1ORVA 4FN5A 4FDUA 1F7UA 4CMHA 2PZAA 3A9TA 1C0KA 1RZ3A 3SZLA 4CG1A 3M1LA 3IQEA 4RL6A 3SS7X 2QRQA 4E5VA 5J3JA 4F2WA 1O4WA 2XGMA 4QYSA 1U2DA 3I72A 3VHQA 1RXSA 1NBMA 1Y5NA 4URVR 3CRW1 2ZIWB 1QTNA 2GM3A 3B9RA 3ROFA 4CTOA 3AJEA 2AHOA 1X9IA 4EDHA 3CU5A 1VLQA 2HAEA 2NQ8A 4KPGA 5A04A 4RTKA 4YJDA 4CIAA 3ZX5A 2DKNA 4CODB 4DSAA 1A98A 3JWPA 4GD3Q 5CDHA 1ZXXA 4Z8YA 1KHTA 3TS1A 3TIIA 1BA2A 4NENB 1F2VA 1ZFNA 3ORRA 2NQ2C 2ZVQX 5EIWA 2ZW9A 3MIZA 1G6OA 1NSTA 3VR1A 5KYXB 4DV0B 1ZSNA 3ZD9A 1K89A 2J08A 2ZE6A 1DT3A 1I3OA 1PR2A 2WT4A 1LW7A 3A1DA 3A36A 3GUVA 3HRIA 4CMIA 5BV8A 3PA8A 3M6LA 4NZ9A 1T4GA 3COWA 3HV2A 1HRKA 4B6OA 2OGUA 2ETVA 2ADOA 3UOWA 5CBKA 2KJQA 1HZJA 3NYRA 2UZ3A 4F2GA 4FLEA 1LA2A 1B93A 3CMAB 2WB4A 1JDUA 1EVEA 3I2IA 4Z9YA 2OG2A 4OFWA 1IMOA 1XMQB 2BTQB 1R18A 2HDHA 3KUUA 1NLUA 2J5BA 4QDUA 3FTEA 5PGMA 1S4MA 1E7MA 1Y8CA 1ZR2A 1OFVA 2XYRA 2ZQZA 3BQMB 3L7OA 1GLGA 3TZKA 3FBTA 3GUUA 1KH2A 1WQ3A 2IEDA 3CEAA 2ZBVA 1YZGA 2HQ1A 1EFRA 2CUNA 3IS3A 3OJ0A 3PPVA 3I2GA 4Q6BA 4S0ZA 3E1SA 3JPYA 2OEPA 5INTA 5IDXA 2ZL7A 2BAGA 4LJKA 3ZY2A 1V5VA 1IY0A 3EEFA 3NASA 3I8XA 3X3HA 4QKQA 1NVWQ 2ZPUA 1QSGA 2OILA 3KL2A 3CRRA 4BC0A 2B8NA 4CKWB 1THMA 3EQZA 3QYAA 4U2GA 1T1GA 2PT7A 3YASA 1YZ3A 1ZPDA 3I5AA 5FFFA 1T5HX 3F8TA 1F4PA 4GR9A 2VCYA 3MBOA 2BHSA 2HIHA 2RGRA 1R7RA 1UDAA 3A37A 3I1IA 1VCOA 1TLFA 3QGMA 5EIFA 5T6MA 3AILA 1TO1E 3JVUA 3FCSB 3G79A 3JR3A 3KV1A 4W1SA 2X9QA 1VTKA 3ZYCA 4B9AA 3VNQA 3DTYA 5SZHB 3KUXA 2W11A 1XJ5A 2FZWA 3ADOA 1ZM9A 4WTOA 1JIXA 2M1ZA 3WL3A 4QRIA 2ZTSA 5FOQA 2Y1OA 5CA0A 2WWHA 1G5TA 4H31A 1SKMA 2XH8A 3NVMB 3DOIA 1PEAA 4PPNA 1ZI6A 4TKUB 3A1CA 4OK6A 1SOMA 3AB8A 4L57A 1ZVJA 2HA2A 3FOWA 2DOGA 5CM9C 1R9JA 3LPAA 3GFSA 4KHZA 3RJZA 3RIXA 1KFJB 1YCDA 1ZICA 5EP3A 3MT8A 6CHYA 1JQJC 5HJ7A 1E4EA 4ND4A 5ALIA 5A6VA 4HRXA 1NJGA 3KYDA 4W7HA 3OBIA 3GJZA 2CJYA 1CIJA 3O8OB 4ATNA 2Q07A 3KBBA 4E15A 5IM4A 2QT1A 3DBLA 1FFSA 3A6KA 1M67A 3QE0A 2GK3A 4Q0MA 4KX3A 4TM8A 1XZIA 2AEMA 2R65A 3KOYA 3M83A 1ZQ1A 4RIIA 1N8SA 4NP6A 1I7SB 4TOIA 2GUWA 1R1DA 4O3FA 3TIXB 2XY4A 1ISRA 1PR3A 4P7GA 5CH8A 2D5LA 4ZVSA 4ZOEA 1FYFA 2PDAA 3AI7A 4L8FA 4S1PA 4KQHA 3P20A 4R31A 1PD1A 2PL1A 2CFIA 1QDUA 3IAS1 4O4LF 1Q0QA 2VSXA 3R9WA 2PZEA 3HMKA 3KJEA 5GONF 2ZSIA 1E92A 1WEKA 5A71A 4ARZA 3EWSA 1H3FA 1E79D 2AN4A 3DAGA 2PH5A 1EGMB 4KYUA 1NPTO 3FETA 5KSZA 1T5LA 2OUIA 1ZOLA 1D6NA 4POAA 3MCAA 1VSBA 2VK1A 4JOQA 3AFGA 4R2KA 4QZVA 3UFBA 4BO5A 5IN5A 4YR9A 4IKOA 5IJWA 1C4XA 4CEIB 5A7FA 2BCGY 4EJ2A 1V7PC 2P3LA 2QXUA 1ZN2A 5I7FA 1U7OA 2VLBA 1H2RS 2RHOA 4QUKA 5ALQA 5DP1A 3G5MA 4EUKA 4BYMA 4Q4DA 3HNOA 4JITA 3WKAA 3PNMA 4IDDA 4P82A 4D97A 3BHIA 3R40A 2WBLC 2YDXA 2CHGA 5K99A 2AQHA 4BL5A 1GYQA 1JEYA 3W5UA 1BHO1 1TX4B 1XMXA 1ECGA 3MTDA 2J3JA 2YWXA 4D57A 1NRXA 1QP7A 4OPMA 4CT0A 1W5TA 3NC0C 3GCXA 3ON5A 3K9NA 5EN4A 3LWNA 4X65B 2VBTA 1KEUA 1M6EX 2QE6A 1JHQA 3AKDA 5DTJA 3SS8A 4J4TA 2O8BB 1I24A 1G9SA 5ILGA 1QOQB 2AZMA 4QPNA 3AF1A 2OD9A 3DONA 4XARA 1RTTA 2QG6A 4YI3A 4JT4A 3ICEA 4QOJA 2E1PA 1Q81D 1RM3A 4I3GA 4DR7B 1Y7TA 3TNJA 2D6FA 5KZMB 4FLMA 2JHAA 2AOXA 4MITA 5GONA 2AL7A 3SF0A 1IY2A 1RRCA 4U8HA 3PEFA 3UA3A 1W2GA 2AR7A 4P93A 1T5EA 4Q16A 2QDXA 3L7MA 4BNMA 4EY8A 3IE1A 2BKXA 3BQ9A 1MG0A 3AHCA 1XXHB 1ELOA 4KPFC 4HN2A 4UOQA 2NT4A 2E55A 3KSMA 4MRMA 4N7MA 2GBIA 2M6LA 2QTBA 4Z4GA 4L15A 1H2EA 1SZPA 4QNNA 1U98A 4J2TA 2VDNB 5FCDA 4QM6A 1DKQA 4TWAA 5FPQA 5DCUA 4YR7A 1OA1A 1R6BX 1SQ0A 1I4DD 3FY4A 3MPUA 4JLSA 1UWLA 3FYTA 1YQTA 3C74A 5JC8A 2L19A 4HLCA 2YN0A 1XYVA 2WTAA 4I55F 1GZ5A 1UPUA 3DMNA 3G7UA 4DQ0A 4J6FA 2GOYA 1E20A 1C1DA 4JYPA 2AEFA 1FTNA 3RAGA 4QGBA 1IQ0A 4Q7MB 1UINA 2AK3A 4FGUA 2KS6A 3G9XA 5BOVA 3V4LA 2X6RA 2IOFA 3GVIA 1AH2A 3C6QA 3VBEA 2FH5B 4C5AA 2GWRA 1A1VA 1BA3A 5JLJA 1KTVA 1E1LA 2OSBA 4RSHA 4YDRA 2C78A 3KTOA 2DE0X 4DG8A 2GKSA 4PG8A 1V5EA 2B35A 3G2LA 4LSWA 1NBMD 1QH8A 5E0KB 1M6YA 5LMNB 2H4FA 5K0ZA 4HVCA 4NU0A 1A2QA 3NWEA 5SZJA 3SJAA 3PDIA 1ND5A 1WR8A 4I4TB 3RFXA 3ZY3A 7ADHA 1EVYA 4HSGA 1ONOA 3GJTA 4AI6A 1WPQA 4M6WA 1KMHA 2IJGX 4KO1S 3QHAA 4MUNA 5TVGA 4BO6A 4DCTA 2OP0A 4CGZA 3E9YA 4EA9A 1EXDA 3KZMA 4XM3A 1JAZA 5EUCA 1SXHA 4LG1A 2HXGA 2BH2A 4K0RA 1HFKA 4YI5A 4CLHA 1WB4A 5FUQA 4H08A 4M1WA 3S8YA 2GCOB 5DT2A 1KC8D 5HSGA 2FOIA 2V3CC 2OBFA 1QORA 5K3FA 4TXLA 4DPKA 1T2VA 3G2NA 3MEQA 3WAKA 2C4MA 2QTZA 1X7YB 1J0AA 4JFAA 4H9GA 3G9TA 4AYWA 4CM4B 5L95A 1BVUA 4TQAA 4AB1A 1WP6A 4J0CA 4R9NA 4GLOA 3GMSA 3ZDFA 4DTIA 3A3BA 1G8AA 1V3VA 3JALB 3KB6A 3CTAA 3WWYA 2C58A 2GREA 5FQOA 4II3A 4ZPJA 1KYXA 2JS7A 5A3VA 3Q8LA 3HABA 3GJSA 4R84A 4BLTA 3T7KA 1GZ4A 1G20E 2QROA 3FVWA 3NIBA 4L3WA 2Q6TA 2C4TA 1WU7A 1PNVA 3GAFA 5CHYA 1ZJ5A 1NX6A 1Z2CA 3VMFA 1MVOA 1EYZA 2ZDQA 3G82C 2Q0HA 1VA4A 4I4CA 1YDFA 4R3NA 2WMNB 4XA8A 5DI3B 5TGZA 1NLYA 2REBA 3PXGA 4JX8A 2UDPA 4N5LA 2OL4A 1PJRA 2AV6A 2Q9BA 2ZRKA 1TI7A 2QD2A 4OHFA 4TTPA 4XM1A 1L5SA 2Q28A 3OQPA 4HH0A 5AHWA 2DT8A 2R4TA 4FYKA 5DX8A 4J76A 5IH7A 3A8TA 5TMPA 4TZ0A 2PSFA 1YRHA 3GQVA 3K0FB 5A0TA 4FEAA 1AF7A 1VI5A 1KMHB 1T15A 2GCNA 1ADCA 1F2UB 4K9KA 4LOKA 3GNLA 2XT6A 4B7ZA 2C07A 2C59A 3PDIB 4PG4A 1MEOA 1ZCZA 3UW3A 3E9CA 3UICA 1JQ3A 1CS0B 2V45A 1I5OA 1E69A 4H27A 1EUCB 2ZULA 3D2AA 3P9ZA 2OFFA 4FFSA 3HN7A 3DLIA 1ZMTA 3MWFA 3QOYA 1YUNA 4OA8A 4D56A 3QH4A 1R0YA 4C3ZA 3V00A 1VM6A 1Z7WA 2XIJA 2QLMA 1UP6A 2H59A 2AW3A 5EKSA 1KFBB 3HKEB 1VDZA 4EX6A 1NQXA 1R3DA 1L7AA 5ARCA 5DOVA 4UE2A 4XUGB 4P3OA 4YROA 4HTFA 4G5FA 1W29A 3DEJA 4XASA 1V2GA 5EWLB 5G1OA 4WECA 5JYEA 2NZ8A 3AXTA 4PC2A 2Y93A 1MB0A 3HHEA 1N2GA 4LJ6A 2SECE 1J2TA 4D4LA 2G71A 2OCIA 4HATA 4G7XA 4QVAA 3VR3A 1FYDA 1NLFA 2M6RA 4E22A 1EZ4A 4KNVA 3CPJB 3TEMA 4CG3A 3SZRA 3A70A 1OYVA 4K8OA 4GOJA 5K0EA 1JAIA 1YULA 3GPCA 2UUOA 5GJBA 3PUNA 4RTOA 1PSZA 4HQKA 3LMKA 3DA8A 3KYBA 3IAXA 3PSAA 5IZCC 5HKKD 1KQSB 3QKSA 3DYVA 4QODA 3S55A 4ARAA 4PVDA 3REOA 1USVA 1T9GR 1CUGA 1F2UA 1TAUA 4D80A 4IVPA 1XZMA 2B1JA 1UDBA 1DBVO 2C2OA 1WORA 3D3EA 4KZKA 4P2BA 4N3CA 3NWOA 4RUKA 1V26A 4TRMA 5DXJA 3W1WA 2IYNA 1L6RA 2WD8A 2ZVPX 2Q45A 4OATA 5KTKA 1MTOA 5AKJA 1LBSA 1EK2A 5CFOA 1VL5A 1NB9A 3PFNA 5BYAA 5SZKB 1RWPA 2JB9A 4YCJA 2KBEA 5JY1A 4UTXA 2N46A 2W93A 4TS1A 1FFCA 2PPLA 1YHNA 2W2XA 4Z4VA 1H4SA 1WSDA 1HNXB 2XADA 1BIFA 1RAAA 1MW9X 2ZATA 3ZWOA 3N0XA 3SIWA 3UQZA 1P1FA 5ALOA 2PIAA 3AKCA 2XOKD 4MHTA 1QMGA 5IXSA 5K3AA 3F47A 1N2CB 4QC2A 5JYBA 5E1BA 3V8MA 1T4MA 5BV0A 3WB0A 3L9WA 1QHHB 9LDTA 1UBSB 3I04A 2CNLA 2NPFA 4BX8A 4G4SO 3C3CA 2H5LA 3V8NA 4BP8A 1FS5A 1GKYA 1CJUC 2H2FA 4E5SA 5IDVA 4PX9A 1EBFA 4F3NA 2HGSA 3BGWA 3STHA 2Q3EA 3FFBA 2H65A 3KHSA 4OXIA 4XFKA 3SKVA 2NV4A 1W76A 1WP9A 2X0DA 3C43A 4BX9A 1P72A 5C7YA 1LGYA 3ND9A 3VO8A 1PFGA 4EK9A 4Z7QB 1M34A 3B6ZA 5HQJA 3MMXA 4CCYB 2BEVB 4RLFA 4MI1A 3ROZA 2F1IA 1YI2B 2QP4A 1OFTA 2JI6A 3HB9A 4G1CA 4X5OA 3VSDA 2I91A 2PR2A 3WGMA 2UYHA 4RZQA 4N5NA 1Z0UA 4NOLA 3FZYA 3ETCA 4E12A 1QIFA 3OIGA 1WDKA 2GR9A 1GZVA 4KNYA 1P6XA 4XDZA 4MMZB 4BKPA 1MV8A 1E4VA 3M6MD 4MRNA 2F43A 2R1TB 3E6AA 4KDFA 4RZSA 2NNLD 4TV9F 4CLOA 4GDFA 4FFOA 4N3BA 3IEUA 1RYYA 3RS8A 4YBRA 1P8AA 4C7OA 5IABA 4G41A 1QZTA 1GTVA 3CLRD 2OHJA 4B82A 2WSIA 5B3JC 3NPAA 3PGVA 1MC5A 2Q8NA 621PA 1TEHA 5FYDA 2DBVO 5LYJB 4DCNA 3JVIA 2R47A 2QS9A 3OIUA 1ESMA 3D3WA 1EFHA 1AE1A 1CQIB 2IW1A 1QC5B 2TMKA 3GO4A 2YBEA 3KFLA 5HF6A 3TAHA 2ZXHA 4HYEA 2WIKA 4O6VA 4HCJA 3TOSA 3L04A 5ADWA 5B7QA 5I7UA 3EN0A 2FRDA 3IIEA 4Z4EA 2FXVA 3PF8A 4EH1A 1B8UA 2QL5A 1SUDA 1OXXK 1BWPA 3ONNA 2Z09A 5K0SA 2QTWB 5I7EA 1VQ6B 1GZUA 2LDXA 3KLBA 4DR4B 3I30X 3IOCA 1MB2A 3A35A 4GH5A 3RRNA 4J0GA 3L3BA 4NHEA 2XCSB 1ETHA 2PCLA 4PLFA 1WL8A 4NFLA 1IBSA 2VAPA 4G84A 1EDEA 4FP9A 5J63A 3TE7A 1DDGA 1CU1A 1RWOA 3FAZA 1X14A 2ISQA 3LYLA 3TD6A 3V8PA 2GHIA 5U9CA 3QHPA 4Q7JB 3L8CA 5EP1A 4ZDWA 3ADBA 1FC0A 4RLQA 3C5WP 1XD2B 4IWXA 4BVBA 4TWBA 5D01A 2ZJ8A 4E1AA 2Y4NA 2Q7OE 1ORRA 1JB1A 4KN8A 4PXAA 2ODAA 5DYGA 2FVYA 1ATZA 1NBAA 5FUWA 2F43B 2ORYA 2R1TA 2HOQA 1AKWA 2VKTA 2VAWA 3GUZA 3L06A 1CDZA 1C3XA 2O0LA 1X7GA 2R97A 3FNQA 3PP8A 4IJ6A 4OU5A 1MO4A 1Q17A 4KWTA 1NRKA 1OVGA 4KIWA 4KQIA 3ABRB 5K8JB 2HPAA 2R62A 2PD6A 3P1JA 3KDAA 2WM9B 1UEXC 3AY3A 4EX7A 4LNUB 4WN3A 1L4EA 3IAUA 4ZOAA 1ZBQA 2W83A 4UNPA 1WKBA 3DO5A 1QFZA 1EWYA 1JILA 3G9UA 1XDDA 2JFNA 4J16C 5CW2A 3TPFA 1XTPA 3UWPA 2DLDA 1E1CB 3ZG6A 4UPEA 3ZBUA 1L8AA 2M9MA 4KYVA 5CVDA 4MGEA 3CNOA 1LRJA 1QHIA 1FYXA 1RKQA 3GF4A 1HMPA 4PQEA 3RT9A 3GL9A 5KSPA 5BN3B 1IY9A 1OFUX 2CFSA 3TNDA 1O0CA 5KYKA 3K0CA 3VYVA 5HRCA 3S2UA 3ZNOA 1IBRA 3LXRA 3D4OA 2RB5A 4LOHA 2J5KA 4FNGA 2Z2IA 1MR3F 2QVXX 1QFXA 3HJTA 4URUR 1N6HA 1WZCA 1W93A 4WK4B 5SICE 3W34A 1W87A 1E2BA 3DFKA 1HT0A 3ZHBA 1ZYUA 2R8OA 3JAWB 1L7MA 2AD1A 3BMCA 1YS2X 3ABQB 2EW2A 1H69A 3ACBA 4U2DA 5K0CA 2AFRA 1ID8A 1FX1A 5KAPA 4GMKA 1PLKA 5EKUA 3QVLA 3KQQA 2XSZD 5LNK6 4H6WA 4NULA 5JLAA 3B9QA 1USKA 1ZM2A 2O7RA 3PQ5A 4YQEA 3FUXA 4L9SA 1R8QA 2Q2OA 1DIAA 3W3AD 3ZCTA 1ZGHA 3CX6A 5TT0A 121PA 1RHUA 5A9RA 1UQRA 2QPOA 4RY2A 3G8YA 4DA6A 5E7MA 2FFQA 1G2PA 1A72A 3B1KA 1OW3B 2GF9A 4NMLA 3FBWA 3K9WA 5B7PA 4N01A 2JIMA 1V4VA 1W7AA 3M5DA 3H9GA 1NU8A 3HC7A 3BE4A 3K96A 1CZUA 1HQCA 3L01A 2NUBA 5DDIP 3A06A 4YRBA 2BY4A 2QE7D 2WU0A 4N0PA 3A28A 4L5IA 2II6A 1D2CA 3CLHA 3FN4A 5JSYA 2VPIA 3T3MB 4DOMA 1KI7A 4X62B 5ISMA 4D4HA 2YQ4A 3KC2A 2UAGA 4HDSA 1RYNA 4RMHA 1QMPA 4BLSA 2PQMA 1MNAA 1YL5A 1BVHA 1U2PA 4HGZA 1C8LA 3Q40A 3OU7A 3AUUA 1R8XA 1AMNA 3SJZA 3A58B 4B5KA 3URKA 2XZDA 5F9MA 1XNRB 3L1JA 2WYRA 2VL7A 2WWWA 1X19A 3BHNA 3E7DA 4HWOA 4I5IA 5ITSA 3A9WA 1FFGA 3QOWA 1Y8AA 4DLZA 4MVXA 5IBRA 4E1VA 4NBWA 1QGOA 3WISA 5LXTF 2W42A 4RPDA 3SYNA 2RC6A 2AFVA 3HJHA 1IBLB 3WRVA 2Z1NA 4C03A 4J3JA 2XQFA 3SR0A 1SZCA 1NI3A 2GNOA 2Y92A 2GXQA 1GUAA 2XZPA 3WP0A 1E3ZA 2DWOA 4MV1A 3F5SA 4R8MA 3CG4A 1ZK4A 1Z3IX 2D7CA 1JKFA 2FZVA 1SXJA 5CYPA 2ZAIA 3ZNNA 2Q5FA 5JXWA 4TT3A 1UJNA 2ERYA 3AESA 3GCZA 2IIBA 4GFDA 1X92A 3SXPA 3MWDA 4PANA 2C92A 4X7PA 3BTOA 4DV3B 4DMFA 3GFGA 1M76A 1IRXA 3KYCA 1XWIA 1Z4LA 3W6PA 1RQXA 2BBSA 5H1YA 5AQ1A 3SPXA 1JHPA 3HVKA 4GRAA 2CLIB 4MINA 4EG5A 1XEAA 4E33A 2CVQA 1E5XA 2OHHA 2PFKA 4XYLA 1FYWA 3PIDA 2NUPB 3RIEA 2Y67A 4G0NA 4C0QC 4DRYA 3D6TB 4V0SA 1C9NA 1VCMA 5DLDA 3DO8A 3M82A 1SK8A 2BMFA 1MLDA 4Q66C 1L4KA 1WXIA 4A2CA 3AUFA 2PA3A 2GCEA 3KPWA 1G16A 1YA6A 5CLFA 3A7EA 1L5HA 5IKMA 5ARDA 2Z9DA 4GZ3A 4LE1A 3OTQA 4IINA 1NGSA 1EDDA 1P5RA 1CSEE 1WHTA 3KVRA 4WADA 4XR4A 3Q6IA 1DAMA 3PA6A 4U2EA 4B2YA 1B1CA 3DD1A 2WKPA 4MRAA 2HLDD 4RV9A 5LLSA 3VPGA 5EXTA 1QU3A 2ZBEA 3CHYA 4YMWA 1E1RD 3V4OA 1QIGA 5IKXA 3PLAE 3I9LA 1ZD4A 3THSA 3QKUA 4NNPA 4YMTA 2HF9A 3S1LA 2RGWA 3Q3IA 1E5DA 3B5IA 1ZIYA 2ZYRA 2X6QA 3NCHA 5FFNA 4CL2A 1PG0A 1Z0IA 1QJ4A 1LRLA 3QPAA 1SCBA 3G2JA 3KIPA 1BFDA 5DU2A 4EUEA 3ILHA 2BM9A 4D6XA 3CN9A 2JFQA 4U0KA 4D9MA 3QIAA 4X06A 4XWWA 5HUQA 1T3LA 1T6BY 2BMAA 4G1UC 1HR0B 1ODSA 5DCWA 4CMBA 2A9VA 4WCFC 2PWYA 4L27A 3IV7A 2EW1A 1VQ7B 5TPZA 3UATA 2I8AA 5KHLB 2JLSA 3RSOA 1MX5A 3Q3CA 3R9XB 4XR9A 2Y76A 5DHAA 1GYRA 1Q1BA 2QZ9A 1YMQA 2YICA 2L42A 1JKJB 4P81A 1CZRA 4QOFA 4RV4A 1Q7BA 1TW3A 3ZJ5A 3KPYA 1E63A 5DIZA 4MUKA 3NT4A 1E4OA 3PQDA 1BXRA 3QPDA 4NMWA 3TTYA 4EO7A 3CUYA 3STTA 4Q9NA 3WRWA 4X20B 1N5IA 3ETGA 3AGQA 3I8SA 2QM3A 1VQKB 1LTQA 1D2AA 2JAOA 4ENSA 3H2HA 3MGCA 4Y8VA