The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
4
|
sequence length |
48
|
structure length |
48
|
Chain Sequence |
GSAMGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural protein
|
molecule keywords |
Hepatocyte growth factor receptor
|
publication title |
Insights into function of PSI domains from structure of the Met receptor PSI domain.
pubmed doi rcsb |
source organism |
Homo sapiens
|
total genus |
4
|
structure length |
48
|
sequence length |
48
|
ec nomenclature |
ec
2.7.10.1: Receptor protein-tyrosine kinase. |
pdb deposition date | 2004-03-24 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01437 | PSI | Plexin repeat |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | ligand-binding face of the semaphorins, domain 2 | ligand-binding face of the semaphorins, domain 2 |
#chains in the Genus database with same CATH superfamily 2VDM B; 1OLZ A; 2VDN B; 3AFC A; 4O3T B; 1SSL A; 4UM9 D; 3VI4 B; 4FWW A; 3ZE2 B; 2VC2 B; 2VDL B; 3OL2 B; 1YUK A; 4WJK B; 3T3P B; 2P26 A; 2VDK B; 1U8C B; 3ZE1 B; 4Z7N B; 3FCU B; 3AL8 B; 2UZY B; 3OL2 A; 3ZDZ B; 1SHY B; 3ZE0 B; 4O3U B; 5E6U B; 3AL8 A; 4Z7Q B; 4WK0 B; 3NID B; 2VDO B; 3T3M B; 3NIG B; 4GZ8 A; 3NVQ A; 3VI3 B; 4K3J B; 5E6R B; 5E6S B; 5HDB B; 4UM8 B; 3OKY B; 3ZDY B; 2VDR B; 4WK2 B; 4WK4 B; 2P28 A; 2VDP B; 1TYE B; 2VDQ B; 3AL9 A; 3OKW A; 4UM9 B; 4Z7O B; 3NIF B; 3ZDX B; #chains in the Genus database with same CATH topology 2VDM B; 1OLZ A; 2VDN B; 3AFC A; 4O3T B; 1SSL A; 4UM9 D; 3VI4 B; 4FWW A; 3ZE2 B; 2VC2 B; 2VDL B; 3OL2 B; 1YUK A; 4WJK B; 3T3P B; 2P26 A; 2VDK B; 1U8C B; 2JWH A; 3ZE1 B; 4Z7N B; 3FCU B; 2JWG A; 2UZY B; 3AL8 B; 3OL2 A; 3ZDZ B; 1SHY B; 3ZE0 B; 4O3U B; 5E6U B; 3AL8 A; 4Z7Q B; 4WK0 B; 3NID B; 2VDO B; 3T3M B; 3NIG B; 4GZ8 A; 3NVQ A; 3VI3 B; 4K3J B; 5E6R B; 5E6S B; 5HDB B; 4UM8 B; 3OKY B; 3ZDY B; 2VDR B; 4WK2 B; 4WK4 B; 2P28 A; 2VDP B; 1TYE B; 2VDQ B; 3AL9 A; 3OKW A; 4UM9 B; 4Z7O B; 3NIF B; 3ZDX B; #chains in the Genus database with same CATH homology 2VDM B; 1OLZ A; 2VDN B; 3AFC A; 4O3T B; 1SSL A; 4UM9 D; 3VI4 B; 4FWW A; 3ZE2 B; 2VC2 B; 2VDL B; 3OL2 B; 1YUK A; 4WJK B; 3T3P B; 2P26 A; 2VDK B; 1U8C B; 2JWH A; 3ZE1 B; 4Z7N B; 3FCU B; 2JWG A; 2UZY B; 3AL8 B; 3OL2 A; 3ZDZ B; 1SHY B; 3ZE0 B; 4O3U B; 5E6U B; 3AL8 A; 4Z7Q B; 4WK0 B; 3NID B; 2VDO B; 3T3M B; 3NIG B; 4GZ8 A; 3NVQ A; 3VI3 B; 4K3J B; 5E6R B; 5E6S B; 5HDB B; 4UM8 B; 3OKY B; 3ZDY B; 2VDR B; 4WK2 B; 4WK4 B; 2P28 A; 2VDP B; 1TYE B; 2VDQ B; 3AL9 A; 3OKW A; 4UM9 B; 4Z7O B; 3NIF B; 3ZDX B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...