1SUSA

Crystal structure of alfalfa feruoyl coenzyme a 3-o-methyltransferase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
227
structure length
227
Chain Sequence
KSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVDHKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caffeoyl-CoA O-methyltransferase
publication title Crystal Structures of Alfalfa Caffeoyl Coenzyme A 3-O-Methyltransferase
pubmed doi rcsb
source organism Medicago sativa
molecule tags Transferase
total genus 80
structure length 227
sequence length 227
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.104: Caffeoyl-CoA O-methyltransferase.
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1susA00
3FTFA 2GS9A 3LDUA 2VP3A 5M5BA 3UJ7A 4YV1A 4X41A 2XBMA 2IDJA 4AUKA 2IFTA 5KQSA 4C04A 4YUZA 3VC2A 3M70A 3RODA 3V8VA 5GP1A 2AN4A 5FQOA 2IP2A 5FA5A 3HA3A 3IHTA 1PJZA 4RTSA 3K6RA 5DX8A 3SX0A 1ZHFA 4QDJA 5FULA 1AQIA 3WSTA 2V74B 4E30A 1X19A 5EPEA 3UJBA 1O9GA 3GRUA 2A14A 1QYRA 2FYTA 1P1BA 3TM4A 1IY9A 2CMHA 2G71A 5CVUA 5EIWA 5EMMA 3PFHA 1RI3A 5DTRA 1N2XA 5HILA 4PYQA 4EKGA 9MHTA 5DM2A 3M6XA 1F3LA 1WXWA 4BY9E 2FPOA 5HOQA 2DULA 3NJRA 4PYLA 1YFJA 3HM2A 5ICFA 5DXAA 1B42A 2ZLBA 3UJ6A 2PBFA 3IV6A 1T43A 3O4FA 5JR3A 3B5IA 4KVZA 2P35A 1G8SA 3UJ9A 4EKIA 5HZMA 1XDUA 3D2LA 3TLJA 3DLIA 2OB1A 4DZRA 2QRVB 4L7VA 4MWZA 5E8RA 4DQ0A 2NP6A 2F8LA 5T64A 3BXOA 4PYNA 4R6XA 4C4AA 4CTKA 3QOWA 3EVCA 5DM0A 3KPWA 3KQVA 1PRYA 3MAGA 3TRKA 2PY6A 3SVZA 3QOXA 5EG5A 3SSNA 4GOLD 3BWMA 1M6YA 2GLUA 4PGHA 1NKVA 3DXYA 4LWOA 2VDWA 4QPNA 4LG1A 2PT6A 1JQDA 2VS1A 4GF5A 2ONZA 1IXKA 4DM3A 5E8JA 1SKMA 4X1OA 4RTLA 4MHTA 1NW6A 2IGTA 2O07A 2DPMA 2ZZMA 2CMGA 4RX1A 3ORHA 4CWAA 2AZTA 3KPYA 2ZBQA 2WK1A 3HCBA 4P7KA 1VBFA 3P71T 2QY6A 3GIWA 3LCVB 3LKDA 5CCBA 2BM9A 3R6TA 3HCDA 5LSAA 3P2KA 3G2QA 5EOVA 2PV0A 4IV8A 1FJXA 5EKUA 2YXEA 1JG4A 3HA7A 2IBSA 3SR4A 1DCTA 2P41A 1TW2A 5LQAA 3UJDA 4R8SA 3SXJA 4OQEA 4XCXA 4RVDA 3PLAE 1QAQA 5GINE 1L3IA 3C3PA 1MJFA 3RW9A 3G2MA 4HH4A 2O05A 1QAMA 1SUSA 3NMUF 4P58A 3FRHA 5BW5A 5K0JA 2ONYA 4C06A 1X1AA 3KPVA 3FUXA 2ZIGA 3P8ZA 4CKCA 1Y8CA 2EX4A 3BWYA 4PYOA 3FPFA 3T0IA 3ELUA 3CJQA 3KHKA 3ME5A 3JWIA 5FA8A 3DH0A 3MQ2A 2Z6UA 3R9XB 2OB2A 4AZWA 3TKAA 1QAOA 1VIDA 3GJYA 3G2OA 3AXSA 1JG3A 1M6EX 5FHQA 3PFGA 2OYRA 2P3QA 4GEKA 1L3CA 3DXZA 3LHDA 4ER5A 2NXEA 3MTIA 3A25A 4RWZA 3UA4A 2YXLA 5E2BA 4DA4A 3DP7A 2QRVA 4E2YA 5CVVA 2O0LA 1EJ0A 3P9NA 2UZ4A 3LSTA 5DXJA 5HFJA 2FRXA 1BHJA 5FWDA 1H1DA 2XVMA 4YMGA 2PXAA 3FYDA 1G38A 1X1BA 3UFBA 3A4TA 3LBYA 3NVKI 3R24A 4O29A 5K0NA 3GGDA 3FTEA 3AXTA 3PB3A 4RTJA 4ER3A 3R3HA 4OA8A 1KPIA 4RVHA 4HC4A 1FPQA 1XTPA 2PVCA 4HSGA 4FP9A 2PGXA 1XCLA 2IBTA 1XDZA 2GB4A 2YTZA 5DM1A 4QQKA 5IKMA 4E2ZA 4P7FA 1R8YA 1UFKA 4FZVA 5E1BA 3EVFA 4F85A 1R74A 3M33A 4G56A 4RTRA 2IH5A 3HVIA 4PCLA 1VLMA 2JJQA 3G7UA 3NWEA 3UZUA 5FCDA 5E1DA 2ZTHA 3ELWA 3LL7A 3P2EA 1NE2A 3M4XA 1UIRA 2AVNA 2B25A 4MIKA 3T7RA 2I62A 2P7HA 4AZVA 3LCCA 2ZBRA 2AS0A 2IDKA 3BZBA 3E7PA 3CGGA 3M6VA 4ER0A 5F2NA 4PYKA 3I9FA 5DM4A 2UYCA 1ORIA 1I1NA 2C7OA 5GM2A 5K8VA 3KQWA 3EVDA 4MTLA 2EG5A 4M37A 1D2HA 1KYZA 3BT7A 5BXYA 3T7TA 1RJGA 3HCAA 2JHAA 1RJDA 3FTCA 4FSXA 5K0BA 1JQ3A 5LR6A 5EZSA 2OXTA 4GBED 1M0EA 3GCZA 3KR0A 3ER9A 1KYWA 3KKZA 4A6EA 3KQQA 4EMSA 2IH2A 5LQKA 3BKWA 3DR5A 2ZCJA 3I5UA 1N7JA 3PT9A 1FP2A 2PWYA 3GNLA 2IPXA 3CC8A 2HNKA 3ELYA 2GPYA 1DL5A 2AOTA 1X1DA 2HWKA 3GXOA 3KQPA 1D2CA 1BOOA 3DULA 3EVAA 5CVJA 3ANXA 4Z2YA 1L3BA 2JG3A 2PX8A 1WG8A 5K0LA 4CKBA 2QE6A 2I6GA 2JHCA 3CKKA 3GDHA 2YUIA 3KQSA 5DT2A 5EIFA 5U4XA 3GU3A 5ICGA 2XYRA 2BH2A 4PWYA 4FR0A 3TM5A 1VL5A 3BKXA 2BR4A 2NXJA 3G5TA 3ID6C 1NW7A 1F38A 4QQNA 3B89A 4GOND 3EGVA 4KW7A 5B1SA 3EMDA 1UWVA 4WVLA 4GOMD 1O9HA 3IEIA 3Q87B 4XUCA 3LKZA 5GOZA 5K0GA 3UBTA 2PKWA 3HCEA 3FPHA 3EMBA 3G8AA 3LCUA 3RIEA 4KDRA 4QTTB 3TQSA 4B17A 5ICCA 4RTNA 5EKXA 1RI1A 4BP1A 3TPZA 2G1PA 1EAMA 2AOUB 4P7JA 4AZTA 3OFJA 2WA1A 5FQNA 3A7DA 3HEMA 3MCTA 3H2BA 3A7EA 5G02A 3ELDA 4NECA 5FWAA 3BWCA 1G6Q1 1ZGJA 4QPPA 1MHTA 2ZWVA 5MHTA 2FCAA 2OPBA 3EVEA 3EGIA 4JXJA 3FPEA 1YZ3A 3B3JA 3P9CA 1KR5A 2XVAA 3NTVA 4CXMA 3MCZA 5GIPE 1Z3CA 1HMYA 3ERCA 1JTEA 1VPTA 5F2KA 1P91A 3UJ8A 3OCJA 4ATNA 2C7PA 4X60A 4EQZA 4RVFA 1HNNA 3FTDA 1AQJA 4CKEA 3UWPA 5JUWA 4F84A 4ER6A 1XJ5A 4KIFA 2K4MA 3BWBA 4XUDA 2QM3A 2P7IA 3KQYA 5EQJB 2IH4A 5DX1A 2YQZA 3QV2A 1P1CA 4E2XA 4WXHA 5T67A 4V0QA 3G88A 4DMGA 2ZIFA 5EMKA 3VC1A 4K6MA 1L9KA 3A27A 4Y30A 3HVJA 5DTMA 5CD1A 4LWPA 3I64A 3G89A 3FUUA 3O31A 3GWZA 4Y2HA 2GA9A 5FADA 4ER7A 1KIAA 3HVKA 1EG2A 5EHIA 3Q7EA 3S68A 2PWPA 1AF7A 2JH8A 3CJRA 2AOTB 3PX3A 1FP1D 3JWJA 4QVGA 3MB5A 4DKJA 1ZQ9A 3THRA 3AY0A 2R6ZA 3LX6A 4PNEA 2P3OA 3CBGA 2P8JA 1BC5A 1JG1A 1KPGA 4KWCA 3THSA 4BLWA 4X61A 2R3SA 3G8BA 1R6AA 1FBNA 3GRVA 2ERCA 3B3GA 2NP7A 4PYIA 3R0QA 2I9KA 2BR5A 5H02A 3NWBA 8MHTA 4OBWA 2PJDA 4X63A 3SSMA 10MHA 2XYVA 1ZG3A 4M38A 5T6BA 5HIJA 2JHPA 2B3TA 2EFJA 3LBFA 3U81A 4HG2A 5BP7A 5EVJA 5LQNA 5HIMA 4OBXA 1XXLA 2Q41A 5CCXA 5KS2A 4QVKA 1SQGA 2AOWA 2N47A 2GH1A 2ZZKA 4M7RA 1U2ZA 4FT2A 2P1DA 3E05A 1YUBA 5E1OA 3KR2A 1NBHA 2UYOA 3HVHA 3G2PA 4IKPA 5LQJA 4P7GA 4QTUB 3KU1A 2VZ9A 2NXCA 5DSTA 3NDJA 1SVUA 3EGEA 2EJTA 3NW9A 3DMFA 5DX0A 3MTEA 2B78A 4YMHA 3SM3A 5LQCA 2NNWB 2WA2A 3OZSA 4LECA 3FUTA 4PIMA 2EJUA 2CL5A 5DLYA 1JG2A 2E5WA 2PX2A 3NVMB 3M6WA 4R8RA 2FK8A 5EHGA 5DSXA 2UYQA 2NXNA 4GUAA 4E33A 2I7CA 5EC8A 5D1HA 5EGSA 3G5LA 5D1NA 3PVCA 4R05A 1VE3A 4U7TB 3CCFA 1KP9A 5FTWA 5ICEA 5KVAA 3OFKA 3OE4A 5E9WA 1TW3A 2QYOA 4RV9A 5EMLA 3LECA 3P97A 2ZFUA 1NV9A 3UJAA 4PYJA 2Y1XA 2AR0A 2PT9A 3VYWA 2GAFA 3NDIA 4POOA 1VP3A 3HCFA 3L8DA 3SGLA 2ZVJA 4FGZA 3V97A 2HTEA 3MERA 3EVZA 2ESRA 2LD4A 3DXXA 4F86A 1G55A 5E9JA 5HEKA 5K01A 3I53A 3IYLW 2H11A 3P2IA 2ZSUA 4AX8A 3FZGA 1NV8A 1RJFA 3KPUA 4C07A 4E32A 1G60A 2PXXA 3OU2A 1QANA 4RVGA 4RTKA 2ZZNA 4C08A 5K05A 3BGDA 4IWNA 2B9EA 5EEHA 2C7QA 4BLVA 1RI2A 2C7RA 5LQUA 4EVIA 2V7EA 5CVEA 3GRZA 3UA3A 2PXCA 2AN5A 2H1RA 1ZKDA 2H00A 1O54A 2HV9A 1Q0TA 5KQRA 5CM2Z 3BUSA 2PX4A 4RTMA 1JR4A 3EVBA 3TMAA 5DTQA 4PINA 1JTFA 1EQAA 3DMHA 4RSRA 1NT2A 4BLUA 2BZGA 1VQ1A 3C6KA 1SG9A 3T7SA 1G8AA 3LGAA 5CIYA 4H0NA 3EEYA 3LDFA 2ZULA 4XUEA 4E2WA 4GQBA 1R18A 2CWWA 3FUVA 3KQMA 3LPMA 2FHPA 2NYUA 3C0KA 5K09A 4E31A 2AOVA 3REOA 1XDSA 2CKDA 2Z6QA 3B7PA 5K0FA 3TR6A 3DTNA 1Q0SA 3PTAA 1ORHA 2IIPA 4PONA 4PYMA 3E23A 1VP9A 4DCGA 2ORED 4KDCA 3DOUA 4E70A 4YUXA 5DRTA 3CVOA 1TPYA 3OU6A 2KW5A 4R6WA 4V0RA 3KPJA 1R00A 3MGGA 4EK9A 5ERGB 5KYGA 2G70A 3AWIA 4PCAA 3TOSA 3OPNA 1NBIA 4OX9Y 4OQDA 3GRRA 3PX2A 4C05A 1INLA 5P8WA 1YB2A 2P3LA 2P40A 1KHHA 3E8SA 2VDVE 3JWGA 3EPPA 1ZGAA 3DLCA 4HTFB 4CTJA 5E2AA 2HR1A 2Z6AA 1XCJA 3O7WA 3B3FA 2AVDA 4GC9A 4IV0A 2ADMA 1P39A 2ZIEA 1RI4A 3C3YA 3KR9A 1RI5A 7MHTA 5EZQA 3AJDA 3X0DA 3HNRA 1L1EA 5FHRA 4DF3A 3LDGA 2YVLA 5HIKA 1NW5A 1I9GA 3EEOA 4FT4A 3I58A 3FPJA 4OA5A 3HTXA 2PSSA 3DMGA 5HIIA 1OR8A 4PIPA 4DCMA 3UJCA 2UYHA 1WS6A 1R8XA 3F4KA 3VSEA 3KQOA 1QZZA 5K0EA 3TKYA 3FYCA 1KPHA 2YXDA 1NW3A 3A26A 2OZVA 3GO4A 4BP3A 3K0BA 1WY7A 2ZBPA 5GWXA 3C6MA 5F2OA 3PS9A 3OU7A 3OZRA 1X1CA 4YUVA 1SQFA 3OE5A 1JQEA 3DUWA 5IH3A 2Y1WA 1IM8A 3CJTA 1D2GA 1XVAA 4FS8A 4C03A 4YV0A 4YUWA 5EEGA 1RJEA 4ZTBA 2XYQA 1WXXA 5DRYA 1JSZA 4GOOD 4UOEA 4RTQA 2AN3A 1NW8A 4A6DA 2ZW9A 2O57A 5K0CA 2G72A 1YZHA 2BM8A 4RTPA 1YF3A 2HMYB 1EIZA 5C9ZA 1WZNA 2JH9A 2G8NA 4U7PB 3HA5A 4QDKA 2AOXA 5LQRA 4AZSA 2AOUA 3P9KA 5DPMA 1EJ6A 4HRAA 3HP7A 3KQTA 4YUYA 4M36A 1N7IA 3HCCA 4HGZA 4YV2A 4HGYA 3TFWA 1KXZA 4ISCA 3M6UA 3ER8A 5FUBA 2BR3A 3JWHA 5K03A 2PX5A 1JSXA 2OO3A 5E1MA 5E9QA 2OY0A 3FPGA 3GRYA 3OZTA 5DWQA 2ZWAA 4HTFA 3KR1A 5CVDA 5GM1A 2PLWA 1YFLA 1BKYA 2OKCA 2VDUE 5EMJA 5GIOE 2YR0A 1SUIA 3FRIA 4RTOA 1AV6A 3SSOA 5CUQA 3FUWA 4FSDA 4KIGA 2O06A 4PGGA 3P9IA 3MHTA 5BW4A 3EVGA 5C1IA 2B2CA 5C0OE 3BGIA 2FK7A 1V39A 1DUSA 1I4WA 4KRGA 4GC5A 2YX1A 3BGVA 4MQ4A 3SMQA 2OBFA 4RYLA
chains in the Genus database with same CATH superfamily
1PKXA 3IUBA 3WYEA 5TB5A 5KOJB 1CFZA 1JSRA 5BQXA 3GLTA 2AZMA 4O63O 1KRWA 1V8OA 1UT5A 3HA2A 5FOQA 4MDEA 3NHKA 3WRWA 1YRHA 3JD2A 2XMGA 4BMZA 1TYEB 2OHJA 4C2AA 1C1XB 2GAJA 4NBLA 4TV9A 1IOVA 2DPGA 1XU4A 3DFIA 4CMIB 2GPNA 2W6ZA 5AKXA 2Q6LA 1SJ9A 2GYWA 2QN8A 2AD1A 3PE4A 4KR0A 1I7PA 3UXHA 1HDEA 3EHDA 1Q3TA 5EPEA 2N75A 5KQPA 2B37A 4H1HA 4TRMA 1OTYA 1NVXQ 1UUFA 2QPLA 1ODTC 4IXWA 5EIWA 3D6VA 5HILA 3ND5A 4PYQA 5A7HA 1B0ZA 3UH0A 4Q4LA 3INRA 4CM4A 3U2QA 4EUKA 4P36A 3KHSA 1TTQB 5HOQA 1UWLA 1O77A 2WAXA 2O52A 1VPLA 1IWOA 4N9QA 3JQ6A 5JTUA 1DB3A 1YZLA 2XBLA 2IU4A 3AY6A 5D51S 1WMDA 2VT7A 2HM7A 1EWKA 3M6LA 3FBWA 3UN1A 2CW5A 3GEBA 5FFFA 2H92A 1AT1A 3C24A 5I9NA 3C97A 1FFYA 3DO8A 1XTIA 1O8BA 1OX4B 1EHCA 5J2UA 5IX8A 1NY5A 4P7BA 3PF9A 2W43A 1ECGA 3LSYA 3RCBA 1QFMA 1UPXA 1NZDA 2WJ6A 3OX2A 3P0EA 3DE3X 4G4SP 4W9RA 5LIRA 4AG6A 1Y3HA 2DUUA 1UJMA 4OHYA 5DHQA 1TQ6A 2ONZA 3LZ6A 2IEGA 4PPGA 4LOAA 2BTQA 3OESA 2VPPA 5E8JA 4F5EA 2CNWD 4EYGA 5AIBA 3REQA 4GQAA 1MPTA 4HBZA 1OPRA 2VTDA 2WU1A 1AS0A 4QBIA 4RX1A 3MJVA 4CEHB 4LRXA 3PQFA 5TVGA 4RGBA 4G0WA 1RJ9A 4L4XA 4AJLA 1Z0JA 3KKLA 3QEMB 1U5BB 1WULS 1U04A 3UAYA 3G2QA 1ENPA 1NIJA 3CEHA 1F7UA 4DC9A 3QXXA 1OF1A 4FYVA 4K88A 2Q7OE 1JT9A 3P9PA 4IKOA 1VL0A 2QRQA 4HZUB 1E2LA 5K8UA 4CM7A 1JJVA 1R4NB 2B4TO 2YN0A 2PFSA 3A9VA 3UJDA 3UGKA 1T0UA 2J4FA 4MVYA 1OYYA 3ODGA 1JBKA 2ZPUA 3NPMA 5D87A 2YYAA 2UVPA 4JSRA 2PZJA 2CDNA 4FLFA 1Z4NA 1P5FA 6ABPA 2BSAA 2FHSA 2XW6A 3GZJA 1O03A 3GT7A 1C3OB 2QWXA 4R68A 4X7BA 2OCXA 4OREX 5KEIA 4ZN6A 3TR5A 4X7RA 2O2DA 4JI0B 1RWKA 2OQRA 2A3RA 5E6RA 1GNTA 3MVEA 5IT4A 2J0QA 3R3YA 3LYHA 5DF1A 2GZSA 1T2FA 5JHGB 2FWBA 3P2MA 1HL7A 2ZJ8A 3KEMA 1JN0A 4MJ7A 2BFEA 5HUHA 2RIPA 1Z6XA 1AQYA 5EHXA 1BYIA 3USZA 2PZBA 1LQ2A 5HZKA 3A3OA 1E7MA 3CVXA 2Y76A 4ZK6A 5H1YA 2CSUA 4KR9A 4F9FA 1F1BA 2HIHA 3RS4A 1SCKA 2G25A 5BSFA 1ZFNA 1O94C 5HKBA 1MC5A 3RKUA 1IN1A 4RXMA 1TTTA 2D59A 4YRCA 2VK2A 1YASA 3QJGA 2IEDA 4K9NA 3A4TA 1M76A 3R24A 4IZHA 2HHCA 2WYOA 1ST3A 2OZKA 3C3JA 2E1PA 1TD9A 3HHEA 4BJ6A 3BL6A 3IPRA 1M2EA 3Q41A 4G5SA 4N82A 1YRAA 4BKUA 2A94A 4WECA 3LNCA 2HJVA 4GXQA 2WVAA 2Q1YA 1F48A 3GA7A 3JQDA 2AG5A 3CEMA 4Y2QA 4YJFB 1XZMA 4PG8A 4F21A 3P27A 3CLHA 4TV9B 3IAAA 3U48A 1U9IA 3OTHA 1I4LD 1VE7A 3DF9A 1DVRA 4MDFA 2EP5A 1HEIA 3JQFA 3CLUD 1U1GA 4BGEA 4BFVA 4I1PA 4GE3A 3V2HA 4NMLA 3ZJ5A 3GUYA 4RETA 2B2NA 1S8FA 4KXUA 5H4GA 1TO1E 1JKFA 1CR2A 1P1IA 3WLMA 4AZVA 4TMXA 3E7PA 3CKLA 2Q9BA 1NDQA 3BL8A 4FDLA 5BORA 1YRYE 4BMVA 3E8MA 3LPLA 3NGLA 4PQYA 4ZC8A 2HV8A 3E2MA 5BQPA 3EXHB 1DWUA 4UVDA 2NYRA 2YBDA 1A2QA 1PUIA 3B2QA 5C5IA 2FPGB 1GL7A 5DCWA 3ZHCA 4NULA 4RD3A 1S8NA 3HBNA 1XHEA 3LL4A 5AUOB 2UXDB 4ZI5A 2IDMA 1TGVA 4IIUA 1KI3A 5EZSA 5IYZA 3OMWA 2QX4A 3EXEB 2FGKA 4B3CA 4CLRB 5LU9A 2IW1A 1J25A 1HYGA 2QN1A 1D6NA 1AUQA 1B3BA 1G9SA 4BLPA 1A77A 3EXIB 1SU6A 5IUJC 5SYAA 2X8JB 4HN9A 4ZT3A 1JQJC 2BZSA 4CU2A 4V1CB 1GPYA 4QVIA 4TTAA 3VNBA 2WMNB 4ZJUA 5KNCD 1XJCA 2FLKA 3CUUA 4EO9A 4UUMA 2ETVA 2BLLA 5BR7A 2J5RA 2PLNA 3CKKA 3GDHA 4NBWA 4E22A 4DY4A 3K0SA 3U3KA 1FUUA 2W6QA 4URWR 3U7EB 4W5WA 2O5EA 4LC9A 3E5NA 1RYHA 3OIGA 3W4IA 3GJ4A 5DXFA 3FWZA 4ETWA 4JL8A 2BN4A 4XUCA 5I4BA 5KWIA 3UY4A 5TMPA 4LMPA 2JGMA 3LCUA 1DWOA 3RC1A 5ICCA 3HUFA 4TYMA 3QY0A 3TLMA 4RO0A 3X44A 4M1ZA 1VJRA 3ISTA 4B7UA 1T9GS 1Z4JA 1SCUA 3OC6A 4MCIA 3ZOZA 1YS6A 1GQQA 3ACBA 4RPCA 4GI1A 1DQYA 4HB4A 4U00A 1UMDB 1Z6YA 2HFJA 3R4VA 4NJMB 4XIYA 3GVIA 4F4DA 2BGUA 3T54A 1FNNA 4X20A 1M1YB 2RH9B 5M3BA 1OBCA 3GLSA 3NV9A 3ROPA 3S40A 3VPCA 5GIPE 4Z4EA 4QJ4A 2FOLA 3U4AA 1ZI6A 3ZJTA 2HEGA 3D7NA 1ZSNA 4MS4A 1HQYE 4K40A 1TZCA 2IYZA 2RH8A 4KACA 4UHFA 4ZCSA 1U4NA 4MH0R 3RJ9A 1KZYC 1PE0A 3C1OA 5DYIA 3BWBA 3BDIA 1YKFA 4KO1S 5DJ5A 3AUTA 1XVTA 1T5TA 1W5TA 4GMGA 3QXHA 1ORRA 2GJ9A 3KSZO 1E2QA 4YRFA 3BFPA 3I37X 4D44A 2YWGA 4MPJA 2PCJA 3M1LA 1TX4B 2JPDA 1AQUA 4G5OA 3EK2A 5CH5A 3V8EA 1JIUA 4Z54A 3BG5A 4ZREA 4ZV7A 4X62B 1JR3D 2W4QA 5FADA 4Y2PA 4IJMA 4GOXA 1PWEA 4IP0A 3KZNA 1W48A 3S68A 3X2EA 1C7RA 1AS3A 1CPYA 5CG1A 1KNXA 2QTVA 4ABTA 2BFCA 2BKUA 1B74A 3TOVA 3G6WA 1F0PA 2EATA 2FPPA 1UH5A 4JJAA 4PNEA 3L5KA 3L0IB 5BSKA 3CSSA 1E63A 3GJQA 3H9EO 4QYIA 1U8UA 1Z2EA 1ORVA 3LQKA 4L15A 4AKSA 1JUDA 4EA6A 2OHIA 1M2OB 1Q0PA 4L2IA 4BB9A 2BFCB 4WOJA 4BRWA 4GYYA 4PE5B 4PYIA 3GBPA 5HUQA 3WLSA 1BGXT 2VJMA 2WPDD 4XWYA 3BXPA 4GKAA 2QV7A 4CIWA 4DJTA 3T3GA 4KL8S 4KYUA 3PXDA 4X63A 2YZ7A 1M9NA 3CRNA 3PUVA 3RYTC 1O8CA 4B6QA 5HIJA 1JMYA 3LBFA 3VBEA 3FB4A 2NU8A 1P1HA 5BN4B 3SC3A 2C7GA 5HIMA 2WKSA 4Z51A 3GLKA 4M7RA 2J8ZA 5T4FA 2Y93A 4C4OA 3ORYA 4WASA 3G2PA 3K31A 1M2JA 4P7GA 4TTQA 1XTRA 4M83A 2VZ8A 2G0NA 4Q1DA 2R7LA 2EGUA 1EVZA 3D1LA 3DAGA 5AI4A 5IFLA 1YUMA 4CETA 2ZSAA 1MORA 1H22A 1W1UA 2LWIA 4OJNA 1F5NA 1UZNA 2EJUA 4P54A 2DQZA 5DLYA 5CITA 1NMXA 5E6UB 5IDVA 5FDFA 5J2TA 4I50B 1KU0A 2OHHA 1BE1A 3OLYA 4YJ3F 3K5IA 3AG5A 2YWHA 4H0FA 4DLWA 1WLSA 1UMCB 2SKEA 4CFSA 2OOSA 5DNVA 1SKYB 2FG5A 4R05A 4QARA 4C4YA 4OEHA 3GGJA 2O6LA 3N9IA 3OE4A 5E9WA 4RD4A 3RG8A 4Z1OA 3HE3A 1C1HA 3GUCA 3NEYA 3ADPA 2BUCA 2I5PO 2PVPA 3BORA 1GTSA 4PYJA 1XT6A 2C00A 3UAXA 3VYWA 3HG7A 3P0IA 4M9XA 4I19A 5EFZA 5A4MS 1X3SA 4MVJH 5KZMB 3LUDA 1CF4A 3EVZA 2W2KB 1QFXA 2ZB3A 2YVQA 3JZMA 3C7KA 3ZV6A 1YUNA 2DTEA 1U0OC 3EZXA 2ZPTX 2QMEA 4DVGA 2EQAA 1PJAA 5K9ZA 3H6KA 4TWBA 1JR6A 2HH9A 2JLQA 4K0RA 4YROA 5TJHA 2V3WA 3B1YA 4R9VA 2DYKA 3U3OA 4MITA 4BTEA 1U5AA 2ZB7A 4BFSA 2P9GA 3AR8A 4G0UA 2H9AA 3G8DA 3WTCA 1W0KA 3A6ZA 3KEGA 1XKTA 3O94A 3QFCA 2ZCVA 4NU5A 5AW1A 1Q1GA 2PXHA 2HWUA 3G68A 3HRIA 1JR4A 2O8CA 2VFAA 3NHLA 2VDLB 2ZS7A 4QDXA 4D9FA 4HDSA 4LE1A 1QQTA 4ARZB 4ZGBA 1JIKA 2Q8NA 3VMFA 1VQ1A 3P5SA 1SA0A 3UMJA 4DXAA 3M1AA 4EF4A 3OSZA 2MSWA 2BDTA 2Z1MA 4XUEA 2VK1A 5GTDA 3O8QB 5CT8A 5DI3B 1SULA 2ZT7A 4GQBA 4CJXA 3WWDA 1YMUA 1N6IA 2GKGA 1WDLA 1J99A 3OT4A 3B13B 3RS2A 1VA4A 1D2MA 1AGPA 1YR1A 5JAMA 1BIFA 4H0CA 3F49S 4AKGA 3AI2A 5CDFE 1WPRA 3TX2A 4TYPA 5TQ0B 2ZWIA 4I7EA 3P0FA 2RGNA 4B3FX 1TPYA 1BCRB 1GUFA 2IHBA 2H9YA 2YYZA 3QHPA 2DETA 5IWCA 4QODA 2FJPA 2HIGA 1DG3A 4PZ9A 2GASA 3ONFA 2X1MA 4R9NA 4AB1A 4BZZA 4ZHQF 1S2GA 4H6VA 4OHMA 1UK9A 3EQ9A 3UCEA 3WB1A 5JANA 4LF9B 3MHPA 1P18A 2RC6A 3I4CA 1AE1A 5BMVA 1PJSA 3WGGA 5IH7A 3GFVA 5AVRA 1CETA 1WKCA 1VJGA 1L5WA 1PNOA 1B43A 5AVOA 4M8KA 2R97A 2FUG1 2GN0A 1HTBA 1R8JA 1T3HA 4NTZA 4ZQEA 1H69A 3OIWA 2RDMA 5FHRA 4DSAA 5DSZA 3J7TA 4QYTA 4OXXA 4O2AF 1OY1A 1T5HX 2IXTA 5JSYA 2YWFA 2ZRCA 1FXSA 1K8YB 3CZMA 3FPJA 3QXGA 4ON9A 3G9ZA 1ZITA 5KYUB 1LBIA 3RSOA 4MA0A 3RDPA 3Q88A 5FUYA 4E09A 2CF6A 1RCTE 1HNXB 3AF1A 3B2NA 4EMTA 3WG9A 3L4KA 3RTBA 3KQLA 3V1YA 3V5NA 1DJLA 4CLXA 4AY4A 3W3ZB 4NOJA 2C4UA 1EVIA 2Y67A 4MVJM 1JFTA 1CWUA 1WXXA 4DMFA 721PA 4BAGA 3DS8A 4R1OA 4XARA 1Y37A 3KDSE 4UEOA 2E9SA 1EK6A 1S4QA 2I3BA 1UEJA 3IH5A 4A6PA 1DEKA 3H5AA 4KMSA 3LC1O 1YMVA 4UCFA 4LSGA 5C53B 2E2WA 3EUEA 1RAEA 1SXGA 1XLTA 3BM5A 1C30B 5INTA 1E2GA 1NN1A 2ZI5A 5C7OO 4D9GA 2CXRA 2AOUA 4YS6A 5DZSA 5K8LA 4QNRA 1W75A 3QWIA 3R4CA 4IGEA 1NWHA 1C9NA 1U0NA 4Q4DA 3HCCA 3ABIA 5LM3A 1T2EA 5IAGA 5KX5B 3AVYA 1E77A 3IT1A 5MGNA 3FPGA 5DWQA 3FPSA 4WV3A 1DAKA 4MARA 1VHTA 3JYPA 1VE5A 3HFGA 2V54A 5JSHA 1FTSA 1EFVA 1SBZA 1YFLA 1KFJB 1T6BY 1U2DA 2BUBA 2OXRA 2VDUE 3FRIA 4JKYA 2B4KA 5HS6A 4BC0A 1NVMB 1R0RE 2HA2A 3IKVA 4I08A 5FPPA 3ZNNA 1V8ZA 5LWQA 4TM8A 1AMNA 3FCOA 2PWAA 4GI2A 5D3KA 3AI1A 3BGIA 2BBOA 3OZAA 5KU7A 1DUSA 3GN1A 4RELA 4MX8A 1JXAA 3QMPA 2BD0A 2OKGA 1LNSA 1GFWA 1TADA 4II2A 3B3AA 3V2IA 1Z08A 2YHIB 1ZH4A 1ZNZA 2Q0HA 1FB5A 2KPOA 4RC9A 3VC2A 2ZQZA 4IJ5A 2ECKA 3JAMA 5GONA 4AQ7A 3QXSA 3HA3A 4US1R 3MPUA 3AYZB 3UH1A 5ARBA 1JQKA 1RXVA 1YL6A 3O73A 1DNPA 2BTQB 4X66B 1J7JA 4N18A 2Y0PA 3I9LA 3G23A 1WZ2A 1R15A 1C81A 1RZUA 1X19A 2QM7A 1H2RS 4GH5A 4D8YA 2B61A 1L8LA 2ZANA 4NCXA 4AW9A 5TGDA 4IX1A 4HLCA 5EJ5A 2RGAA 3EG9B 1LEHA 2HQSA 2DLCX 1I2MA 1TLFA 1FFWA 1XBTA 5IDXA 4OLJA 3CLVA 3O1JC 1GWNA 3MBKA 4MP3A 2VEDA 4DANA 4FILA 3BDAA 2GCOB 4HEJA 3PI6A 1RPNA 1TVMA 3DHNA 2RI1A 5PNTA 4CM8B 1IDN1 5BVHA 1CRWG 3RBXA 8ATCA 4B85A 1PVOA 4L7VA 4MWZA 3S2UA 3KYCA 2JAPA 2RHCA 2YJTD 2I80A 1THMA 2UV8A 4UHDA 4DBZA 2G6TA 1FNMA 2I6FA 4MWSA 5SY4A 1L4MA 3M83A 3TLCA 1C3OA 3PD7A 3OLVA 3WJAA 3INGA 4YBRA 2ZGVA 3VJKA 4IDQA 4BS9A 1NKVA 2WJPA 3IQFA 2VDWA 4LWOA 3EXG1 2QUBA 5JEDA 1Y6JA 2CVQA 1GL6A 5ES4B 3NYQA 4UNIA 1Q1QA 4XSGA 4X1OA 1MIHA 3B51X 2BGKA 3QKSB 3ZXIA 3FETA 3FXAA 1QIFA 1IXSB 2R6DA 3F3SA 1YDGA 1RMTA 3R9IA 3HDQA 3LLMA 3QQ5A 3SNKA 3LOQA 4GI7A 2OC9A 1ZIDA 1R88A 3PPXA 1T2UA 4R9RA 4OMCA 4NPCA 1ZK2A 4X1IA 5BYKA 5ED4A 4D42A 1G2IA 4WMLA 5LP6B 2ORYA 3DBVO 4KZKA 5DVZA 1DKRA 2I4NA 3DG9A 4HFJA 4OQLA 5M7EA 4IDFA 1BWRA 3RYHB 3UMVA 3O8OB 5KHOC 2GBLC 4OQEA 2DEUA 2O7RA 3LP6A 3PLAE 4OGKA 3P94A 4DGSA 4FX5A 2DQSA 3SJ7A 3THWB 3KALA 4LCBA 2D2XA 4LJ6A 1OROA 3GIDA 3U09A 1Z88A 1M83A 4ZAFA 1ZN8A 1QC5A 1BQ3A 3D2AA 4I8IA 1KQNA 1P7VA 4C3VA 3MCWA 1NJ8A 5IMSA 5ITZA 3GUZA 3L4JA 4CMBA 4QEZA 1S2NA 1OYVA 2B5WA 2WMOB 1YD7A 2BY4A 3OIVA 4ROSA 3TXYA 1NTOA 5A4AA 4DIFA 1UJBA 1E7YA 2POCA 1EIWA 3WLEA 3ZD9A 4FZ5A 4QOIA 4BO0A 4F46A 3ND8A 2HLHA 4X71A 4X8LA 3IAEA 1KYQA 4LZOA 4AZWA 4L1KA 5FBWB 3ROXA 4AUNA 2ECOA 5KX5A 2HZ7A 3IKMB 4MA4A 1R8SA 1ZZGA 2GFHA 3SICE 1H2AS 3AKDA 1NW4A 4HNSA 4J0KA 5JYCA 5A5DA 5JSZB 3DSRA 1XZIA 5L51A 2QRMA 4O4HF 1Z4PX 5TQ2B 1QFYA 1JAHA 3DTVB 3LSTA 1G63A 3OFSA 3MUOA 2XVMA 1SR8A 4H1TA 4OHUA 3VTZA 3WQQA 4ABYA 5KMGB 4JIGA 5KYWA 2QVYX 4KN5A 4BCBA 3UAOA 2LTAA 4HN4B 1OXSC 5A0FA 4OA8A 1PSDA 4KLRA 4RFSB 4CMIA 3S2EA 2X8AA 2FKNA 4BXOB 1XCLA 4D4HA 2WD8A 1JEAA 1T1GA 3GEHA 2GKSA 4OB7A 1VJ5A 3TKLA 5IKMA 1Y5NA 3C48A 3R7BA 1WCV1 2GBCA 1R8YA 3UW3A 3ZHYA 2P78A 2RHOA 3WIBA 4U7GA 4F85A 1QO7A 1UMCA 5FB3A 2VQEB 2MSDB 1L1QA 1PLKA 1ZOPA 3NAGA 3Q6NA 3DQQA 5CYFA 2ID7A 1XG5A 2WG2A 4G0NA 3KB1A 3AHJA 3FR7A 3SOZA 1VSTA 1AZLA 1FBTA 3GROA 3OZIA 4IEFB 3WZ2A 2PH1A 4ZO8A 4Q1EA 4DDTA 2IDKA 2XD9A 1DG9A 2JGFA 1OB5A 2P6UA 3S2GA 3DT8A 5GZ3A 4MDYA 4L78A 1NVAA 5JYDA 1W1IA 7YASA 1FX0B 2NIPA 3E3OA 4XJTA 5IARA 6PFKA 3UTDA 3V32A 1E3IA 3EVDA 4JT8A 2H59A 3ZHQA 4EFNA 2NAFA 4DN6A 3BICA 4D0LB 2FNAA 3T9FA 3AVTA 1T1JA 3B1WA 1M5TA 4RPJA 4JJFA 2CXXA 3COSA 2G09A 3JQ9C 1L4NA 3CTPA 1K63A 5JJ5A 5KMGA 4EMSA 3HMKA 3H8WA 2Q9UA 4QM6A 5REQA 4LYFA 4AIIA 1CY8A 2BT4A 5K3AA 4NESA 2F8MA 4YJ2A 2HRCA 3BAZA 1NXOA 2ZVQX 1JWAB 5EINA 2IPXA 3B8EA 4EKYA 2C5EA 1DL5A 3FGNA 4RCZA 1ZEJA 4KG7A 3EVAA 4HUJA 4WCFC 3UG6A 5L3QA 2IHJA 2JZNA 2XCQA 3AHHA 3L9WA 1BXGA 4R7GA 4Q3KA 3ZW9A 5AWFC 1QONA 4DTCA 1N3LA 3SE7A 2LDXA 1Q84A 2AZ4A 2YUIA 3HBFA 1LPMA 5FLXA 2VJQA 4F06A 4XVHA 3DUFA 3WR5A 3DEKA 4NR0A 1TA0A 3AFGA 3SXUB 3RRZA 4G0MA 3V80A 4GOND 1VZ3A 2TMDA 2FR1A 4KXXA 4Q4JB 3BTUA 5IW8A 3VDNB 4DNPA 2G1KA 4L5BA 1A5TA 1UWVA 4E12A 4JXXA 2A9FA 3BE6A 5CFMA 2GNAA 3I0ZA 5FOUA 5TNXA 1OFUX 2Q5HA 3VNSA 3H2IA 3ZEAA 3VA7A 3VTKA 3TIIA 4FWIB 1KBZA 2AXNA 4IMIB 1UFOA 4AG5A 5DGIA 4EFDA 1CZOA 3KDPA 3G7SA 4LGCA 1QO9A 1OAKA 4OMUA 5KAMA 4FXOA 1J2EA 3VH4A 1J90A 4R5MA 2YHUA 4MXDA 3GD7A 5EHQA 1T6NA 1O1YA 3QJYA 4ZK2A 1XF9A 3UQYS 1I7LA 3MXTA 3HK2A 2IU0A 2VH1A 3EDOA 5HQTA 5A4DA 1V4NA 2Q7XA 1FDVA 4FFMA 3HL4A 5E4JA 1Z0KA 2VNHA 1N3IA 3OCJA 1LZLA 1SRRA 2ZBUA 4QHYA 4RVFA 1LLUA 3WISA 4KVFA 5KTKA 3VDXA 4Y2YA 1UKVY 4BGIA 5BV8A 3ILHA 3FCEA 2FMTA 4QRIA 4DVJA 2SKCA 4EL0A 5JVDB 5JNWA 3UJPA 5KJCA 1U1IA 4ZEWA 2DPLA 3NZEA 4CMJA 4HEA1 4MVJE 4P4UA 4K5QA 4KXFB 2YQZA 2QPOA 3SYLA 3UK1A 3W0LB 3JTEA 4CODB 2X4LA 3I04M 1N2CA 2EFCB 4GMHA 4QBGB 1FUEA 3K16A 5AVWA 3HP1A 1F8YA 4GSYA 2I2AA 1L9KA 3WL7A 1KAQA 3ICQB 1M0WA 1NZJA 1O6ZA 3G9QA 4CRWB 3T3NA 5A71A 5CD1A 1FPMA 3EPLA 4LI3X 5IM5A 1QUEA 2VG8A 4URUR 4JOBA 3A9CA 5AI8A 4NBKA 2GJ8A 4UU1A 4WEOA 2J3JA 2HF7A 5ALGA 1D03A 1GITA 3E9QA 3HGQA 2FLVA 4UFOA 4B33A 5B2EA 3PDCA 1GSAA 2PUJA 4G1BA 4XWKA 2A5FA 1G2QA 1UXKA 1ZEMA 4PS0A 4DIMA 3WO1A 4MS3B 4BLTA 1U65A 1W35A 3DXFA 3GX1A 3LUGA 2ZBGA 2HMAA 2ZJ6A 1M7BA 4GYWA 1ULHA 1GPUA 4PNZA 1NRXA 1ZL0A 4ARSA 1NF2A 1NVBA 5KWJA 1P62B 2HPHA 1EWRA 1FBNA 5C81A 3ZDQA 4MJXA 3S1LA 2ADOA 2XBUA 2V7QA 1RHKA 1RLJA 2VOEA 1GUBA 5C80A 5KBYA 1YOVB 4FYPA 1L7RA 2JBHA 1VMAA 3PCXA 3V9PA 3LUCA 5UKDA 3SSMA 1A88A 2BE9A 3ANSA 2NN3C 3GFTA 3T15A 3TTVA 1ZG3A 3WLIA 1YHYA 4KUHA 2QSYA 3PYLA 1Q2UA 2VUUA 2ODEA 4DYHA 4N0PA 4BCDA 4BMOB 5FWNA 3L84A 1MXHA 4ED9A 4WJZA 4W63A 4GXTA 1XQVA 3CNEA 2HU5A 3E05A 3LW7A 4FD3A 4O2BA 2VR1A 4WL0A 5JSKA 5C8YB 1JBQA 3IBCA 2UYOA 1F4LA 1USUA 5FPQA 5TARA 1RLTA 1R3UA 3K5PA 2R25B 3IAUA 5DLPA 3EXHA 2EJTA 4CMHA 4ZEVA 2JNWA 1PFYA 2AEEA 2FWJA 3DMFA 1I33A 2XNDD 4FX2A 1MPXA 4G5GA 4I8DA 1QZUA 1PZGA 2B78A 2RK4A 4L50A 4MB6A 5NULA 3V4VB 3K96A 1NVWQ 4D9KA 4MKRA 4HHEA 1QKKA 1RZVA 3KOMA 4RMNA 4AS1A 5DBIA 5FXMA 3K9WA 4PXSA 2PDAA 1U1EA 4QECA 3WLQA 1X1EA 2NXNA 5C4IA 2QNRA 5FPTA 1QQ5A 3R7NA 1RPAA 2BBSA 5FTWA 2UUBB 2XCOA 2XE4A 2B9VA 4JL6A 5JXHA 5IKXA 2V1XA 2R00C 3SYTA 1KR2A 1DIAA 1OFUA 3BH7A 4YT8A 3JAKA 4PBSA 4POOA 3SYMA 3CUWA 1JLHA 1OX6A 3HCFA 1ZYUA 4UM9D 3VZCA 5I48A 3E5RA 2FXVA 4FQ5A 2HTEA 2ZT8A 1Z5NA 4UTVA 1PWXA 1T34A 4FQ7A 4PSVA 1Q7RA 1O0BA 1T8RA 1LRKA 1KJJA 2B82A 3MEQA 4PZPA 4Y8VA 2DLDA 4S24A 1B76A 5E9JA 4CM9A 4EFLA 2H11A 1CVRA 2ZSUA 3DE4X 5FOXA 3FZGA 1NV8A 2HWWA 3RUDA 5FUXA 1B6TA 2HNBA 2P9JA 2NSLA 1E18A 4QO7A 2CXSA 3CONA 4ZAVA 4BLVA 4G0YA 1SBCA 5DK6A 3EXFB 4EMBA 3IOYA 1PSZA 1KYTA 4OAOA 3RI3A 5KJ1A 3G6KA 2YZMA 1N7GA 2G9ZA 1OLOA 3AKYA 3R3ZA 2WJYA 4WCDA 2FA9A 4NOLA 1UEIA 4V39A 2YHAA 4FMBB 4NDAA 1KU6A 1BXKA 2MSLA 3L4BC 1Q11A 2CCKA 4ADSG 3KKKA 1YE5A 5E9AA 4BNDA 2VNAA 1KKLA 1UPTA 4GKJB 4OV6B 3QYFA 2DFVA 2FJUA 4O4IB 5AKHA 2NPIA 3ZGNA 4HNRA 4JEIA 1UK6A 4EMUA 5B5SA 1R9NA 1R18A 1OWNA 221PA 3SLRA 3EGDA 4DQDA 121PA 1U80A 2I1WA 4R1NA 4K2AA 2EIXA 1N6PA 2V6IA 5COBA 4KE6A 4KFCA 4O0LA 5KHAA 2ZSBA 2WFMA 1R6BX 1JG6A 1IAVA 4X1KB 1H0RA 4QG3A 4K9RA 4TXMA 3FNFA 2JDIA 4QC2A 1NUUA 3PHGA 4M0PA 3OU6A 5KNBD 1H2ZA 2XB6A 2BH2A 1R12A 4A2PA 2PGNA 2O3RA 2WU3A 1VL6A 4XD7D 3RV4A 4B40A 1Q14A 1XD9A 4GYJA 4S2EA 5JS6A 5BSEA 1K06A 2I3ZA 4YT2A 4G4JA 1KHHA 1LD3A 2VDVE 2E48A 3EPPA 4BQRA 4H7DA 5AK5A 2VF8A 5AJVB 2ODBA 2VCHA 2W0MA 4AMBA 2QPAA 2IOQA 3H18A 5ALXA 4M86A 1QHSA 3VH2A 1G5QA 2AI3A 4ZAYA 1THTA 4M0MA 4CGZA 1R0CA 4DF3A 3QELA 1DKMA 1QG0A 1A8IA 4QUAA 3SLGA 1VDMA 3TN7A 3WB9A 3GP5A 4XDGA 3S8MA 4CMKA 1OLSA 2ZYDA 1OR8A 3OM9A 4PIPA 4JLJA 4XGNA 3RSLA 3UJCA 3VSEA 3I2YX 4ZAWA 2VHXA 1XL1A 4TL7A 1KPHA 2YXDA 1ENOA 1WMSA 2WSYB 4N3GA 5F3WB 4H4CA 4LNUB 1TQ4A 4W5JA 4EB6A 2PTGA 1YOVA 4J16C 2ECPA 2I2CA 4V0MA 2ZOSA 4GUDA 1Q7BA 2VPQA 1RJEA 3ZNQA 5I9IA 2REBA 1JA0A 4YT4A 4M8IA 4G0VA 4R2IA 1RYBA 4N76A 4C7VA 4OM8A 4MHOA 5EFOA 1CY6A 1ADFA 4F71A 1VB3A 1H5QA 1H8HA 2XNJA 3TIGA 5ITVA 5KCZA 2W2LD 2ZWPA 3VR5D 3S7ZA 3PRYA 1TFUA 4AJKA 4RTPA 5FTNA 5C9ZA 1JAZA 2CK3A 3V46A 4AP9A 5C1BA 5HRCA 2QMHA 3WGJA 1K92A 3I39X 4LSWA 1JPUA 4I55A 1TECE 3WK5A 1EJ6A 2FPMA 1Y34E 1VKJA 1NLYA 1WPXA 2A5JA 1GZUA 2CBGA 3HFSA 3KOYA 3I05A 5LB4A 5K03A 2QL7A 1YQGA 1RVDA 1CC1S 1GEEA 1JPVA 1PV1A 3DOIA 1P2FA 2C9CA 4M1QA 2B1GA 4D4KA 2FGJA 3F7NA 4YB8A 2JCVA 5IYZF 2Y77A 5AP9A 5G1OA 1LF0A 4M6WA 1SXJA 4US2R 4KOAA 2L18A 2IJGX 4QFDA 4DCNA 4Y9SA 2C5AA 1XD2A 4Q4AA 5JW6A 2W6ID 2G8LA 1B1AA 3PK0A 4I1IA 1ZU4A 4QDZA 3G17A 5FKJA 5TGZA 2PMEA 1E0DA 3OJEA 4LSZA 3ANNA 4BEBA 1CJUC 4JITA 4DCUA 3KQUA 3DOHA 5KC9A 2D74A 4AMGA 3M0EA 4KU4A 4PZYA 3EF0A 4YV1A 4LNAA 1MN6A 1H42A 4RVUA 4A10A 5ICMA 4BNWA 1LX6A 2RHWA 1CUCA 1U7WA 5FPYA 4CV1A 1TAUA 4CPDA 3V8VA 3AEYA 4BAZA 3WMWA 5JWOA 4IDPA 3QYPA 1JE0A 1G21B 3KVYA 1E2EA 3AERB 4IJ6A 2AXEA 4ZCLA 2D0OB 4CIXA 3Q12A 3DD1A 4Q37A 3L0SA 3DE6X 5LUAA 4TUYF 3GAZA 4EYEA 1AKMA 5K2MA 1MB3A 2M6RA 1UOOA 3O4IA 4KB5A 3C14C 4X9XA 4JV5B 4BQOA 3B82A 1WVMA 3ABRB 3PKZA 3CIFA 4EKGA 3CX4A 2EL9A 1H23A 2DJ5A 4IGIA 1C5KA 4ZZ2A 1LLDA 4WK0B 5THXA 1S9DA 3QI7A 3L4BA 2FVXA 3IBYA 4WKPA 1AK9A 1OI3A 1Z07A 2F67A 2V6JA 3ASUA 1T43A 2GWRA 1A1SA 3O4FA 4M99A 3VH3A 4EPYA 4JBWA 4EKIA 1B2LA 1YBMA 3HJAA 3NCTA 2Q3FA 3MJSA 4XRRA 4DM4A 2ZQ5A 1I30A 3RUAA 3NWPA 4OD0A 3JVIA 4QOFA 2XB4A 3MIZA 2CY0A 3LK7A 5PGMA 1RYEA 5T64A 3AV3A 1NGSA 4OKIA 4NL4H 2KJQA 1O4VA 3OJCA 3PNOA 3QOWA 3LZDA 4QO8A 4EATA 5DFAA 4MQ6A 1WCIA 2H6EA 1BXGB 2O2IA 4O4JF 4UBKA 2CLLB 3KKOA 1YR2A 3SSNA 4ZGWA 3X1KA 5I7VA 2PUCA 3OQ1A 3KTFA 4D5GA 2OWDA 1AJEA 4IOJA 1NN5A 3QH4A 1YZGA 1GCGA 4NZNA 4OHFA 1V96A 3DDUA 3NETA 2X5OA 1VBKA 2MOKA 4MGHA 3RTAA 4O5AA 2XCRB 4LV5B 4L5AA 4IVQA 5IVKA 2V9ZA 6REQB 4PZCA 2WG1A 3KPYA 4B48A 3VJMA 4I36A 4KXLA 2Y71A 3E2IA 1NQOA 2WSBA 4UHJA 3LKDA 4MQBA 4GLJA 4BNHA 2NG1A 3KD2A 3W3AA 4ND3A 2GHQA 3PPVA 2KM1A 5EOVA 1C4OA 4XIGS 4WBXC 5HWSA 4OJTA 3MZ0A 3BL5A 3F5DA 5J1SB 2ZUSA 1I7DA 3SR4A 4KRFA 5KYWB 2D1RA 1FX0A 4IXDA 1H0SA 2F2TA 3OOEA 3W5VA 4EGAA 4F6RB 1DMSA 5JPCA 4QYSA 3TX6A 5JJLA 2BGWA 2V5VA 2I7DA 2H0QA 1JLLA 1LTHR 5IVPA 4RUKA 4XM1A 1PD0A 2P30A 4DCPA 4A0GA 4BXOA 4F2GA 1ZLYA 4XDHA 3ZDAA 4KNVA 1X2BA 1TM7E 2BP7A 5CXXA 2QP4A 1SUSA 4MYSA 3KPVA 2HD4A 2YW9A 3P8ZA 1NXSA 4YXWD 3UXEA 4KNYA 3L7DA 2DKFA 3Q5DA 2QD5A 3BWYA 4KH1A 4BNXA 4KR6A 4CCWA 1KK0A 3AKZA 4N03A 2W58A 1T3ZA 5DHTA 2EZ8A 1ZDMA 3DM9B 3CT4A 4HAIA 2AG1A 1UZAA 2C2WA 3AILA 4N0DA 3TLXA 3C5WP 5HDBB 4BWFB 1FJGB 3M5PA 4PRKA 4TTVA 3QG1A 5BV7A 2P3QA 2O23A 2BWJA 3LHDA 3N75A 5MDHA 4IGFA 5LMCA 3RREA 1L4FA 4OATA 1O97D 2XWBF 4NI5A 2YWEA 4RU1A 1UF9A 3W8FA 3HKEB 2ZXEA 3S7TA 3U40A 1VLQA 4HB0A 4RIIA 3P9SA 5DHUA 1EJ0A 421PA 1VFNA 4BFTA 2JJ2A 1N6LA 4FN5A 2JK0A 3FYDA 4YFYA 3PPYA 4LY0A 4B75A 3LBYA 1XQXA 3M3DA 2C96A 3Q7RA 1TCVA 2XDAA 3CZ9A 4D74A 4KPYA 2V6GA 3H75A 4GMKA 5A7FA 1NJFA 2J7KA 1OXBB 1PLJA 1A9XA 1RQPA 5DM1A 2NQTA 1RKXA 4NZOA 4Y0NA 2X0IA 4TVKA 2I2WA 4WBSA 5EJIA 1KJYA 1PS0A 1Q0LA 2CUTA 1AX9A 3A6EA 4MV5A 1B16A 3EVFA 4RTRA 3RARA 4F11A 3UTCA 1YDWA 2BFFA 1P19A 5E4FA 5K3DA 2DM6A 3VI3B 4UM5A 4NNOA 4PZ0A 3NYIA 4C4RA 2B25A 3AM1A 2R8BA 3EWIA 2P7HA 3AOEC 4WUTA 3UGTA 3UYLA 4L5JA 1UKBA 5LZ7A 4DARA 3M6VA 1I4EB 1YS9A 5LPNA 4DV4B 2EF0A 4RMIA 3ESZA 3Q1LA 3UUWA 5KVQA 3U0VA 3QA9A 4CBVA 2P91A 3NHZA 1VKHA 1S8OA 5HBGA 4JUDX 2PWZA 2C07A 4HDAA 4MTLA 1E3MA 3KYCB 1MIOA 4HJXA 1W47A 5EVCA 4LAFA 5TMEA 4HP8A 1JWBB 4IDOA 3COZA 3LM8A 3OQ6A 3LGSA 3KVOA 1HGXA 4AMZA 4EHFA 1AO0A 3CKMA 1P60A 3ER9A 3BE5A 3KKZA 4JEUA 1IIBA 1XRSB 1OWOA 2HLNA 4GZ3A 4XD7A 4CKWA 3SAJA 1V37A 1MX5A 2WIDA 3A1VA 5LQKA 2ZTMA 2JLXA 5C51B 2HCJB 3OF2A 4RA9B 3A1UA 1NJSA 4K8RB 3H8VA 5DDIP 4RZ2A 3GNLA 4JP2A 4KLZA 3ELYA 3OO0A 2XT9A 5FAXA 1KEEB 2YOHA 4BZPA 4UPDA 2ATCA 1SO8A 1W88B 2H54A 4M21A 3H5NA 3SF0A 3R9KA 3ANXA 1S9HA 2AQIA 4NFYA 1XAHA 4Z2YA 3VISA 4DSNA 4MR9A 4DDUA 2VJDA 3N59A 5K4HA 2FX3A 3L7BA 5FBLB 4WFKA 1PFQA 3AB7A 5BNFA 4N4AA 2VQ6A 1EAYA 4UEWA 2P2YA 1Y9JA 3D8BA 4MINA 4WZBE 1EK5A 4KPGA 3FKQA 3RRBA 2PYZA 2EFHB 3PC8C 1DLJA 4Z8XA 4QJBA 3FJYA 2R6AA 4GBMA 1A4RA 4R41A 2R7MA 2PKWA 4LJYA 1AXGA 5E6SB 2DFDA 1CUUA 3NVAA 4MI1A 4LOJA 5BMVF 4ZVKA 3V7FA 3U1TA 1ZH6A 4LOHA 1MT3A 3C1AA 4EG6A 3E9NA 2V9CA 1II0A 1YB4A 3NDPA 3KL2A 1C1YA 4YALA 3SEAA 4OL0A 5FI1B 4R98A 1WMEA 4TLEA 4YJHA 1QB7A 4N39A 1HE2A 2ZXFA 4JXJA 3EVEA 3WRVA 1NNSA 1ZK4A 2AJLI 1UCFA 2NSJA 4QAQA 3SD7A 3N8NA 1IN8A 1WW3A 3DFFA 4MQEB 2B4YA 1DX4A 2VHJA 5ARDA 1VCHA 1Z7YA 2NUPA 4ATNA 2XRZA 2RKWA 1TK2A 1GQRA 1PFVA 2C8KA 3G0DA 5JAHA 4JDPA 2XODA 3P52A 1KMIY 1DIRA 4WIAA 3TW4A 4CCYA 1XJ5A 3IBGA 5EKSA 1G7SA 1R5OA 2GEVA 3CLSC 3HKEA 2NO4A 2HHHB 3AR5A 4GIBA 5ALRA 2I78A 1JU4A 4PPQA 2H8GA 1JAXA 1GD1O 2HF8A 1SHLA 2ISCA 1OVMA 3UB3A 2IH4A 1ZXBA 5DGDA 2A4KA 3OFND 4OK5A 4CQMA 1VDZA 3G88A 1J8VA 2XKJE 3VNQA 4OVKA 3FPBA 4FEAA 4F1JA 1LC0A 2J4CA 2ZUEA 4EY4A 3C1TA 2C57A 5DLDA 3GWZA 4Y2HA 5I47A 1N4AA 2ACWA 3VR1A 3WSWA 2YQ4A 1FJXA 2GA9A 1SKAA 3NEAA 2EBWA 4WDQA 1NYQA 4D9IA 3KWFA 4LOKA 1JECA 2NO0A 3GEPA 4PVCA 4GAEA 2AOTB 5KTTA 4OOEA 3HH8A 3ZY6A 3R0XA 4K3UA 2R6ZA 4D45A 1RRMA 2DBZA 1FP4A 1JF8A 3ENNA 3EIFA 3JWPA 5HCUA 5LYJB 2Y0EA 2QZ9A 2VDWB 4MZDA 1X13A 4ZCQA 3NBFA 5LCXA 1CUEA 2R3SA 1J2UA 2C9MA 1OXMA 2ERCA 4EI2A 1C9JA 4PN7A 2HDOA 3PC3A 2I8LA 3UJNA 1SXJD 2GEDA 4QBKA 2JIZD 4RDHA 1DIHA 4WLEA 2D0PB 3RYCB 3K9NA 1U3UA 1QQAA 2VTEA 3H86A 1CEQA 2C5HA 3VV2A 5JNSA 1MR3F 1U1DA 5D3QA 2Z0MA 4CM8A 1RRPA 3UUEA 5KS2A 4QEKA 4QXRA 4FOLA 2ZUTA 4DEYA 3AJAA 5EL0A 1IY2A 3SC4A 4A03A 4XQ0A 3HB1A 2C77A 5LQJA 1CD5A 1IM2A 1DC4A 1HDYA 2FQQA 3GOHA 2IK8A 2VZ9A 2C9YA 3EGEA 3NW9A 4G97A 5DGTA 3MTEA 4JQYA 2VHTA 1KI9A 3RSFA 1NKSA 2GBFA 3A2MA 4NABA 4V03A 5CYGA 2K6GA 1SG6A 1T2VA 3E9YA 1N2IA 4R8RA 3RU7A 4ZI7A 2KE5A 3LWDA 1USIA 1V43A 1MIOB 3QVKA 4UUPA 1SZCA 3W2EA 5EGSA 5D1HA 2R5FA 1NC3A 4XWWA 3A4LA 4FHZA 4U7TB 1IOZA 1XQ6A 4JY7A 1IONA 1P0QA 5KVAA 4Y0AA 2ZJYA 4Q5IA 1RLMA 3R6LA 1C8VB 1M66A 3B1JA 4BX3A 4Q3BA 4IQ4A 4KQMA 5G0TA 1T0JB 3O9VA 1XXHA 5JDCC 4J4BA 4C7OB 3UHJA 3MWEB 2HJRA 3ZYCA 3MERA 3G1WA 4QE3A 1BYUA 2XXJA 1WPGA 4DLBA 2QMUA 1FYFA 4P8RA 4UU8A 4QICA 4EHAA 4EY3A 5JQWA 4ND6A 3RVRA 4JI3B 1E1RA 1VXRA 4DLRA 4EJSC 2WOJA 1E1KA 3OOYA 1QH8A 3AO0B 4FHEA 2FE4A 3ELBA 3ZLTA 2OM6A 4H6XA 2Z5FA 5AXBA 5CVEA 3UA3A 1DUVG 2AN5A 2HDHA 4Q3DA 4KK4A 4ML3A 3ZWVA 1N6HA 4MPPA 1UBKS 2FWNA 4YLGA 4ZYWA 5K8JB 2YASA 1KO4A 4K86A 4X90A 4BFYA 2W2NA 2NO6A 1EQAA 4L72A 2GESA 4D0GA 3II6X 1NT2A 2GTHA 3MRXA 4XYMA 2GSDA 2ZITA 4H0NA 1H2XA 3GA0A 1L5GB 1RMQA 2Q2NA 2D6FA 5CVTA 2J0UB 3AV0B 5SYMA 2SICE 3Q10A 4C6HA 3AP3A 5KYXB 2G36A 1YRQA 2FHPA 2NTVA 1JT2A 1ZVJA 2FRDC 3A11A 1WUIS 3KQMA 4NJEA 5CH3A 3REOA 2HX1A 3MRSA 3VYRB 3IAS6 5EXXA 5IULC 1KP3A 4U0KA 2AT1A 4I9GA 4LY6A 1O7JA 3V8MA 3ZGYA 4EGFA 2H63A 3E23A 2I34A 1ZUIA 3VYVA 3L0OA 3A9RA 2ATXA 1IVYA 4QGBA 1E7RA 2Q7DA 3WGZA 1KJQA 4D8XA 5I45A 2NVOA 5BNTA 3UHFA 2WF7A 3T12A 4LTDA 3TNJA 1HE1C 3UOWA 2OVFA 4B74A 1A7UA 4ZD6A 3HBJA 4FK8A 4Q3OA 1C0LA 5DMXA 3W8EA 4AF6A 4RDXA 3A36A 5M2QA 1I7SB 2YFHA 1BHO1 1OA0A 3ESRA 5L6MB 1WW8A 1FK8A 2FPXA 4KHZA 5AVYA 1P9RA 3C3YA 3QOYA 4Z7NB 1PJ3A 3GJTA 1XLWA 4KYIB 2PHZA 5KX5F 2RGDA 3LU1A 3AU9A 5AW6A 4TT3A 2QYHA 3RM3A 4A91A 4GI3A 3AIMA 4D9EA 2ZJOA 3TJRA 1YTUA 2WJJA 4FOTA 4BVLA 3PTLA 4JLPA 4DCMA 3ZJ4A 2ZSEA 1WS6A 2JG3A 2E55A 1L5MA 5KDOA 3S29A 3KAJA 2A3NA 1Z38A 1MB4A 3GO4A 1LX7A 4WN3A 2JJ1D 3OU7A 5EE0A 3YASA 1XTBA 4C4ZA 1VGQA 1H3EA 3CJTA 3PQ7A 4HNUA 4C7OA 4Z7JA 1ESDA 2JAXA 3HU3A 3G5MA 1CR1A 1G5IA 4EBFA 1M54A 1HWYA 1TMGE 3HLKA 1JSZA 2RSLA 1WZUA 2J1LA 5F21A 1P7ZA 4OM7A 5F4ZA 3SC6A 1GQYA 1WOYA 2WYWA 1EFRA 1KEVA 2FSUA 3ZWCA 3HQ4O 1R37A 4JJKA 2IWRA 4QUEA 4EGQA 1Z39A 1XTZA 2BH9A 2XJ4A 3T61A 3M4NA 4M9QA 4Q6BA 5BN3A 2E4UA 4OLFA 1K8ZB 3KQTA 1BU8A 3S27A 1IN6A 2QM8A 1KJ9A 1GTJ1 5EE9A 2JCSA 3QU7A 3L9XA 4GFDA 4O2AB 4YV2A 3RJTA 1VYTA 3QKRA 4MWOA 3N74A 1P6XA 5BR8B 3EGXB 5AW0A 4ZRMA 3TQOA 3B6MA 2CJFA 2HBYA 2K87A 4FYXA 1ZUWA 1ESNA 2Q3HA 3GUHA 4MB2A 1ZCBA 2PLWA 3G79A 1RSZA 3MPOA 4H18A 4IFTA 4PFJA 2B34A 4YP6A 3RSGA 5EIXA 4RTOA 3LTEA 1KVRA 2FMIA 1MVNA 3HU2A 5IBPA 3PD0A 1NQVA 1Q1BA 3FUWA 3QMMA 1P1RA 3GRFA 4ARAA 3HYTA 3EVGA 1D5WA 3PNPA 1IXYA 1MW8X 1AA6A 1NI4A 2PSEA 3P9YA 4LDJA 4F3YA 1DJPA 1GUAA 3H4TA 2FFHA 3SMVA 1A7KA 4G2NA 2GNOA 1S2MA 3PGMA 4D99A 2ZUCA 2ZDHA 4DM7A 5CJPA 1X2EA 1EJ2A 5ALNA 2WP8J 3IJEB 3S2SA 2QMYA 4Q7QA 3B1VA 3N5CA 5I51A 3B9PA 1U0LA 1Z3IX 1KEZA 4EDFA 4L9SA 2G1UA 2WR8A 1FFBA 2Q27A 3KCQA 5FA5A 3WP1B 4ALLA 3AJRA 4W6QA 3EFOA 2JFWA 4DR3B 4LJAA 2AQKA 4BYMA 4D82A 2ID4A 5B36A 4DWWA 1MQAA 4G01B 4JQOA 3MT7A 3DDSA 1T8YA 2AA3A 2CE2X 2G71A 4JKIA 1Y3FE 1TQ8A 1EINA 1IQPA 4M9CA 1TCBA 2YS7A 3BZWA 3D8UA 1S8AA 1U3FA 1R0YA 3DMYA 2BFDA 2RC5A 2IYYA 4H17A 3EDQA 4H08A 4BYGA 1I24A 4KVAA 4B4KA 2WBLC 2NSYA 2E6UX 2QQ5A 5B37A 1MAWA 2PBFA 5TMDA 3R7FA 3ZGOA 5JMTA 2O8EA 1JI0A 5EXSA 4DMHA 4NMMA 3ZWAA 1PZHA 2PMFA 4BLQA 4FDAA 1I1HA 3A4MA 4NYIR 1EDOA 2QUZA 3FDZA 4G86A 4JVLA 5EA2A 4DLNA 3QYAA 4ZYZA 2QT0A 2J3DA 2Z8ZA 4V24A 1XWIA 1SN7A 4RH1A 1JKJB 2P1ZA 1M67A 3ZCXA 3TO5A 2MYUA 2GN9A 1XWFA 1WAMA 2PD3A 2DGDA 4C7KA 1U8YA 5EJ6A 1RXWA 3RBVA 1OXKB 3N6VA 4BBJA 2C2YA 4QYIB 2W7TA 4R9UC 3SPXA 5KTNA 1O3YA 5HQ3B 4Q00A 3N1UA 3NIWA 3IE2A 4X8MA 5AK6A 3UAZA 4FMPA 3RVQA 3PQ6A 2C84A 5B12A 2DJIA 2PTHA 3NBYC 4LK2A 4O2BB 2WHRA 1KQ3A 4FKZA 4KEAA 4R3NA 4RJJA 3ZGXA 2IP4A 4JK3A 2DWCA 2RIRA 4RVOA 3ORSA 2WQ7A 3WJ7A 3WRXA 1VBNA 3VNUA 1MAVA 2GWHA 5ITSA 2J46A 4OI0A 1JG4A 3UMCA 3HGTA 3TLAA 4DNOA 5CT9A 5LZ5A 3FA2A 3ZDXB 2HUNA 1ZAYA 5LQAA 2MTBA 3AX6A 4HXEB 3U16A 2WWWA 2KYRA 4LJKA 4BNYA 3SXJA 1XIVA 3C8DA 4QJ5A 1X9IA 1LNQA 2F3PA 3EH2A 3HL0A 1Z47A 2KWIA 4K9QA 3D1JA 5GJCA 3W9YA 3RW9A 4YXFA 5H3CA 1QF7A 2B3DA 3KBBA 3LO8A 4A8JA 2G83A 4MV4A 2G28A 3AUAA 1P7CA 4MKXA 1ZUNA 3N0XA 3AGQA 2ZIGA 3JYHA 4K9OA 4UJ5A 1M34E 3P20A 3SIXA 3U37A 3O2QB 3E15A 2XUGA 2HSJA 2QJWA 1HR0B 4G5YA 3U31A 4KAXA 2HTFA 1C9EA 1L4GA 2Q0SA 4GBGA 3HGMA 4WNYA 5AJYA 1K8QA 3VOAA 3L7CA 3SOPA 5TV2A 2C5GA 3TFQA 3ROZA 5HJEA 3R40A 2BCEA 4LV8B 1YZQA 3AXSA 5DB4A 2GRAA 3MTGA 2R2AA 3HEAA 3P4XA 1FU8A 3CN7A 3D81A 4H7PA 3VDQA 2OFOA 4U2EA 3ZCSA 4LYJA 5ALVA 3DP7A 5EJMA 4XM0A 2W2LA 3VR5A 4E2YA 4DA4A 3MUNA 1T8SA 4C0QC 5LP6F 3P9NA 4RJKA 4IAOA 1TVEA 3PXGA 3JVEA 3GZ4A 5KOHB 1X80B 3OO1A 3QKRB 1EP1B 3C85A 4HS9A 3WWYA 4YRBA 4FM9A 2IHUA 2TYSB 3NIGB 4XA8A 1WLYA 4L8YA 1GPH1 1PZFA 2YS6A 3BSFA 4A16A 1HNWB 1OFGA 3LUFA 4QUBA 2XGGA 1UJ5A 4JYCA 5AM0A 4PZAA 5AR1A 1DTSA 1XDZA 2GB4A 2ZI9A 4HYTA 1RWBA 4NBTA 2JRLA 5F12A 3UC5A 3C1UA 5CA1F 3IP9A 4F7DA 5A9SA 2QQ0A 3QW2A 2DKNA 1LSUA 1RWNA 3HVIA 1V6AA 3ITKA 1VLMA 4ZVMA 3VI4B 2NU8B 3UKJA 1LJ8A 2C5FA 4MJLA 3H5WA 2R6R1 4O4IF 1KF0A 5AKJA 3QY9A 1EUZA 3EQ2A 3OEEA 4PPYA 4C0HA 1IBCA 4CUKA 1HT2E 4BB0A 2GARA 3BEOA 3N2LA 4IW3B 4UDNA 4AI6A 3DPIA 4RVCA 1PTKA 4I9HA 3MTJA 5K6TA 2GCIA 4HZUA 2Y9PB 3FPCA 5EKDA 2C54A 3BC1A 4MR8A 2O3JA 3PFIA 2OXFA 4WKOA 1GM5A 4GECA 1AH2A 3Q3IA 5I4CA 1RJDA 1GGKA 2AE2A 5AKLA 5KC8A 4IDDA 2ZJ3A 1JQ3A 1OHHD 2OXTA 3DZGA 4GR4A 2HMUA 1N5RA 1R6VA 3LLVA 3DVSX 1IN7A 4G8JA 1RMYA 4IIGA 4NYJQ 1M74A 3FLMA 2CFTA 3QF4B 4V0ME 4YPOA 3PT9A 2WUDA 1UIMA 1J42A 5DYWA 4XWGA 3VYTB 1AQNA 1YACA 4AY2A 5AM3A 1Z0ZA 2Y3IA 4NK4A 1UDAA 4PF1A 3R6DA 4J94A 4XYBA 1AKWA 2DR3A 2Q4RA 4XGRA 1BMQA 4DCTA 1ND6A 2GM4A 1I51A 4IXTA 4FQ8A 1G6HA 1FFDA 5EGNA 5U4XA 1LZKA 5JJIA 3GLGE 4KBGA 4ARUA 5HUJA 4EZIA 5JY6A 1Z7BA 2C2BA 3WV5A 1F4VA 3ZE8A 3K15A 5L6LB 4G3XA 4D6XA 3GFPA 5B1SA 4OGFA 1SQ6A 3R7LA 1XAIA 4GOMD 4TPKA 5LDGA 3ZDEA 4ZMBA 1V48A 3K6SA 3BJEA 3SI7A 5A3QA 3R9WA 2AFRA 3JQ8A 4P31A 4Q9DA 4K6CA 3U5ZB 3HUDA 1NF8A 3E6AA 3MRVA 1E99A 1JV2B 3BRCA 2E1RA 4RFLA 5SYNA 4PGFA 2QKYA 2C3UA 2H1WA 1MLDA 4IH9A 3W5JA 4HAYA 4WPGA 4YONB 4EB0A 1J2YA 4EIWA 2AQ8A 2XUHA 2ZWVA 4JJGA 4KXVA 4MHSA 4ZV4A 1V5EA 5FTLA 5CG2A 1YZ3A 2HMVA 2I2FA 4CXMA 1TYAE 3DV0A 4AXXA 2Y0CA 3ERCA 1YU6A 1JTEA 2J0UA 4ZT7A 4CUJA 2NO1A 5LKAA 2HHAA 1IUOA 2VSQA 2OUKA 3G8YA 4PLVA 1HNNA 1XMPA 2H1SA 2HN9A 2HQRA 4Q47A 1Z5OA 4OHCA 5BPHA 3BFXA 2YVAA 4XUDA 1GSHA 2AXQA 4ZICA 4JBLA 5CXSA 1NAIA 4WK4B 1ZA1A 4R69A 2JHFA 1PWZA 1KI6A 1JYEA 1WB6A 4MGYR 3P0JA 5FPSA 2FF7A 4E2XA 5JDCA 4C88A 1DINA 3WWEA 3ZN2A 1ISSA 1T35A 4GPZA 1BOFA 5JO9A 4RH3A 4DA8A 3WY9A 5DTMA 3PDHA 4F1KA 4QYMA 3RC9A 4RS4A 1NE7A 1W5BA 2ECQA 2O2EA 1F8UA 4N0MA 3U9TA 3QLTA 2V3VA 5LOVB 3VHRA 1KHTA 4JT4A 1XCBA 3GC6A 4OYYA 1I4OA 3FVRA 3BHIA 1W44A 2B1JA 3DAPA 5HM8A 1PNQA 1SGWA 2F64A 1BQ4A 2FDXA 1KTVA 2WF5A 3H2SA 4U5XA 3M6MD 3Q72A 4LY9A 2QRLA 1MC8A 4MR7A 4GWKA 3TYXA 1E1CB 1TYDE 1JG1A 2MDTA 1QV7A 3SZRA 2WVHA 1J6UA 2R11A 3S0JA 4G25A 1MFPA 2B6HA 1MVLA 3EC2A 1GDHA 3WC4A 3CLTD 4YCAA 5LYYA 2BAGA 3PFCA 3PJGA 2WAOA 1TU3A 1Y5MA 4FYKA 1TKBA 2WG0A 4RSHA 3RC2A 3SY8A 4C7JA 1GLVA 4FGJA 5T6BA 3ZJUA 1CW2B 2KLHA 2WEKA 3IESA 3DGEC 4IILA 5F9FA 3TW8B 4QLAA 1GGJA 2BELA 4FIZA 4RL6A 1YVRA 3IIJA 1GCOA 1Z5WA 1ZOLA 1ZVKA 4NYMQ 5L4LA 1YS4A 2EKZA 3GPDG 3ZIAA 4UD6A 3I83A 4QTUB 1BGWA 1SD1A 4L5IA 3UJHA 2XOKD 3QXJA 2GYUA 2WJVA 4LOLA 4U6NA 1DEAA 4I4TF 5EIBD 1FVHA 1L5QA 5BVHB 4P0PB 4IMRA 3SVTA 3VNVA 4HRXA 3VDMA 1HF3A 2G0AA 3O21A 1J39A 3LIPA 4KUEA 3AUUA 4UDOA 3WGIA 1A8HA 3AF2A 1REQB 3HCPA 1JFVA 1RM5A 3QKSA 5DYYA 2NU6A 2JLCA 3W1WA 5EHGA 1KNQA 2UYQA 1C1XA 1XWWA 1MZPA 3TTWA 2I7CA 5KPDA 2CLIB 3F1KA 4M0LA 4YC7A 2WAYA 4FHFA 4NDZA 4ZP1A 3R7WB 3TEFA 4S04A 4JI8B 1E9FA 1YK0A 5C7IO 1W6UA 1DJQA 3P97A 1BEZA 1L5KA 5C8YF 3UJAA 1EFUA 2AR0A 3QF4A 2I4RA 3UPUA 1ZHHA 3Q7QA 3D8TA 3L8DA 4FGZA 3L6CA 2IVFA 4DMLA 1E0JA 3K0AB 3GZNB 3A9UA 5TPZD 1P2VA 4UZSA 3ZQJA 1O08A 1I3LA 3HZRA 1YBAA 3PQCA 4TSKA 4DPMA 2WTBA 4BMSA 1M2WA 4RLFA 5K01A 1W76A 2DMRA 1SOVA 5CFOA 1MO3A 1YBVA 2OZLA 4YDSA 4D56A 1DARA 2ODAA 3PR2B 4E32A 3HJBA 1QANA 3OPQA 4IG4A 1GNVA 4IZ6A 3TCXB 1GCUA 3O47A 1F3OA 3BGDA 4I5FA 3W9UA 4E7OA 5CFRA 5FL3A 3O75A 1ODCA 4IJVA 1C3EA 3AYXB 1X7YB 1T8UA 5GONB 3RU9A 4DJJA 4YYZA 5FI5A 1U7PA 1SXJC 2F8SA 4MUIA 1KKMA 2Q28A 3FFTA 1M7HA 5DBEX 3RT9A 3WNQA 3OCYA 4JLMA 5TQ2A 1RPZA 1C4WA 1FDIA 2Q3CA 1VL8A 2C4HA 2FR8C 1Y9DA 2HQ1A 2ZRJA 2FUEA 3EGCA 4ZAXA 3TMAA 3TXXA 2OHVA 2HSDA 3B1ZA 2O2ZA 3DMHA 4N6NA 3A14A 1SVSA 3C6KA 2CDRA 5IJ0B 1AMUA 1L8XA 4HDRB 4W5NA 3LDFA 4EAQA 3ZCPA 3PSAA 4CQMB 1X15A 2H5EA 3WGUA 5AICA 4C29A 3FUVA 2VAWA 4TTIA 5ENDA 5AJHA 2BFAA 3V8BA 5H7XA 4BWVA 1V11B 4XJXA 3TINA 2CL7X 1CNMA 2Q5FA 1JFFB 1KERA 1Y8RB 2A4MA 3EQZA 4I1VA 1QPGA 4JKOA 2HJHA 4X00A 4PFSA 4FB5A 1A5AB 3O8DA 1TFRA 4N7MA 4M2LA 3NBZC 4J0FA 4B4WA 3RC3A 2NV2B 3A9WA 4MQEA 3WVNA 3KPJA 2GM5A 4GDMA 2OSVA 2IIQA 4KXMA 4Y7DA 1YNSA 4RXUA 4REQB 4U7HA 4YK7A 1ITZA 3PFBA 4BVGA 3TG8A 5DWDA 1HYEA 2YIMA 521PA 1HK7A 4BLSA 4IBOA 3JWGA 3E8SA 3BDVA 3G2HA 2J5KA 4HAXA 2BMJA 2FI1A 2V58A 3BHMA 2PMBA 2WWVD 3RSHA 3S2ZA 4M6WB 2QRGA 4YAUA 2HCBA 1RI4A 4J4TA 1PFUA 1V71A 1W1WA 3JRNA 5BURA 4AS3A 1A5SB 3S81A 1D8TA 3PQ5A 4FYIA 3QG5A 3RWBA 4B2PA 5HIKA 4U0JA 1KDRA 2Q6TA 4JI2B 2LIPA 3I58A 4ZQHA 4WOPA 1HLGA 4YCMA 4G0XA 4B6GA 1Q12A 3VR4D 1G1MA 3E3MA 4TL9A 1PIWA 2W9XA 4EGJA 5JQGB 1E9RA 1J0AA 3ESQA 3WGQA 5FJIA 1KK1A 1A8PA 4W1PA 1C9KA 5DGXA 3FOEC 1N1MA 3PEFA 3CRMA 1L5SA 3IAS1 5DNUA 4X65B 5EEGA 1GPMA 4TKZA 5DN6A 4ZQBA 2X7JA 4EJFA 3A1NA 5DRYA 2CVZA 4YDRA 3G13A 4BIIA 1ULBA 4A3SA 1LPPA 3A32A 4D81A 5C4MA 4YJDA 2B7BA 3EWNA 2N0SA 4MROA 1K88A 2I3DA 1V5FA 1EIZA 3Q0IA 4GO1A 3IRUA 4HWPA 1WZNA 2O59A 3I76A 3MAAC 3T5GA 1NG1A 2YIVX 4B3HA 3FWHA 4QT4A 1N8KA 1XEWX 4RSGA 4UUBA 3RNLA 3UATA 4LJRA 3D59A 4ZPJA 4ACBA 5GGXA 3ADBA 1WEHA 2QEQA 1KXZA 1RQLA 3BIWA 3H99A 3KT3A 2ODPA 3ESCA 5DHRA 4BQQA 4CL0A 2CFSA 2QI9F 4EZBA 1S7CA 3RUFA 1AG9A 3A4NA 2JAUA 4IEEA 2A6PA 1UPAA 2CMFA 2JCYA 1NQXA 3PR1A 4JJEA 2YJZA 4UREA 4CTMA 4YQFA 4HWKA 2IWHA 2FW8A 1EUCB 1E96A 2DX7A 4UJ3A 1YK1A 3S2FA 2O8EB 1M0SA 3IHKA 4M1MA 3VZQA 2B2CA 5JAOA 4NE2A 1SM4A 3AP1A 5BSVA 2HRZA 4RK5A 2XT6A 3FZNA 1DXOA 1M5UA 1TVKB 3FFXA 1SXIA 4EI9A 4ZXPA 4UAGA 1FYXA 2JB9A 1Y8QB 5KQSA 2Y99A 2DT5A 5FWYB 4CTOA 1Y8ZA 2J4DA 1WR8A 2IS4A 4J75A 5GP1A 1KI6B 2H08A 2IP2A 1AHPA 3CS3A 4RTSA 1XU9A 1NVGA 1ZCJA 3BYZA 4QQ8A 5SV2A 1GQSA 3BAFA 4BO3A 3AM4A 4F1WA 4HVLA 3VZSA 2FAXA 5HW0A 4MYHA 1JA1A 1D0SA 3GFOA 1F0KA 3KSUA 1FUIA 2VSXA 1XD2B 4Q4AB 4X1YA 3ZE2B 1GAQA 4FKBA 4JYBA 4XOUA 3LA8A 4IVNA 4UVIA 3RABA 1V16A 2BMAA 4PO3X 4KR7A 4B4UA 1F6BA 3ADOA 4RANA 4C4TA 2A9OA 3A2LA 4LMBA 2E89A 4HDNA 5DNDA 3L7AA 1T9ZA 4RM3A 4YMUA 3O90A 1I2AA 1B0PA 5JZ9A 4LX0A 4UULA 3OCCA 3TVDA 1B8UA 1QWSA 2IBMA 1FY2A 2C0QA 2DUMA 3QE0A 4J2OA 1NXTA 5DTEA 4BX8A 3P7MA 4AY6A 4OX9B 1PQUA 3W2FA 3H1BA 5B57C 3EISA 4X6XA 4J1NA 4BMDA 2HZBA 2PX0A 1OGYA 1SOUA 3KQVA 3NC0C 3QOXA 2RAPA 4XQGA 2CV2A 3GFRA 4BC1A 4GOLD 3B78A 1E1YA 2BW0A 3DXYA 4DC1A 1JQDA 1LRLA 3UG7A 3RG2A 1WO8A 1H4VB 1PL8A 1TEZA 1BXRA 1XPJA 2H4FA 3E22B 4C2TA 4EYSA 2QAJA 4HK4A 4CWAA 5J2TB 2GPWA 1GT91 1RKUA 1U0TA 2QORA 4GL4A 4KIWA 3DHWC 3L5OA 1WCWA 5ECDA 3P71T 1EFCA 1LWNA 2QY6A 4PRZA 4RCVA 4IZIA 4RNCA 1OBHA 1U2TA 2F1HA 4WNAA 5DNCA 1I2CA 3L6DA 2IZOA 3DGFC 5AOVA 4LV6A 4K9DA 2BFOA 4INOA 4C6RA 3SQWA 1N1DA 3DZ8A 5KDLA 3BB4A 1HKUA 1O95A 3L7MA 2P41A 2O4CA 2QLBA 3N0WA 2PRIA 1FNSA 3H2YA 4HAOA 4MSUA 3WB2A 3HJFA 4F9EA 3CVYA 1RYMA 3L0CA 2QG6A 1GZ4A 3GDWA 3AKCA 3BK1A 3ZCTA 1M1UA 2X5NA 1X94A 3R41A 4CMAA 4DV5B 5GZ6A 4RHTA 3QUQA 1YKSA 2GAOA 2VYNA 4LNHA 3VSAA 5HSGA 5K0JA 1X1AA 4LQLA 1LSSA 1BSVA 1KAGA 2HJGA 3FUXA 3KYDA 3VU8A 1XNJA 5B2ZA 4X5OA 1H3FA 5IAAA 1BRMA 3R8CA 4PYOA 1QMPA 1I6LA 1TPZA 1TZBA 2FSGA 1ZGBA 2X3FA 3CURA 3ELUA 3H2ZA 3KJZA 1KK2A 1RC1A 2E4YA 2EQ5A 3ECSA 3HJTA 3LBHA 1TUGA 2VTBB 4CV3A 2MT9A 2BI7A 2WLSA 2ZETA 3VO2A 2NUAB 1RPTA 3R5HA 5EPOA 2WWHA 1TAGA 1QDLB 2Y1KA 821PA 3ACDA 4PC7A 1AQ6A 1RWPA 2QTVB 4HVCA 3I2JA 1FMCA 2HUPA 1W85B 4KFTA 5TPWB 3TXAA 4XRGA 3ZW8A 1ABFA 1SA0B 2H06A 4QULA 1JDSA 1LF5A 3GLRA 4UE3S 3A25A 4DQUA 2V6MA 2WFZA 1YE8A 4C4SA 5JYEA 2O0LA 1E6MA 4UHKA 2ZDGA 5SZKB 4PZDA 4EOGA 2R4QA 3WFZA 5KYTA 2X1HA 1CLUA 1V1JA 2RHTA 4NAUA 3NVKI 3K1TA 2DY1A 1V7ZA 3FYSA 4N3NA 4E1BA 2ZE5A 1GU7A 1KOGA 4BNDB 1KPIA 1FSFA 5AVTA 1UPBA 1TKRA 4AX4A 4NBVA 1BH2A 5KYXA 2VK4A 3JYNA 3EZYA 4E2ZA 3LT5A 1RBQA 2ST1A 2HA7A 4O2RA 2QMQA 1R74A 2MYPA 3OIDA 1PGJA 1G17A 2H17A 3ZNOA 5JRDS 3UZUA 1RKVA 2WDPA 4W9MC 2PR7A 4MIKA 4F97A 1Q0QA 1FW6A 3IVXA 3H1AA 3GLUA 3DMDA 3LCCA 1DC5A 3BZBA 5FI0B 3TQHA 5CDYA 2QR2A 2VWPA 3W7VA 2HT6A 1WB9A 3G49A 1P4HA 3QU4A 2QN3A 4E14A 1TTPB 4Z9BA 1ORIA 1C3JA 5G3YA 1V8FA 5AKZA 4LCEA 4FFBA 4L95C 2JI7A 2EG5A 3INTA 3IT0A 3DO5A 2CHVA 3GLIE 3ZHXA 4KPUB 3DDOA 1V16B 1ISHA 3HCAA 3TRJA 3T3HA 1NX9A 3AG6A 3ZNPA 4C0BA 2A57A 2JI4A 3NH9A 1RVV1 3VYUB 1OJLA 4RDIA 1C1DA 1BFUA 1SH7A 2DZDA 4OQFA 3AQ4A 4O4LA 1W5SA 4URYR 4MLPA 4JDUA 2EAUA 4CIAA 3VV3A 4U3JB 3GT4A 5CAEA 2O2CA 4WY5A 2YCBA 3O8CA 3JR3A 1DXHA 3KXDA 4O8ZA