1SZPA

A crystal structure of the rad51 filament
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
316
structure length
295
Chain Sequence
MVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRTDELSARQMHLAKFMRALQRLADQFGVAVVVTNQVVTGGNIMAHSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein RAD51
publication title Crystal structure of a Rad51 filament.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 81
structure length 295
sequence length 316
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1szpA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1szpA02
2IYTA 1S0VA 3ZDQA 5KU1A 2BVNA 2RAPA 2A9KA 2O8DB 2FGJA 1GFIA 4RT3A 3A1SA 4QWAA 5J0OA 3EPGA 1E0JA 1ZU4A 4TN1A 4YD2A 2B7CA 2F43A 1UBGA 2ZROA 5DBAA 5FBQB 4EYIB 3DM5A 5JS8A 1DAKA 2O8FA 4ITRC 2P67A 2ISPA 4POAA 8ICLA 2ZIAA 2NRXA 5KT2A 2CDNA 1JAHA 3IHWA 3AP3A 3T34A 3SHFA 3RWOA 4DUGD 4R65A 4NCIA 2YWEA 3VX3A 4DSJA 4F4YA 4IDQA 1Z0IA 2FPLA 1P6XA 1XMIA 3LQQA 2BMDA 4MF2A 2UVQA 1U81A 3T15A 4TYYA 5FUWA 2FG5A 1OXTA 5KFYA 3B13B 2BEKA 4FIDA 4IEIA 1SHZA 2J0VA 3LBNA 4IFBA 3UG6A 4QRHA 3EZ6A 2IL1A 4AI6A 3HYTA 2YVUA 4RPZA 4MRVA 1U94A 3RB3A 2D06A 3KZ1E 2VANA 3EZ2A 2BQUA 4ELUA 1EESA 8ICKA 5L1JA 4M9LA 4C3ZA 2Q9CA 2ZREA 4PC7A 4PH5A 4F4XA 1CKEA 2GTPA 4HB0A 3V7LA 1SKWA 4GZMA 5JEDA 3TQ1A 4LHZA 4KYUA 2XY6A 5J4KA 2A5DA 1S76D 5JSZA 1GUAA 4AKHA 1ZQTA 3RS3A 2GCOB 3UPUA 5TB5A 1QHGA 2WJYA 2TMKA 4KLUA 1XZPA 8ICFA 1KDTA 4O3MA 2O0HA 1XTRA 5J0XA 4EEYA 1X6VA 2OBLA 4O3OA 3AVUA 2QP9X 2VA2A 4XOIA 1U9IA 1KY3A 4DFMA 1FX0A 4IOMA 4OI0A 4HB3A 2WWWA 4II7A 8ICPA 4OHXA 2ZJ8A 2G0NA 1NBMD 1OHHD 5J2IA 2W9MA 1W36C 4CT4B 1W49A 1EFTA 1SVIA 3PV0A 1YZNA 1GNPA 2YOFA 4DT1A 3CF6R 3ISBA 1ZQUA 1JNYA 3P26A 3B9PA 1V43A 3ZZ0A 1QHSA 1G16A 1XMJA 1IJFA 5JRZA 1X1SA 3MGCA 3C16C 4B3DA 3CZQA 4ECQA 1NVWQ 1VYVA 4R8UA 4KVAA 4BRUA 4EFMA 2ZITA 2JLZA 2GEUA 4OQXA 1IHUA 1E9EA 4CEJA 4M9JA 5L1KA 1KTVA 1P3JA 4Q9LA 2FLLA 3BXZA 2DR3A 2ZYUX 1XMVA 3U7EB 2HYDA 1KEJA 2HLDD 3M0EA 3O47A 4PHDA 8ICXA 1C4OA 2FV8A 2MSCB 1SVSA 3ADDA 3OE7A 2ERYA 2BWJA 2GRJA 4HLUA 3VU9A 5GJBA 1TUIA 4Q4HA 1G19A 1ZETA 1RZ3A 2XY7A 2G3YA 4M6WA 3LLMA 4ELVA 4X8LA 4XVRA 5A5GA 4LYAA 1OSNA 2XNDD 4YXWA 4XWOA 1Z6XA 1T4GA 3KTAB 5A0FA 1OHHA 1Z06A 1Z00A 2GESA 2KBFA 3BERA 4PHHA 2H17A 4TLBA 3VMFA 2WTUA 4B44A 5AJWA 7ICIA 3SE0A 4P4TA 4QWEA 1UKYA 3GDXA 3CW2A 2C2RA 2P0EA 2W2XA 1UT5A 4GPTA 1KIMA 5CIWA 1M1YE 2YJTD 3OESA 4O2LA 1NOMA 1B0UA 4Z54A 1QVRA 1KO1A 4LV8B 3W6PA 1Z29A 1CJTC 4DCSA 3RH4A 3ZQJA 3MG9A 4LHVA 1ZNYA 2D2FA 1E9DA 3EIHA 3TMKA 4V0NA 2H5EA 1XRJA 3A1UA 1PLJA 3QXXA 3I32A 3ONWA 2V1UA 1TAQA 3KFVA 1KFDA 4PGYA 2KWIA 1IM4A 1RPLA 1ZQWA 2F7SA 2VA3A 2CCGA 4N3NA 2JLUA 3U7HB 2HF8A 3M8RA 4NM2A 2PFOA 2BHNA 2EWWA 4GP7A 4BECA 5J0UA 2HW3A 3K9GA 4XA5A 2HHQA 3PMLA 1AKEA 2Q3MA 4KLTA 2YYZA 5IDVA 2VPPA 2H16A 3RRMA 1P2VA 4C0BA 3U3OA 1E1RD 3OAAA 2LWIA 4D0NA 1DG1G 1N2CE 2WSMA 1W4CA 1GRRA 2XTMA 3J81k 7ICVA 3HJNA 5DISB 3GLFA 1M8PA 1NF3A 2AX4A 3HYRA 5CK4A 4A82A 1JECA 5DBBA 2ZXUA 1MRNA 4QHYA 3C5GA 4EDHA 2DYKA 4A4DA 4BFTA 4HZIA 1KRPA 2A2ZA 5EOZA 1ZC4A 4B2PA 2M9NA 1QSSA 5UKDA 3UATA 1G8GA 5J47A 4KSCA 5KG5A 3C4JA 4ARZB 4QZFA 2QU8A 4PFSA 1ZQXA 2XGQA 1BYIA 2CHGA 3GIIA 4F92B 2H7VA 1E2QA 3RWMB 4OQNA 1N5IA 3IQXA 4FS2A 1QF9A 4GI7A 4Q8EA 2ONJA 4JKIA 1EX6A 2NPFA 4HAZA 1CBUA 2H18A 4OQFA 4V0ME 4R71A 4C7OA 1S96A 2JJ8A 4I28A 1FNMA 4C30A 3IGFA 4YVZA 4OHVA 4E0DA 1E2EA 4ED3A 5HCIA 1T0HB 4TZ0A 4P4OA 1MRSA 1YZUA 3RRGA 1KKLA 4DS5A 3PNCA 5DQGA 4RFSB 4IRKA 1HQYE 1RW4A 4FBTA 1II8B 1NY6A 2RGNC 4R2HA 4L9SA 1T3LA 4HAWA 1PLLA 1A5TA 2C8VA 4P4SB 3GPLA 5IINA 3F5FA 2RHMA 3DHWC 3IIJA 4WBSA 4QNMA 2VP6A 3PX0A 1CS4C 4BFWA 1U90A 5JI2E 2XXAA 1U45A 4IQUA 1OLOA 4PANA 2MUTA 2BM1A 4FI3C 4D4JA 2J6TA 4ARZA 5DQHA 4DQSA 2CCJA 1E9FA 1M7GA 3LW8A 1V9PA 1IY0A 3T5HA 1IJEA 1TU3A 1VCMA 4JLNA 2IYWA 3AQ4A 3W6NA 1GM5A 3UXPA 1ZD9A 2ZUDA 2PEYA 2QE7D 5G3YA 4TQUS 2GXSA 3CRW1 2R6DA 4TUPA 2IEYA 5F9NA 3B8HA 3VR5A 2GEDA 5J2BA 4R66A 1UKEA 2YINC 421PA 3TH5A 1NVXQ 1W2HA 3RAQA 1A1VA 4IOKA 4UB1A 3QSYA 1Z0KA 3UK6A 5J4VA 4XTCS 2RGNA 3SBEA 1T6NA 4AYTA 1XP8A 1P7CA 4IDOA 5FI0B 3AKCA 3PVSA 4JMPA 1ZQYA 4DF8A 3SFVA 5KUTA 3R7WB 4Q1DA 1XTIA 2QMOA 5FBWB 2WPDD 4C0LA 1HV8A 2HCJB 3GEHA 4JT4A 4QJ4A 4ECVA 3CH5A 5FFMA 4QOSA 4DSFA 1VYUA 3MDCA 3VKWA 4YG2A 3T1QA 1T3SA 4MDEA 2GDJA 4G3IA 1YJ5A 5JJKA 9ICAA 4O0IA 2J41A 1S10A 1L3TA 5CJ7A 4EJSC 5BQ5A 4YMSA 3KHLA 4KAXA 4C2UA 2YWFA 5KT3A 4NYMQ 1KI6A 1XFAA 1KI1A 1KJWA 4IXMA 5GJWC 3L2OB 3BE4A 4PHFA 3M9MB 1A77A 4DLEA 1Q1QA 4YXMA 2EU8A 3TW4A 4Q19A 5J2FA 3RJKA 4M22A 4JV1A 4PTLA 1YU9A 4O0MA 4BRWA 2ZRFA 1IONA 2GXAA 1G64A 3X1YA 1UAAA 1RRPA 3V6HA 2F1IA 4PSVA 1R4AA 3U3MA 4BWMA 5SZHB 2ASJA 5EWEA 5L8VA 3FHTA 8ICIA 1E2DA 5JHGB 1HUOA 5CP2A 2ZR0A 4DSKA 4MGKR 3RS5A 2IHBA 1XDBA 3DM9B 3JPOA 1NKSA 3EC2A 4JYCA 1GL7A 3TAQA 1H8HA 1QVAA 2BM0A 2K5UA 4EPVA 1QDEA 4LZDA 2ZQ5A 5LPNA 3NEYA 1A82A 1JXOA 3V4RA 4BZPA 3U3JA 2RB4A 4ACAA 3PITA 4Q66C 3SDZA 2KZZA 3T5DA 1R0ZA 2NZJA 1I4TD 1JJ7A 3K09A 3H86A 3WP1B 3NKVA 1ZM7A 5JWRA 3GLGB 1N5KA 4KYIB 4BLPA 5J0RA 1EXNA 1MQ3A 2LCFA 1YKSA 1FX0B 4M1WA 5J40A 3PR4A 1R2QA 4WXRA 3RJIA 2BCVA 2N46A 3MJHA 3QXHA 5IK2A 1U2RA 4JJKA 3DVLA 1IXSB 2JJ1A 4W9MC 2AK3A 3RRNA 3A8TA 3ZZUA 4M1OA 3SV4A 5E7MA 3PG5A 4AG6A 3ETLA 4JK1A 2PZGA 3C14C 3CBQA 3THVA 4G0NA 4KV9A 2XB4A 4DB4A 5HZHA 5CJ2A 4B3GA 2ZRKA 3BJYA 2F3TA 5J2KA 1WRBA 4OHWA 4YD1A 4BFZA 1PV4A 4Q03A 1E79A 3SC3A 3TLXA 3IPXA 2C2DA 1G7TA 3TVTA 3ZD9A 4AWXA 2ZTSA 2JLRA 1JAIA 4CZ2A 2F43B 2V6IA 1SULA 5LDDC 1AQUA 4M9ZA 3SYLA 4J9SA 1HH4A 4XQ8A 4B3FX 1B23P 2VLIA 1QRAA 4FW9A 3N2EA 4KLZA 2IS1A 2R6AA 4GC6A 4ECTA 4O9MA 1KNXA 2CNWD 2OV2A 5GJVC 4WW0A 2W9AA 4P31A 1J70A 2LKCA 4O5KA 2GK6A 3C7KA 3N97B 4DSIA 3VKHA 4ACBA 1Z6TA 5KT6A 2J45A 1ZM2A 1E9AA 2NQ2C 3EWAA 4UNNA 5JHHB 3OHAA 9ICGA 4P4PA 1Z6GA 1AGRA 5DGAA 2WJGA 3NH6A 4HDQB 5FUYA 3KQLA 3EPJA 2W8KA 4M53A 1KFSA 4LK2A 4GMDA 3GV8B 2C9OA 2VHUA 2IUUA 2OSBA 3RAPR 2DWQA 1G7RA 5CLQA 3JVUA 1ODFA 3MUFA 2XC9A 4FWIB 4QG7A 1OT3A 1S0MA 4QFMA 4YMVA 4LOAA 3OEHA 1XZQA 3HR8A 2CHVA 2BC9A 3JPRA 2WWGA 4PZLA 5H8WA 4RQ0A 3ISCA 3KL4A 4ZDJA 2DPJA 2ZTCA 1L3VA 1G7CA 3CNNA 1BPXA 4V0OA 1XD8A 3ZVRA 3LWMA 3FMIA 4HUQA 4QBIA 5L3QB 3HWSA 2OM2A 2ZRLA 2R8GA 3TANA 2PI4A 4ELTA 4JL8A 3SEAA 4BEBA 1E2KA 4Q01A 2W9CA 3GLGE 5TZVA 2QSYA 2WJIA 4OK3A 4AY2A 1FP6A 3NXSA 1F2TA 3Q8QB 2NG1A 2XZOA 4IQVA 1KJYA 4JBWA 3N70A 4EJSB 2F1RA 4B33A 3B78A 5JS7A 1N6KA 3GV7B 1D2NA 3DO6A 4B47A 1Q21A 5L3SA 4P3YA 5KFBA 1NY5A 3GJ7A 3LVRE 5JZVA 2Q3FA 2EYUA 4XVUA 2AGOA 4A6XA 3VNVA 1NMZA 3I5YA 2R44A 2QAGA 1NKEA 1JB1A 2FFQA 3SNHA 4V0KA 2IUSA 2BEJA 3TUZC 5DGXA 4F8RA 1N48A 1UDWA 5HTKA 4TURA 4M2LA 1S8FA 3B1YA 4FXPA 2REXB 1ZQKA 1Q0UA 2PL3A 3MFYA 2R8IA 2GCNA 2N1BA 5J2DA 2ZSEA 2VO1A 1EWQA 2ZU0C 4NXZA 4N1AA 1O87A 2V8OA 1JR3A 3IQWA 3VX4A 1OB2A 5M04A 1NG1A 1RJ9B 3T1VA 2IWRA 4Q48A 4FMCB 1UEIA 3AVVA 4FWTA 4D25A 1NBMA 2RMKA 4IXNA 4RVCA 1G8HA 2QZ4A 4Z6FA 4M9SA 2J5XA 1KSPA 4HAXA 4IDNA 5GVSA 4PPFA 4I81A 3AVWA 2Q0ZX 4WAUA 1E9SA 3R8CA 1W0KD 1AZSC 4DC9A 1GZSA 3K9LA 4LHYA 2OG2A 1MABA 2AQ4A 4BXOA 5DLQC 1BPEA 3DPUA 3MAAC 3K70C 4KU4A 3QE0A 4P4SA 1BPDA 5KG2A 2HHWA 3ADKA 1E0KA 2VQSA 4BFSA 9ICBA 2VRWA 4JZKA 1KO4A 4A92A 1ZQVA 2GJKA 1Z28A 2AXPA 2IBMA 4R9UC 4HYKA 2F6RA 2XY5A 4JLVA 1JEDA 5FOXA 4BE7B 5BYJA 1M7BA 2PLFA 2J7PA 4KXFB 4ED6A 5LB4A 3W34A 1XSLA 4Z6DA 5KFXA 3AVTA 2R6FA 3HPOA 2GZAA 2ZYTX 3MMPA 4B9TA 2NIPA 2D4HA 4I1OA 1MOZA 2GXQA 1DOQA 1AQYA 1FL9A 3MWLA 2CK3A 3PFIA 4F5RA 3C5HA 3QOFA 2PJRA 2VSFA 1S97A 1WE2A 4ED8A 3DZ8A 4FCVA 2WIBA 2J59A 3L43A 1WCLA 1UM8A 1SXJD 2ORVA 4FMCF 4Q43A 2EVWX 1XTJA 2PH1A 1US8A 3K0CC 1MV5A 2JEIA 3R7WA 2G88A 5CWRA 4AK9A 4DRZA 2HYIC 3JPQA 2P65A 3TR5A 2YC4C 3M1IA 2FLPA 1MO6A 4YMTA 2QN6A 3SN6A 1AS2A 3LXXA 2VSXA 2BKUA 1KNQA 1T3HA 3GIMA 4GOKA 3TNFA 5C46F 3RS0A 1XWIA 1S9HA 2B6HA 7ICLA 1JXMA 5DQIA 2Y8EA 5EE1A 1UADA 4HB2A 1S0UA 1ZIOA 2VIIA 1R0WA 3L0SA 3QIAA 4A9AA 3GLHA 4D26A 3ISDA 5L3SB 1RRGA 3V4FA 3FMFA 4DIEA 5FTNA 3FMOB 9ICCA 1OH7A 1JALA 2OAQ1 2WWXA 4NL4H 4NYJR 3H8JA 3R20A 1AROP 3RS7A 1XJCA 1BPBA 5DO9A 1ESNA 4DBLC 3K0CA 4U00A 2ZETA 2CL6X 4M0AA 3T1TA 4LVSA 3TKLA 5DNYB 5D46A 5BN5A 1R10A 2IYYA 5JRJA 4DLXA 1F2UB 3MLEA 1P60A 1ZC3A 4HSEA 4A0GA 2Q3HA 2GXUA 3DL0A 2W8LA 4BWJA 1TKDA 1DG3A 4HLDA 1L4UA 3T5GA 1XPUA 5CITA 3Q85A 3CX7A 4KMUA 2ZE8A 5AUNB 2W2TA 4ESVA 4KLDA 4CEHA 2X8AA 5L1IA 4CCHA 2HHTA 5L1LA 5JI3E 1Q20A 5AK0A 3TUJC 5FI1B 3L8YA 1ZQMA 2E87A 2QQEA 1P72A 3L0IB 4FD2A 4NHOA 4PC3A 3CX6A 2ZJAA 2BQRA 1TADA 4Q9KA 4YDHB 3RRYA 3WYAA 3PY8A 1G4AE 4QJ5A 1XTKA 3AB3A 2G1JA 4Q7KA 5IIOA 5BXQC 5EZ5A 1TK0A 1T8EA 4YP3A 4QW9A 5B58C 1S9DA 2VP5A 4LDJA 5KG7A 3QVUA 1S3SA 4TQRA 4HAUA 4DZZA 3EIEA 2OXCA 2FN4A 3R9WA 1S0NA 2C98A 8ICHA 4IRUB 4F4CA 1W4AA 1ZQSA 3E2IA 3EZ5A 4ED2A 3AP2A 5KSZA 4YR0A 2QG6A 5IT5A 3O8DA 4PGQA 4M9NA 2GF9A 2N42A 3QI2A 4JLDA 3VR2A 4TZ6A 3M9OB 3IDQA 7ICNA 3GJ8A 3NGDA 2GJSA 1OXUA 4MRRA 4W7SA 1KDHA 4ILEA 1FOEB 4MFAA 4QGHA 4RUAA 2OBNA 3ORYA 2OCPA 2JA1A 4M1YA 1E9CA 3RJFA 2ZUBA 4LJ8A 3OHMA 1S1CA 4WZAE 3SJZA 1SVWA 4OHYA 4M6WB 3H4DA 4DLVA 3I8XA 1KI4A 1AS3A 4QW8A 1II9A 8ICCA 4IJMA 5JJIA 2F1HA 5KFZA 1NP6A 1T9HA 3WBKA 4GZLA 4UB3A 3U7FB 9ICWA 1JJVA 1IOZA 1TQ2A 4RZ2A 2ZPTX 1CLUA 1VIYA 3AUOA 2IYZA 4Q00A 2HHSA 4TYPA 4KLEA 3U2QA 4QKQA 1SKQA 4FINA 3BS4A 4A0FA 3T5KA 1EWRA 2WOJA 2BIFA 1YR8A 1NSTA 4OJQA 2ZSAA 3IHQB 1FP7A 1WA5A 2HT6A 2ZRJA 1GRQA 5TARA 4TSFD 4DLGA 3HDTA 4DFJA 4O5CA 1HA3A 3PR1A 3P32A 4NMMA 1II0A 3UKDA 4NLGA 4QWDA 4TMTA 3IEVA 3IO5A 3RC3A 4OI4A 3G6VA 7ICGA 2WAYA 1E4VA 2ZSDA 4PR0A 5FBRB 2XITA 1D8TA 5DLGA 3B5JA 4C0QC 2JLVA 3K70D 2BCJQ 3H4BA 3BQ2A 9ICQA 3EZ7A 3WHLA 3EG5A 4ESHA 1WQ1R 2Z83A 3QEOA 4D0LB 2VL7A 1F6BA 2OCBA 2ZI4A 5H1YA 2PEZA 1AZTA 4RD4A 5KFAA 1HY3A 1ZP6A 3QEAZ 4O25A 8OHMA 3HU2A 2C99A 3KTQA 4EPRA 5KNBA 3HPQA 5FL7D 1KMQA 2ZUCA 4TMZA 3P1JA 3G6XA 4UJ5A 2RH5A 5K8IA 2X19A 2JEGA 4UQOA 4BFYA 5KFNA 3SBDA 721PA 2BDPA 3AH8A 1IN4A 2IUTA 3V7JA 2JLYA 5C5JA 4M8NE 4NU0A 4BWYA 4IRCA 2WOOA 3LV8A 1P4SA 1NL3A 3E1SA 4X8MA 3AGPA 3C41J 3HT3A 1DAIA 4TSFA 3X1WA 5IK2D 4QM6A 4DQRA 1R6BX 5KG1A 1W1WA 4GMXA 4F93B 4HAVA 4PHGA 5CYPA 1FUUA 2W0SA 3GQCA 2CVHA 5CJPA 4I2EA 5DYIA 2FU5C 4NY8A 1E99A 2WWHA 3E70C 4KLSA 5KG3A 9ICIA 1ZNZA 3B60A 4DQIA 2Q21A 3CNOA 4A2WA 2Y1JA 2V1XA 4EQ6A 2GHIA 4WIAA 1SXJB 2YWHA 4HB4A 1NIPA 2A5FA 4I2IA 1L4YA 1OYWA 1Z3IX 4YMUA 4I2AA 1H8EA 1KI2A 2O52A 2J0QA 1W44A 1EGAA 4EPYA 4DCUA 1XNJA 3MFIA 2V7QD 1U0HC 1VHLA 1FTSA 4MKIA 1F3OA 2Q9BA 3HPRA 3ND8A 5DE3A 5GJCA 3RHFA 3MWKA 1KK1A 1F48A 2F9LA 5KPJA 1ZQQA 2ASLA 4RZ3A 2P5SA 3VR4A 4DL5A 1H8HD 1U48A 4RQ8A 2C03A 5KFUA 3VR6A 4FCWA 2GA8A 2IHMA 4QZEA 2VF7A 2XGJA 1OKKD 4ZH4A 2VA8A 5KFEA 4PO9A 4D4MA 3GCGA 4TQ9A 3BQTA 1ETUA 5SZIA 4LSGA 4MEXA 3T12A 1GWNA 1VPLA 3PR5B 1DOAA 1Z6AA 1JPNA 2QROA 4PHAA 2ZRCA 2GJ8A 3Q9LA 5JCPA 1NVVR 1SVOA 1ZINA 1XEXA 1BGXT 2R65A 2X1VA 5EP4A 3NBYC 1LF5A 1G21E 2JGNA 1LV5A 3OJUA 3EPHA 1COWD 1QBKC 1YZQA 2ZE6A 3N4MB 1R0XA 4DLWA 2BJVA 5FOTA 1N0VC 1Y63A 4M9QA 3TQFA 1XPRA 4PC1A 4TTPA 1Z0DA 2P6NA 4JLAA 3GLIE 3AP1A 2PX3A 3CLVA 4GP6A 4LHXA 4C0HA 7ICJA 7ICOA 1KDRA 1RFLA 1SGWA 3OEEA 4B3BA 1G3MA 4KO8A 4N0DA 1UKZA 3THXB 2I9GA 2DFKB 1CXZA 3U60B 1B22A 2FEOA 3BD9A 3SS8A 1COOA 4NLKA 2GKSA 2HLDA 4DIDA 1Z08A 4B9NA 4QL3A 1JXLA 5FL3A 3QZ8A 1MABB 3MABA 2Q0HA 4ZIRA 4YR2A 1OH8A 5A4JA 5K8UA 4B75A 1E32A 3HW8A 4BEJA 2ATLA 4TUSA 7ICTA 2IXGA 4D4KA 4NTZA 1SL1A 3RJJA 9ICSA 3MR2A 5EP1A 5FBVB 2VYFA 4JSTA 4UKDA 5DDMA 3TSOA 4ZIRB 1W46A 4L5BA 1FQJA 3RSOA 3Q7QA 3BH6A 3BQ0A 2VHCA 4U02A 4MDFA 2OEPA 2IF2A 4QZAA 1NN0A 1BOFA 3KKQA 3B6EA 1MO4A 4UNRA 1G41A 2ZSFA 4B9LA 4TLDA 1C1YA 3SZ2A 1NSFA 1KAGA 2ZJOA 3EXAA 1X9WA 1UA1A 3K0EA 4ZI3A 4RZRA 5BOLA 4JVMA 3ZVMA 3HWTA 3RNLA 3I4LA 4CGZA 2PBRA 3LNCA 1KK0A 3R8FA 1CRPA 4URWR 4DDVA 3AF1A 1A4RA 5ELXA 4TLEA 2FA9A 3IUYA 4ZDWA 1DVRA 3L82B 4PSAA 1IAQA 4GBMA 4IW3B 1VDZA 1NVUQ 3HU1A 3VTKA 2QRNA 3MRSA 4OJKA 3WHKA 1G5RA 2ZS7A 1OIXA 1NLZA 4NCNA 1M2OB 4B9SA 1LY1A 4TMXA 1G5PA 3KHHA 2G9NA 2YHSA 3A4NA 4DLUA 4LX0A 4TQAA 5CA7A 2A30A 3ZQ6A 2NO6A 4Q1BA 5KOYA 2VH5R 3LFUA 4ASUD 2ZI7A 2V4ZA 2NMVA 2BKEA 4NYIQ 3W6OA 2HVHA 5EP2A 2A1JA 1A76A 4UAZA 1AKYA 4XD7D 1BS1A 3KDSE 3IO3A 5DG7A 2KJQA 1E94E 3PVXA 2AK2A 2GF0A 2AKYA 1ZM4A 3T5JA 2OAP1 3NBFA 2W9BA 4HZUB 1EFHA 4UB4A 2XGPA 5EXPA 1T8TA 2IYXA 5KPDA 1W36D 1GITA 1CR1A 4TYWA 1QTMA 2FF7A 4RQ2A 5TY0A 4YMNA 3BFVA 2RHDA 2NO9A 1E2GA 3Q8MA 2R6CA 5SZKB 3PXGA 1NJGA 4RSGA 4A36A 4DLTA 2V4QA 3I72A 3RH5A 3B1XA 5EWFA 3LX8A 1FW6A 2KN7A 1IM2A 3DMNA 4OK5A 4ECRA 2QPOA 5HP4A 4LZZA 4URYR 2PZEA 3MSXA 4AKIA 4NH0A 3A1TA 4OYHA 1U47A 2FOLA 3D31A 4NP6A 1QHYA 4B9VA 1E69A 1OIVA 2JJ2A 5E95A 5DBCA 1SHKA 1KLNA 4DSOA 5KFQA 2IS4A 4KLMA 4BZXA 5DHAA 2DY1A 4CYMA 1R7RA 4CF7A 5JSZB 5JJLA 1EXMA 2QGNA 5FOSA 3GLHE 2OUKA 4F4ZA 5EXSA 8ICJA 3EX7C 2BR0A 3QPWA 2JATA 5JWOA 4RT2A 4LPKA 1YVDA 1OJLA 2QL6A 2WMOB 1VG8A 3C2KA 5IF9A 3WNDA 5KFDA 1KI9A 4BUJA 3NDBB 1P73A 4RPYA 3EZFA 2NGRA 3KJGA 4C0AC 3K75D 3THWA 4Q4HB 4MYUA 1WBBA 1LS1A 4LJ9A 1N56A 4F4WA 4PAMA 4RD1A 3D8BA 4Q1CA 3KX2A 1E2MA 5EE5B 1NK0A 4KLGA 7ICQA 2FMQA 1SXJA 4MYTA 4G5OA 2XCAA 2NZ8A 3PUXA 3QG1A 4RCZA 4DS4A 4LRWA 3WXMA 1TPZA 3SOPA 3UQ0A 2XNSA 5J5CA 2AR7A 2XZPA 4C8MA 7ICRA 5ANRB 2LKDA 5KFRA 3ICEA 1N0WA 4RQ1A 7ICFA 4F5NA 4QZBA 1X1RA 1XCGB 2MMCA 2ATXA 3QJYA 3SJAA 2ERXA 2FX3A 3RTVA 2KSQA 1NBME 2JJ2D 2QA5A 4AC9A 4RZXA 1T0JB 3REGA 2ZVPX 3M8SA 1VIAA 2WBLC 2F1JA 2GNOA 4HUQB 3VQTA 4LC0A 2CNWA 2V6JA 2IX3A 3REFA 3B1VA 5IRCD 1YR9A 4OQMA 5CB6A 1JX4A 4EIWA 4DSEA 4AYWA 8ICGA 4TTQA 3WNBA 4MUAA 1SVLA 2FPKA 1D9XA 1KI8A 1W48A 1NIJA 2W83A 3GLIB 3PMNA 4M1MA 2REBA 3EA5A 2DFTA 1KMHB 2PFQA 1ZU5A 1JIHA 2ORWA 3AF2A 3KQNA 3OFND 2W2VA 2OILA 3BB4A 5DIFA 5G40A 1N6OA 2R62A 2MSEB 4A8JC 1NN3A 4IQWA 2BCSA 2O8EB 1G8FA 2PCLA 3HP6A 4DF4A 1Y88A 3RB0A 2ZJ2A 4I4LA 5GADl 2A78A 7ICEA 4J9LA 4DOAA 3L8ZA 4FCTA 2JLSA 5H68A 1HJPA 4ZCLA 1E4YA 2PCJA 4PPXA 621PA 1RZTA 2XOKD 2J0SA 2GAOA 3EIQA 1VHTA 4OL0A 2FZ4A 2DBYA 2ZI3A 2H92A 1DE0A 4PZZA 9ICRA 2UKDA 4F2SA 4LJ4A 4X8OA 8ICYA 5KFJA 1N3BA 1M34E 2EFDB 4HLQB 1P2UA 3PUWA 4MRPA 3IBYA 3PEYA 2O8EA 3RVBA 9ICTA 5IIMA 1ZQGA 2ZE7A 2J7PD 4DSUA 2B7BA 3LK9A 2IYVA 1XD2A 1S4QA 1HE1C 2WZQA 3C1ZA 5DHFA 8ICEA 2GJAA 3I73A 5LBIA 2R8JA 5KFMA 8ICWA 1KOFA 2Z0MA 2J9RA 2BCQA 1A7JA 3AKDA 3LXRA 5KFFA 5KFCA 1N6RA 3A37A 4IKEA 2D3WA 4UNQA 1JR6A 2QI9C 5KSPA 3KKOA 3TFSA 1KK2A 2FDCA 3QXJA 5F9FA 4L4UA 5AUPB 4R7ZA 2VSOA 5KT5A 2PX0A 3EASA 5IIKA 4WZBE 2JLWA 3U44B 1JXEA 1AIPA 1NI3A 4TL7A 5D3MB 3AUYA 2MMGA 3CRVA 1XSPA 2R8KA 5KG4A 4DL4A 3OIUA 4MEYA 5DKWA 2BHRA 1IY1A 1J7KA 1CIPA 2KBEA 1TK5A 2FFHA 1BPYA 1G3RA 9ICFA 1UF9A 4O3PA 2KI5A 3BFXA 5EXTA 4DEYA 1N25A 1G6HA 1TV9A 4BLRA 5B2ZA 4Q02A 2ZRIA 3VAAA 4AG5A 4W5JA 2ZAOA 4EZ9A 3GJ3A 5FOUA 4O3RA 7ICSA 1BYUA 2CL7X 3ZD7A 2WIAA 3IHLA 1P9RA 2KFNA 2ISOA 5JWHA 1NK8A 2ZJYA 3FKSD 1T5IA 2GBLA 1QLNA 5J2EA 9ICKA 4ON9A 3BB1A 4KLOA 3B0XA 3U4QA 1NLFA 2PZFA 4PHTA 3AF4A 3ZGXA 1MT0A 1CRQA 9ICJA 4JV2A 2O8CA 3SQXA 4RCYA 4M1SA 1D2MA 1OXVA 4LC1A 1GDDA 1TF7A 3V9PA 5DB9A 2Q9AA 3SR0A 4DJTA 5LD2B 5JCZA 1WDTA 4RQ6A 2AJQA 4LYFA 1XXHE 4URVR 3TARA 4RFSA 4N0EA 3BORA 4DSNA 2QE7A 3AVPA 2E1RA 3NH9A 4W5HA 1KYIA 5FTJA 5BW8A 1GTVA 4DLYA 2ALZA 1M6NA 3GFTA 3P4YA 2EQBA 4W5WA 4KTQA 2JJ1D 2OFOA 1K6MA 2IMWP 3AKEA 2VHTA 2VP0A 3KKNA 2WHXA 4XWAA 3K0FA 4WA7A 1DTSA 3CRRA 3WMEA 2DPIA 1XO1A 3BB3A 4Q45A 2WAXA 1ZUNB 4S35A 1LB1B 1HUZA 1DAHA 1U0LA 4D82A 5CYOA 1ELOA 2HJVA 2ZEJA 5DLFA 3QY0A 2KTQA 5FPSA 3R9IA 3GLGA 4FMDB 4QC2A 1P9NA 2XJ9A 4BLQA 2XTZA 1CTQA 3NHBA 3QF7A 3PW2A 2HHXA 1G9XA 4E07A 1LTQA 5CDFA 4BGDA 2ZM5A 4KLQA 4Z1MA 2W9BB 2VP4A 3CF2A 2VBCA 2ZRBA 3CB4A 3H0KA 2EFEB 4I29A 3KB1A 1Z6YA 1CEZA 2L0XA 2ZRPA 2IEZA 2WVJA 3M9NB 1DAGA 4PC6A 2FMPA 1XX6A 1ZCBA 3LBHA 5FBLB 1JMSA 2ECKA 2BMEA 3CO5A 1ZQBA 3KKMA 3FFBA 4URUR 1XU4A 2J3EA 1G20E 3C1YA 1AS0A 1CJKC 1KO8A 4ECUA 2J87A 4Q4AB 1O3YA 5TV2A 1VG9B 5CLLA 1E2JA 2ORIA 2ZRNA 4QGFA 1NK9A 3O8BA 2BPFA 3SFZA 4JBXA 3RANA 1W36B 5HNKA 5FTMA 1ZQHA 2HCBA 3NVAA 4C8KA 1FQKA 3W8RA 4B2LA 1RYSA 2H5XA 2O8BA 3CRQA 1PUIA 2J1LA 4HLCA 1CEEA 3KHGA 1ZQLA 3QKSB 8ICSA 5SZJA 3UXMA 1ZJNA 1Y3AA 4CRWB 3G5UA 2IHNA 4M1KA 1I2DA 3S1AB 4BFUA 3HX0A 3FPAA 3BGWA 3N5CA 3NTUA 4X5VA 3FWYA 2VF8A 2Z4RA 5CM8B 2WM9B 1W7AA 2A5JA 2G0TA 1Z2CA 3QENA 4PQRA 1G291 1LVGA 4TT3D 4M1TA 521PA 3FYHA 3LH5A 1H38A 3SI8A 9ICXA 3D3QA 5FPYA 3T06B 4J9OA 2YWGA 2UZ3A 2BQ3A 1RIFA 4RQ4A 2AXNA 3K0AB 1ZMXA 2HEIA 4LJAA 1X2IA 3KUDA 3NBZC 2WWYA 4BLSA 3ZLJA 1ZRHA 2PLRA 2RCNA 2VTKA 2VP9A 5D3QA 4B74A 1VMAA 4LYHA 5E3HA 3C2MA 5KFWA 1HEIA 1Q3TA 3RLFA 3I62A 1TVAA 4D0GA 2GILA 3SZRA 4K81B 1ZQOA 3K0AA 3MCAA 4EYHB 9ICHA 2CLSA 4GDFA 1VKJA 4BPBA 2GWHA 3RBDA 2OLJA 4JLKA 4U7DA 1QHNA 1WCNA 3RAXA 4IRDA 4JWMA 1TX4B 4HATA 4RY2A 4DHEA 2ZRDA 3GV5B 1WB9A 2CMKA 3GJXC 2G1KA 3OEHD 1XEWY 3HU3A 4NCJA 4EZ6A 3W8NA 3Q8LA 2REOA 1DELA 3SV3A 4FBUA 2AFHE 4Y0AA 3ZDCA 2GEVA 4DKXA 4G01B 3NG1A 1Z63A 2J6SA 5AJVB 1ZQRA 5KG6A 1TU4A 4M9XA 5FUVA 4EFNA 4K4HA 1R5OA 2GBLC 4MKFA 4UXHA 2XSZD 5EZ6B 1JEEA 3I8SA 4XRHA 2AN9A 4UNPA 4Y0VA 3IM1A 3THYA 2HUPA 2IYUA 1FPMA 4LV6A 4ECYA 1Z8FA 3MWYW 1J8MF 4ZKEA 4JYBA 3T61A 3TUIC 3FOZA 4C8NA 1XD2B 4XUSA 2BGWA 2IK8A 3BIFA 2J6UA 1GOTA 1YE8A 2ZS9A 3FTQA 3THOA 4JS0A 3KFXA 4QWBA 3UXOA 2ZYWX 2CLCX 3OZXA 4JVNA 4PAOA 4WZ6A 3Q8XB 2NRTA 1MH1A 5EUQB 1OH5A 2NRZA 2GZHA 2HHUA 1ZBDA 4K8OA 1YR7A 4EBEA 4GOJA 3AV0B 4Q1EA 1MSWD 3KQUA 5KSYA 1G6OA 3LAWA 2JEJA 9ICPA 2NTYC 1ZQZA 2BCRA 2B8TA 4M9HA 2QQ0A 3AUXA 3KUCA 4HZUA 4NYMR 2AU0A 1W5TA 3C8UA 4QGAA 5C2JB 3P4XA 4J9QA 2QMEA 3JVVA 1VCNA 4TTRA 3CPHA 1W47A 2ZRMA 4JLOA 1E9BA 4WVFA 2WWIA 5HHHA 2IXFA 3RC8A 1AM4D 3D7MA 3H40A 2FFBA 4JLJA 1Z47A 2ANBA 1QHHA 4F3OA 2KFZA 1TQDA 4ZDIA 5B57C 9ICMA 1NN5A 4YC7A 4QWCA 2XEXA 2WKQA 1E1RA 3OAAD 5L3VA 5D49A 4ECSA 1QZXA 4ZCIA 1ESMA 3MR6A 5C4MA 4F2RA 2AWOA 4IVQA 5EJEA 4LV5B 1K1SA 1NRJB 1IQPA 2IWHA 2V9PA 3LO5A 1QG4A 4PXAA 1OB5A 1ZAKA 1G8PA 1SKSA 1OW3B 3KB2A 4URZR 3EWSA 4A2QA 3BK7A 2MSDB 1V5WA 1ZD1A 2QTFA 4O2RA 3UMRA 3CPEA 1YQTA 4DEXA 3VKGA 2A3RA 3SQWA 2QP4A 1B43A 3KXKA 5KFIA 1ZUHA 1DO0A 1XCMA 1JQJC 5EXXA 4UAYA 1G4UR 1YRBA 4B32A 3TSWA 5BN3A 3JPPA 4DFKA 2AGQA 1OYYA 4RU9A 4A1FA 5CDFE 4P0TA 1DAEA 1NKBA 2ZRGA 2HXYA 3W9YA 4RJLA 4KITB 3AF0A 1GAJA 1I4DD 4MKHA 4LBZA 1S2MA 3GD7A 2V9WA 4Q9IA 3ZIAD 1JI0A 4Q47A 4PHEA 4HDOB 2RGEA 4XH9B 3SHWA 2ODEA 4ZV4A 3RR8A 1CUKA 4A8JB 4G5SA 2SHKA 4QZIA 1IN6A 2CE2X 3PEVA 1N6HA 2B8WA 3OIWA 3V7KA 4Q8FA 4PGXA 4P4MA 1E1QA 3QBVA 4XSGA 3UG7A 2V3CC 4PAQA 2NRVA 1WP9A 4NM1A 4B3CA 4YXWD 2KZMA 4DLSA 1HQCA 2RGGA 3BBPA 4QZ8A 5J0TA 3UPQA 4Q18A 4TMKA 4M4SA 4CDGA 3QXSA 2ZSBA 4LJ6A 1T8UA 4I2DA 5FL7A 1EFRA 3UIEA 1NVVQ 3QKRA 4DLZA 2QBYB 5DG9A 1KI6B 4Q21A 3BJIC 1UBFA 1PJRA 1ANKA 1RRFA 1MO5A 1SXJC 2YNMA 4YMWA 4DCTA 2CEAA 3VHLB 2WKPA 5KFSA 2VHQA 4BASA 3SYNA 1ZJMA 1D2EA 2FNAA 2O8DA 1Q3HA 3BWDD 3LLUA 4TYQA 4DDTA 4KLFA 3SYZA 1QHHB 4D4LA 1ZD8A 1D8YA 4JWNA 2C5LA 4DVGA 4I1VA 3IEUA 4IVRA 4ZO4A 3G6YA 2QORA 2BJWA 5FR2A 3BOSA 3OSNA 4DQQA 2C77A 3C15C 5DB6A 4LUCA 4M0LA 3RB4A 1TNDA 4EBDA 3SYKA 4F50A 4JT2A 4B6FA 5DGBA 4NBSA 9ICLA 8ICTA 2AGPA 2FMSA 4KFSA 3LDAA 3U3RA 3AU2A 5JECA 3UXNA 5HR5A 4AD8A 3GLHB 3PO4A 3QNUA 4EFLA 4R63A 4DOBA 2C28A 2JZBB 3CWZA 2G77B 1SXJE 3LY5A 3V6JA 2JIZA 1P61B 3KQKA 8ICVA 2A7QA 4DWJA 5GVRA 2QAGC 2XOKA 3E2EA 1U8ZA 1YRAA 4JBYA 1W0KA 1U99A 1JN3A 1JR3E 3NIBA 4EPTA 2I4IA 1E2HA 1P75A 2ASEA 2ZYVX 3HP1A 1G8YA 1NN1A 1YZGA 1TUEA 1NK4A 1G3UA 1T3NA 2GJ9A 2J0UB 4GXKA 3CRMA 5BWMA 2FH5B 1ZQEA 2OLKA 2QGZA 3KHRA 4JIMA 4U5XA 3H1TA 3VR3A 4B43A 2A5GA 2JEFA 2I1QA 2P6UA 5J0WA 1ZM3A 3DZDA 3PIRA 5E7JA 1KO5A 4US0R 4B48A 4KODA 5J4YA 4XJXA 1QSYA 4GXIA 4FMDF 2IHYA 3S1AA 3VU9B 5CB1A 4KLIA 3FDIA 2ZTEA 1J8YF 1MKYA 2Z6VA 4RKEA 1RRCA 2WSSD 2XAUA 2ZVQX 5BN4A 3GFPA 3RJEA 5J4HA 1L7VC 3RRHA 4CEIA 2QMHA 4QXAA 4GT1A 1EFCA 2AWNA 1CULC 3EPLA 5KNCA 3CIOA 1AGPA 2CL0X 4H9GA 4MYCA 5HKKA 1XMSA 1Z2AA 3NBXX 4KBGA 5J0SA 4R98A 4E5UA 4EQ6B 3MWJA 3TR0A 1G18A 1BVSA 4IR1A 2RKOA 5FTKA 2MAXA 3K9NA 3U3KA 2QP3A 3EPIA 4UJ3A 1HTWA 4OHZA 4DWIA 1KI3A 1W2GA 1OF1A 3OIYA 4ED1A 2ZI5A 4RNMA 1NMYA 3CF0A 3T3FA 1I2MA 1UDXA 3I3SR 3EPKA 1LF0A 2DWPA 5JLJA 1TFRA 4DT1B 2OWOA 1TL7C 3TFRA 1NJYA 3VR1A 2D2EA 4A2PA 2ZANA 4Q4JA 4YQWA 1IN5A 1IN8A 4B2IA 5G53C 4I2HA 1W4BA 5J0QA 5J2GA 2BDTA 2IYRA 3FKQA 4G3XA 4DLRA 2PXIA 4LBWA 5F98A 3B1WA 4KSBA 4M9GA 3C23A 2A1JB 1L3UA 1KK3A 2OBMA 4TUQA 4B9UA 3OFNA 1KSJA 4RPXA 3OEED 4PX9A 4RKFA 1ZQNA 1XXHB 2HDNB 1TF5A 1ZQIA 5AJZA 4L8GA 2IYLD 3QUSA 3MD0A 1GKUB 3L0PA 4YDSA 4MF8A 4F38A 3PUZA 4CW7A 3WRYC 1WBDA 1VCIA 5AWFC 1YR6A 4J9NA 1E96A 1E98A 2BOVA 2GVZC 4FMBB 1XEXB 2D62A 4HLUC 4MGIR 4DCVA 4Q7LA 5KYKA 3B2EA 1X9SA 1Q12A 3CM0A 1N6NA 2JZBA 4QHSA 2AD5A 1KMHA 5JMTA 4I2JA 2XSZA 4P4UA 1UBEA 3FHCB 4KBFA 3TGPA 4PHPA 1HUQA 3KTAA 2IBKA 1P2SA 2YC2C 1H65A 1R5BA 1YZLA 5BYKA 1DEKA 3TIFA 1XEFA 2C9CA 3RRZA 5KFVA 2CK3D 2R2AA 2IXEA 3BQ1A 3CH4B 9ICVA 4H1VA 1BPZA 3NC1C 1F5NA 4LYJA 3ZD6A 1OFIA 1TK8A 4MITA 3UMFA 3FFAA 2WICA 5BOMA 2WTFA 3LBIA 2V54A 4XVQA 3K0SA 4C2TA 3PW5A 1E2PA 4E09A 3W5IA 4GFDA 2DCUA 2FSFA 2ODBA 4V0MA 1NK5A 1PLKA 4O3NA 1RPZA 2VHJA 2CVFA 3KKPA 4P33A 3GFKB 1L5UA 2QPTA 2HV8A 1OPXA 2XX3A 3QZ7A 2ZR9A 4RD6A 3U61B 4O3SA 3H4MA 1NG9A 2IC5A 7ICHA 3M4YA 4HEJA 4M21A 1GKYA 3TE6A 4K4GA 2GETA 4EBCA 2GVDC 1K5GA 2X2EA 2ZR7A 5HHIA 1CJVC 4L9WA 1MR3F 1MO3A 4US2R 1L8QA 1CR4A 5L3QA 5K8TA 2IYSA 2WJJA 4I2GA 4TT3A 5DG8A 5IILA 1TQ6A 2ZJBA 2ONKA 3QKTA 3U7GA 4YCXA 1SZPA 2BCGY 4BLTA 1OIWA 1SL0A 1J99A 5J4LA 5LD2C 1J90A 2V7QA 3MJRA 4KFTA 4PQYA 3T35A 4ECZA 1K8RA 3QEBZ 3AU6A 2GWSA 3B82A 3C5CA 1N6PA 3Q5DA 4EAQA 3AVQA 4XD7A 4J9MA 1ZYUA 4NCHA 3UMSA 3Q8KA 4JL5A 3QPVA 1RKBA 3WBJA 2CHQA 3ZDEA 3ASZA 4BQSA 821PA 9ICUA 5JEEA 8ICZA 3UWKA 1EX7A 1D9DA 2W6JD 3GQBA 1S0OA 4XWKA 2FLNA 3C5FA 3V6KA 2CJWB 3CR8A 4DUGA 4MGYR 5B64A 3KXIA 1UBCA 2QRZA 3LD9A 4DB2A 4YMOA 1ZIPA 3C21A 1EG7A 4OI1A 1XSNA 5KFKA 1VTKA 3CKLA 2P5TB 2ZE5A 5F2EA 3AVYA 3W5JA 3IPYA 3RSLA 8ICBA 4KN4A 4DSLA 1VG1A 4ASUA 4DXAA 1N5JA 5F9LA 4TQSA 4KLHA 4TMVA 3K09C 4IFEA 4Q9JA 1XBTA 9ICNA 1GL9B 2JASA 1C9KA 4B6EA 1G3IA 1KFTA 4ZKDA 1ZJ6A 1BO6A 4M04A 3JPTA 4Q1FA 4D80A 3Q8RB 1X8LA 3NDPA 1D9FA 2OHFA 3TW8B 2BPCA 1LS6A 1QG2A 4TL6A 1X3SA 5HMLA 4RNNA 2UVWA 5JBQA 1Z07A 8ICNA 1KHTA 2RDIA 3RDPA 1TMKA 3UQ2A 2RDJA 4JKYA 4TYNA 2YOHA 3K4GA 2AL7A 2W6ID 1E9RA 3NEJA 4KFUA 2ODWA 1RC8A 3AVXA 1BH2A 2HVIA 1AA9A 3THWB 2R9VA 5EQTA 4RFVA 5AJYA 4US1R 5EE9A 5EWGA 2WWFA 4QGGA 3A58B 2WSSA 1E0SA 1XF9A 3UWOA 4YQFA 4PZYA 2OZEA 4YN4A 2GCOA 5DB8A 4K46A 1NK7A 4NDZA 3GLFE 1OE0A 4I2FA 1KKMA 1FUKA 3RABA 1TEVA 1AJEA 4DL2A 4IEEA 4FO6A 5KSOA 3PX6A 1GP2A 4C9BA 5HKKD 2NO7A 3DOFA 3QKRB 3RYTC 2H8KA 4ZDKA 4RNOA 1E79D 1YHNA 4IOJA 3AKYA 3I92A 5KTQA 2PMDA 5KFOA 1ZQJA 1IXZA 2QAJA 1KTQA 2FWRA 1MC8A 1RXWA 2GK7A 1SVKA 2W6JA 1ZQDA 1NLYA 3RR7A 3DDCA 5TXGA 3W3AA 5DDYA 4F91B 1K5DA 1KI7A 1Z0AA 4ABYA 2XXAB 4OKSA 1N0UA 3TAHA 3JZAA 5KDLA 2ANCA 1XPOA 1TTTA 4M47A 2IA5A 1I4LD 8ICUA 1NJWA 3TVDA 4AKEA 3H8WA 4CIDA 3PENA 3D6TB 3I1FA 3LVQE 2FSHA 1H8ED 3B0YA 1GILA 2OFXA 1P5ZB 1TEXA 3RBEA 4Q7JB 3TAPA 4S2EA 4JL6A 5J0PA 3F0TA 3BC1A 4JLMA 2D7DA 1GNQA 1W0JD 3WMGA 1L3SA 3C2LA 1X9MA 2C96A 4TMWA 4UBBA 4F7WA 2WJHA 5KT4A 3B9QA 3HR7A 1D9ZA 1Q1ZA 1RVDA 2IS2A 2YV5A 4J9PA 1IXRC 1Z5ZA 3ND9A 2MUTB 3AVOA 4PPNA 2E9SA 1DS6A 4F5PA 1FFHA 3Q3JB 1QHIA 4ERNA 4RQ3A 3VHXA 1GG2A 4KJZA 2GAAA 2WMNB 3IIKA 4BFVA 1M7HA 2ZI9A 2YOGA 2A5YB 4DEZA 4F5QA 3W90A 1E2LA 1NK6A 2CBZA 2ATVA 3CX8A 4QBFA 4DDUA 5KDDA 2P6RA 4UB2A 7ICKA 4C8OA 2ZS8A 4LBYA 4AYXA 5J2HA 1OKKA 221PA 1T91A 4XSHA 4GL2A 1NJZA 1EFUA 2JAQA 4HYYA 4MKGA 5HPYB 3AM1A 2FGKA 4GLXA 2EWVA 1DBSA 2XNDA 2RGDA 3ZVLA 4YXJA 4AIIA 2IA6A 3ZH9B 3NWJA 3VNUA 3K8YA 4I1SA 1Z0JA 4ECWA 1XTQA 4ZPXA 2YZ2A 2ZRAA 8ICOA 2XCPA 5CIQA 5KFPA 1EK0A 1WXQA 4B34A 2NOAA 2D7CA 3F8TA 4I1UA 4LZGA 4IR9A 4L15A 1ZYQA 4PO1A 3FKSA 5DI9A 3T1OA 5EUMA 2Y1IA 3GJ4A 2XZLA 4O3QA 9ICEA 4V02A 5H70A 4R8UB 2DFLA 4GSYA 4KLLA 4HDCA 3U5ZB 3LW7A 5J0YA 3WNCA 1UJ2A 4I2CA 4KLJA 2PT7A 2Q6TA 2QPAA 2QAGB 5FPKA 5CR0A 5IIJA 1XJQA 3OE7D 4Q4JB 1X86B 4E03A 4PC2A 3GLFB 1ZQFA 1TQ4A 3LX5A 4MRSA 4YR3A 1RE0A 2QM7A 2JCSA 1N6IA 1VG0B 2QY9A 3LA6A 4NONA 4UXIA 4EJSA 3ZD8A 1LV7A 1KDPA 1Q1BA 3A4LA 3TRFA 5KFTA 2PMKA 3A6PC 2AQ0A 2BBWA 4UB5A 5HZKA 1SL2A 1W5SA 1CR2A 1Z0FA 4QNRA 1XD9A 4KCGA 4Q5IA 4KN7A 1S3GA 1U0JA 1QSLA 2BBOA 2WV9A 4LGMA 1NKTA 4YMMA 3NC0C 1ZCAA 3OIVA 3GIKA 1BMFD 4CEIB 5L9XA 5EE3A 4KVGA 2O8CB 2CLDX 1XXHA 5AJXA 2FE4A 1U8YA 4UAWA 4MGZR 1OH6A 4O5EA 2B92A 4TL9A 2YKGA 4B3XA 3ZDDA 1NJFA 2KB0A 1JR3D 4F4KA 1E2IA 3TJZA 3TBKA 2RGAA 3MBYA 2JLQA 1UPTA 4BFXA 5KFLA 1KGDA 4L16A 2C78A 3W3ZB 3LQRA 3U4QB 2EFCB 1VCOA 3Q5EA 5IIIA 4LBVA 4NYIR 3X1DA 3OHBA 1HE8B 4UXJA 4GXJA 4RQ5A 3DKVA 3OJSA 4B73A 1DADA 1Q57A 1X8KA 2BMJA 2IW3A 4Q4LA 3LRPA 4Z6EA 1AN0A 1KAOA 4MYHA 2ZAMA 1ZNWA 4LJ7A 1F2TB 2DHRA 8ICMA 1E2NA 3IBGA 1Q22A 4V03A 3WY9A 4HUTA 4Q7MB 5F9HA 1R0YA 4RD0A 3ZYCA 1UA0A 5DN6A 2NRWA 1RYHA 3BFKA 4ECXA 1E2FA 3MR5A 2G6BA 3MR3A 1FTNA 3KQHA 1D8LA 5HE8A 1G17A 2QM8A 3ZDBA 2CE7A 2PFNA 4YFKA 2GCPA 1ZNXA 2QBYA 4ZI2A 4JSYA 2I3BA 3Q7PA 4IHQA 4KHZA 4QZCA 4TL8A 2F9MA 4JVLA 5DI3B 5HE9A 2RGXA 4WOPA 5KDOA 1ZVQA 4DL3A 4MFFA 2BV3A 4TLCA 2X77A 3THXA 4Z6CA 3PW7A 4B76A 2I1VB 2XB2A 6Q21A 4RZUA 1OXSC 2GZDA 2XTNA 3QBTA 1ZQCA 3BH0A 1P62B 2W00A 2DWOA 2OT3B 2V4RA 3WYFA 2AFIE 4J9KA 1JBKA 4A8JA 3KJEA 1FZQA 2F3RA 5FPTA 1D6JA 1IBRA 1HT1E 2QUZA 4MQBA 1BMFA 2O5VA 2P2LA 1KDOA 4TWZA 5CM9C 3GEIA 1DARA 5D4BA 4I27A 5J2AA 1AK2A 5AR1A 3MGIA 3WP0A 5K8LA 5FUXA 3ADBA 5B30A 1N5LA 2WKRA 4DL6A 2NO1A 2R8HA 4A15A 1KZ7B 2W6IA 1E1QD 2BMFA 1CJUC 2CXXA 2EFHB 1G3QA 1UEJA 2W0MA 3QVVA 3O8CA 3KJHA 5P21A 3GMTA 3PX4A 2HJGA 5DI3A 4DOCA 2F55A 4QZHA 2HT1A 3FE2A 1OFUX 4UNSA 5D3MA 8ICQA 121PA 2ZI6A 4LY6A 1ZW6A 2ZU6A 4PO8A 4PPGA 4MA4A 5C18A 3ZIAA 1E3MA 3ZS9A 1G1MA 2FZLA 1JQLB 1EFRD 4QM7A 3IILA 1JPJA 2JEOA 1XB2A 3FVQA 2ZTDA 3A36A 4GNKA 3X1ZA 5F3WB 7ICUA 1FMLA 1GL6A 2C2HA 3PEUA 2QENA 2JLXA 5HCNA 5J2JA 4FS1A 4Z8XA 3ZS8A 1Z83A 4CEJB 4G5QA 8ICRA 5HMMA 4R64A 1GRNA 1Q1EA 3RH6A 1U9IC 1Z22A 4LI0A 4B71A 4ZCMA 4D2IA 3GJ5A 4KI0A 3K9HA 3PEWA 3P27A 5CK5A 4DL7A 7ICPA 2LYHA 5LB2A 3ZZTA 5CHGA 5DB7A 2FEMA 3AF3A 3GIJA 3K53A 2FSIA 4GOXA 2UVRA 1VECA 5KFGA 3V72A 1COWA 1SKYE 3FMPB 3PUYA 4JLPA 1NKCA 2R8RA 4AURA 1ZM9A 4OK6A 1XC9A 3GJ0A 1KSHA 1XEWX 4EUNA 2PI5A 3AEZA 4IVPA 3GILA 5C4GB 1E0AA 2OESA 2IT1A 2O8BB 3ADCA 2QNRA 3CPJB 4BDPA 1J2JA 4H1UA 4AKGA 4YLGA 1SVMA 4RQ7A 5FH9A 3PO5A 5KT7A 5L3RA 5FPHA 3H84A 3B7GA 3FHOA 2XJ4A 1P2TA 2C95A 4EKDA 3CR7A 1CR0A 4NLNA 4X8HA 1A2KC 1F2UA 4MH0R 2ASDA 3KJIA 4P32A 1D5CA 2UZIR 4CEHB 2DPXA 3THYB 2KZ3A 4Q1AA 3BDPA 1HT2E 1DGSA 5TMPA 5CB8A 3EZ9A 3H7IA 1LB2B 1GIAA 3QKUA 3K70B 3X2SA 9ICOA 1W0JA 4JUZA 2OE2A 5FR1A 3DEFA 4G5RA 4R2IA 2G83A 4NYJQ 3TI0A 4UBCA 3EW9A 1S9FA 3H2YA 2PFPA 4Q4AA 3A4MA 5AUOB 2JDID 4E22A 3QG5A 3BRWD 2O8FB 2JIZD 5JUMA 1OFHA 1X8JA 4URXR 1GNRA 3L0OA 4D6PA 4RD3A 4XIGS 2WPDA 2RGCA 2Z4SA 4B9MA 3RJHA 2BPGA 1TF2A 3QQ5A 3GJ6A 2HHVA 2AD1A 1CU1A 5AUQA 3QKSA 3PQCA 4Q9HA 4B35A 3GP8A 1C7YA 4JV0A 2BBTA 4NLZA 4G5GA 3B85A 3CWQA 1G7SA 1WMSA 2D74A 4NCKA 1MQ2A 4A6PA 3GEEA 3RS4A 4JLBA 1E6CA 3AGQA 1PVOA 2XO7A 4NPHA 3FB4A 1RXVA 1DO2A 4C0SA 5TDHA 2OO7A 1NMXA 4CVNA 4K4IA 3PW0A 1ZUIA 4MUBA 4Q44A 2AKAB 1ONBA 1IXRA 3ZDAA 2ZJ5A 2QSZA 3BH7A 3PV8A 2HF9A 4QJ3A 4CT5A 1FMJA 2CCKA 1U4BA 1SKRA 1LFDB 1VYTA 2R6GA 3OF5A 1II8A 2HXSA 1IN7A 2EYQA 5G41A 3CNLA 4Z8YA 3PW4A 3PJRA 1ZQAA 1BIFA 1F60A 3NHAA 3CZPA 4C4PA 1T7PA 4DCNA 3VFDA 5C1BA 4LHWA 3G82C 1S77D 1WCV1 4PPQA 4J0QA 3MFHA 1KZGB 4OI2A 2O0JA 3N2IA 4C7OB 1R8QA 2IF0A 2UVUA 1GSIA 4IDHA 4V0LA 1PZNA 5FOWA 1L2TA 1OXXK 4A0RA 1SKYB 3CUEF 1FNNA 2P66A 1S1MA 5KO2A 4QZDA 2V55B 1SQ5A 7ICMA 4G1UC 3TK1A 4KLNA 3FDSA 2IYQA 2NPIA 1HYQA 4IDPA 4C0KA 1U9LA 2JDIA 3ECCA 3Q72A 2H1LA 4QBHA 1CF4A 4MFCA 2FPMA 2C22A 2B21A 2J46A 1XTSA 2NO0A 1KJZA 3QPUA 3A1VA 4YONB 3QF4B 4TLAA 2H57A 3MGHA 1R8SA 2C04A 2Z5FA 3RS2A 4QZGA 2FFAA 4QHTA 4DFPA 5DYGA 3X1XA 1Z00B 3R9XA 4GC7A 3OSPA 5KG0A 2QMUA 2ZJZA 5J29A 1KY2A 3DMDA 2KE5A 2VP2A 3B1ZA 3GLIA 3ICQB 1NJXA 2ODNA 3PCRB 4KFRA 4WXPA 3M6AA 1DAFA 4LPSA 2O0KA 3Q8SB 3QF4A 3RB6A 4FN5A 2PT5A 5FTLA 3I5XA 5KFHA 3ASYA 1DPFA 3EARA 3SI7A 3TAUA 4EPWA 2UVVA 3U6KA 3EYZA 4A0HA 5DN6D 3A1WA 4I2BA 1UKVY 1TAGA 1RYRA 3LWNA 5FOVA 3K0FB 1U49A 1IY2A 4JVSB 5BPCA 3I61A 4J9RA 1PUJA 2OCAA 3LWLA 3JPSA 1XJ0A 2EW1A 2ZRHA 3WYGA 2EFGA 3U6BA 1CP2A 1NNEA 3EAQA 4PSKA 4DDWA 4MRNA 4LCBA 3TQCA 4ED7A 4Z51A 3ZVNA 3WRXC 4QBGB 1LNZA 1M74A 2J7KA 4OBEA 3FGNA 5G3ZA 2QTHA 2W58A 4I99A 4LJ5A 1K1QA 2C9YA 4BLOA 1RYFA 2QT1A 1KO7A 4GRAA 3T5LA 5DH9A 1US8B 1W4RA 2FSGA 3V00A 1R5NA 5KTYA 3ZJYA 3IIMA 3WMFA 2BBSA 2BCUA 4BZQA 3F3YA 2CJWA 2QT0A 4C0JA 1BKDR 1CJMA 1U8AA 4HAYA 5EP3A 2AHOA 5JFGA 1TAUA 1YZTA 2FJUA 1OFTA 5IHPA 1GKIA 4C8LA 3JZMA 1N6LA 3E5HA 3QEJA 2QEQA 1YZKA 2W9CB 1T5LA 3EC1A 4RUCA 3CONA 2FMXA 4IOLA 2C2EA 2Z43A 1Z3EB 3DKPA 4RD2A 2P3SA 2DFNA 3O8RA 3Q8PB 4Z1MD 4HI0E 1QHXA 5EE0A 1RJ9A 4NE2A 5E4FA 1OV4A 1Q44A 1UFQA 4M2YA 2DB3A 1WF3A 4XTRA 5DSZA 4QZ9A 4F5OA 3SJBA 3EA0A 4LWZA 2J0UA 4IQTA 1ZQPA 1KSFX 3IKJA 4ED0A 1HURA 4OQLA 4LJYA 4F4JA 3GFOA 3SJCA 3MDAA 4DO9A 4DSTA 3U44A 3DOEA 2IS6A 1XS9D 3QXCA 2RGBA 1KSGA 2OFWA 1XWLA 3QE9Y 2PJZA 1P9WA 4NZYA 1UT8A 4BXOB 5TVKA 3SU8A 4EPXA 5KHOC 5KNDA 1U98A 2OCYC 8ICAA 5J2CA 2VEDA 3UANA 1LW7A 3BAFA 4DQPA 2OXRA 2X2FA 5E7IA 3H8SA 3OGUA 1XCPA 4UQGA 4PQFA 2QTVB 4F4IA 1G5TA 2WJVA 4JJZA 3TSZA 1A2BA 4P2HA 3RJGA 4D81A 1GVNB 3KXLA 1DAMA 3JPNA 3K1JA 4NKRA 3G0HA 3P20A 3PUVA
chains in the Genus database with same CATH superfamily
1U4NA 1U8EA 2IYTA 3LLCA 2RAPA 2CXQA 4J16A 5KU1A 1GFIA 4KXQA 1ZD5A 4QWAA 4M37A 5J0OA 1I2AA 1E0JA 2IXTA 4NBWA 2DQZA 5CA1F 1WO8A 1UBGA 2ZBPA 5DBAA 2CHUA 2Y99A 3K9WA 3DM5A 4GR9A 2OGUA 2V7BA 4BBPA 2O8FA 1UMCA 3F9CA 4ITRC 4UU7A 1L8AA 3VNAA 1R0LA 3QHAA 2ZIAA 1CUDA 2FPUA 2N9UA 3T34A 1NURA 1I24A 5IWAB 1TJPB 1CUBA 1JLKA 2FK7A 2ENUA 1LQUA 3EDCA 1C4XA 1KEZA 3IALA 3T15A 3U5TA 4TYYA 1U81A 2YZNA 1RQGA 2O2GA 3PX3A 5FUWA 2F1OA 5KFYA 3G0IA 1CZNA 1GUDA 2J3MA 5JE8A 3VI3B 1HDYA 5KWEA 4QPZA 4WHMA 4PGGA 2JI4A 2HTFA 2VNKA 4QRHA 3UG6A 4BQIA 3MAGA 4JELA 1U94A 3DE1X 4J7UA 3RB3A 5CVEA 2I66A 2VANA 1B26A 4E2ZA 1F14A 4INPA 4IX9A 1AZLA 5NLLA 3E9MA 3VZQA 5AM3A 5L1JA 4MR9B 4C3ZA 4PC7A 4OHPA 4F4XA 1VHJA 4RM2A 3V7LA 3ORFA 4KDCA 3HL4A 2FQQA 1TCUA 5AVWA 5J4KA 1S76D 3SHQA 5JSZA 1O6GA 4NLLA 1PQYA 1J07A 2DQNB 3EGVA 3UPUA 3PC3A 4KWIA 4IGEA 1E2BA 3EPPA 2X8JA 1FMTA 1XZPA 8ICFA 4O3MA 1BN6A 1EG2A 1KDTA 2GJ4A 3RYFA 5M34A 3WGZA 2C0PA 3F1KA 1X6VA 3W2IA 1LVUA 1XDSA 3U40A 2QP9X 2IZ7A 3OPYA 4HDNB 3P0JA 1AK9A 1PL8A 1USKA 3LCRA 4II7A 8ICPA 3NJ8A 4PZAA 3EGCA 4KB5A 2G0NA 1NBMD 5C0YA 2IEGA 1JXQA 1ZEMA 5J2IA 1TTPB 1Y6ZA 2PUGA 2YOFA 1GNPA 4DT1A 4DG8A 1SCJA 3ONDA 3AKZA 1T2CA 3CEPB 3Q7TA 4Z86A 3E35A 3N8IA 2OHOA 5SV2A 3PNLA 3PPWA 1CY7A 2PMEA 5JRZA 4I5DA 2FN7A 3MGCA 4GZ5A 3AR2A 2A6PA 1E2UA 3C16C 3CUTA 4MX8A 3V55A 4KVAA 1B8VA 3HKZC 5IDXA 1J42A 5KS2A 5JDIA 3EVNA 2C83A 3H3JA 1L1QA 3IE0A 2PLAA 2VDMB 3ICOA 3QVWA 3BXZA 2DR3A 1YIDA 3CW8X 3GHYA 3QVXA 1XXLA 3MJDA 4ZT7A 2HLDD 4S04A 2ZJFA 3EVGA 3GAAA 2A0WA 3FZQA 4JXXA 3T7KA 2XDWA 3ADDA 1R50A 3V9AA 2JGAA 2KSOA 5GV7A 5GJBA 4ZT3A 1RZ3A 2XY7A 2ZW9A 4OGWA 1OBVA 4FS3A 1EUDB 4X8LA 7ADHA 4B7AA 1FMFA 1CK4A 3W5DA 4XWOA 4WFKA 1T4GA 2QARA 2N0SA 2H00A 1Z00A 2GESA 3VMFA 3WDKA 3GPCA 2H17A 2XT0A 1CRZA 4PLZA 1SXIA 1P6UA 4QWEA 3LVVA 3GDXA 1H1LA 2C2RA 2GN4A 2OG1A 2WP8J 3LMKA 3R6TA 4R3UC 4XA8A 4WJ3B 2WK1A 1UXIA 4FDMA 4FUQA 1NOMA 5AP9A 2KVCA 3INNA 2ZIWB 2H54A 4Z54A 1QVRA 1KO1A 3EVEA 1HOXA 1U3WA 3KBOA 3MNFA 4LV8B 3RH4A 3MG9A 5FX2A 2LMRA 2XMCA 2D2FA 3KG2A 3FSJX 3OZDA 5K6AA 1YA4A 3OF3A 4V0NA 2EAMA 1JRLA 1QQ7A 1LPSA 1ODSA 1V25A 1V39A 2H5EA 3BCSA 3Q9SA 3HEMA 3I32A 5IVPA 1TM7E 2KW5A 4K6OA 1A9XA 1NW6A 1SU7A 1IHYA 1JUDA 1IM4A 5DXAA 2VA3A 1J5PA 2VJYA 3LKDA 2HF8A 3OLQA 2PFOA 3MEQA 3OQMA 4IXTA 3GLTA 4AQYB 4KX3A 5J0UA 2HW3A 1TYDE 2Z98A 3K9GA 2Q3MA 3N86A 4NBNA 4GGPA 2VPPA 3LY9A 3THRA 3KQPA 4FKMA 3U3OA 1K92A 1MB0A 1SB3C 3OAAA 4NJMA 2WSMA 1JILA 5DM0A 3W4IA 1W4CA 1RE1A 2WZDA 2DFPA 7ICVA 1VE1A 3HJNA 4QRDA 4A82A 4UPDA 1H5UA 4D6YA 2HRZA 2WWVD 3VSAA 4DTCA 2A67A 1UZLA 1MVLA 3L18A 4BFTA 3TM5A 5D5PA 5C8XA 2I3DA 5EOZA 1ZC4A 3J81j 1AGYA 2XT6A 3H3XA 3HH8A 3GGDA 3R0IA 5SYNA 1F8XA 1P29A 4RIFA 1IQRA 4QZFA 3QLVA 4HQRA 1ML4A 5JSQA 1BYIA 2BI8A 2DECA 3JQ7B 2QX4A 4EUSA 5FFFA 4OQNA 3SM9A 2ONJA 4FS2A 1IB0A 2FWJA 1JMKC 2WKWA 5FJJA 1T6YA 1Q1GA 2HHLA 3AUJB 1V1MA 1CBUA 1T8WA 3ANNA 1QQ5A 2QDKA 3M6VA 1S96A 3I58A 4M1EA 4OQFA 1JLHA 2R97A 5IS2A 5ETJA 1E2EA 2B1GA 2HZBA 4J0KA 3W2EA 4ED3A 2E4WA 2FX5A 2H1FA 2KNJA 4WEQA 3ZWCA 1YZUA 2XWPA 3CKMA 1ACLA 4FHEA 4I08A 4RCVA 4HH4A 5H9WA 4DV7B 5DQGA 1BGWA 1U2GC 2C3MA 3ZWVA 4L9SA 1Z8HA 4HAWA 1A95A 3D02A 3F9RA 3KKAA 1JBEA 3CLRD 3QUAA 1L3IA 3IIJA 4WBSA 3A6ZA 2VJCA 1NVMB 1R8JA 2B6NA 2WWTA 1E5XA 1U90A 3LKVA 4K7JA 4KO1S 4QNMA 1DRWA 2BJHA 4J0CA 1RYNA 3F97A 1FYXA 2FY8A 1P8AA 2MUTA 2EV9A 4L8LA 5ELLA 4MUHA 4BO4A 2O6HA 1H5NA 2PRKA 3FNRA 1SCBA 3V4PB 4ARZA 3QYPA 2DJIA 1JMYA 3CN9A 3GARA 1MAHA 1P1JA 1QTIA 3KPWA 2WF9A 1J1UA 2IYWA 3W6NA 4F6CA 1JJAA 4U6NA 2OR3A 2ZUDA 3JWPA 2QE7D 4P08A 5GPBA 4BNDB 2GXSA 4RQAA 2OV4A 2J4FA 2SKEA 2G80A 2QUHA 1GPAA 1MHPA 2COEA 1U7HA 1ZH6A 3B8HA 3CGGA 3IMCA 4L57A 4TSRA 2GEDA 5J2BA 3G1WA 5A03A 5JQGA 5KU7A 2PBLA 3QFCA 1NOJA 4RH0A 1HE5A 2I76A 3HVRA 3RAQA 1CERA 2C9BA 5J5AA 1UBLS 2Z5LA 2L19A 1G21B 4UAUA 3R5XA 4E0BA 1V47A 4UB1A 4XX1A 5AVXA 3NAGA 4XTCS 2JGJA 3SBEA 2PANA 3TWOA 1P7CA 2BHSA 3I2GA 1GQFA 2O7NA 3AKCA 2AFIB 5G02A 1ZQYA 4DF8A 3CLKA 5KUTA 1GPH1 1N2BA 4J4HA 3ZE7A 2QMOA 4RWZA 2WPDD 3C4QA 4UD2A 4C0LA 3CLTC 4QJ4A 4ECVA 3CH5A 3HN2A 4QOSA 4Z0HO 1VYUA 3MDCA 3DUWA 3FNHA 3UC5A 5CDSA 1SKAA 4MDEA 2GDJA 5HTOA 3A6EA 3HLYA 4CLEA 4R8KA 2B0JA 4BRZA 1ORDA 3BXHA 4N3BA 6YASA 1VPDA 4J29A 5KT3A 4NYMQ 3FETA 1KJWA 2W37A 3ZV7A 4EG0A 1HL3A 3L2OB 3BE4A 1RCTE 5ICMA 4DLEA 2EU8A 1U2PA 4YXMA 4BMOB 1U3CA 2IHZA 5K45A 1M2VA 4PRYA 1YU9A 3OIGA 4ALLA 1EVIA 1Q7BA 1EFDN 4B17A 4ZI7B 4M60A 2GXAA 2BFCB 1GG5A 3X1YA 3IOEA 4YJ2B 5LP6A 3V6HA 1IG0A 1TK9A 3EXEB 3U3MA 4UULA 4BWMA 5L8VA 2W43A 5EWEA 2ASJA 2EIXA 8ICIA 2PKCA 3S81A 4XQ0A 3OEWA 1PL0A 3R2JA 1BROA 2E5FA 3L6RA 3DFFA 1X7WB 4IEFB 3L04A 3JPOA 1PEDA 4H1WA 2K5UA 5JXGA 1GYPA 4IRMA 5F4ZA 4CF3A 2ZQ5A 3DQQA 1O6BA 1A82A 5LPNA 5ALUA 1NXXA 3S2UA 4ZQBA 2QB5A 1YACA 1T5OA 1R37A 2RB4A 2VJMA 3PITA 4GAEA 4KLCA 4Q66C 1R0ZA 4S3MA 3K09A 5DT9A 1JJ7A 3DL7A 4ZCRA 5BSKA 1E0DA 3HFJA 3RBXA 4KYIB 1BCSA 3O6VA 1MQ3A 5CPBA 4YAJA 1FX0B 1XZ8A 3A9SA 4OFZA 4CCAA 1MJGA 1R2QA 1XTPA 3D64A 4WXRA 4G4IA 1U2RA 3B6KA 4ND7A 3DEZA 2IS1A 4QG3A 1Y89A 1Y42X 2AK3A 4IZOA 3VJKA 1YZHA 1RMTA 1S7GA 3A8TA 4I1IA 3HVHA 1RMYA 1HG1A 2XPCA 4P38A 4KV9A 5CHYA 4AG6A 4NZ9A 4YP0A 3FCYA 3M4JA 3GFBA 2XB4A 4G5YA 1Y3DE 3W7BA 5HZHA 4O63O 2ZRKA 4YDRA 4QO8A 4YD1A 4BFZA 1PV4A 1W6UA 1YS9A 1WB4A 5K6TA 3L7AA 3TVTA 3G7NA 4ZZ0A 4AWXA 3BMQB 3S3TA 2JLRA 4DR6B 3I2HA 2F43B 3IJPA 1SULA 1WLYA 5JAMA 1SHTX 1B74A 2DUNA 2JGFA 5ALRA 2WINI 3BE5A 1LUAA 2IPNA 4ECTA 2OV2A 4CLRA 4WW0A 2ZSHA 3D7NA 4KIWA 4MUXA 4QECA 1N77A 4K9KA 4DJDC 4O5KA 3ZY2A 4RZQA 2BEUB 3A32A 4RYDA 3I30X 2JXJA 4FTWA 4O29A 1ZM2A 1ST2A 1QFYA 2MRLA 5FUYA 1AGRA 3KQLA 5EUCA 3V80A 2W8KA 4LK2A 2FRXA 3VKHA 2YIJA 4OLFA 5TGDA 2OSBA 2IUUA 1J8VA 1R15A 1YK0A 2XVZA 2DWQA 3ROZA 1G7RA 4WCFC 4CQLB 3IAEA 1KOLA 1JHDA 4FHDA 4A0QA 4C6TB 5GZ3A 5T14A 2FW9A 5AI4A 3EF1A 3RE1A 5JTUA 4QFMA 2K2WA 2VJNA 1QF6A 3OEHA 3PQ3A 4Q0MA 4MWSA 2WWGA 1YMVA 3HGMA 2F59A 4QOEA 3ISCA 4E7OA 3EUEA 3JVEA 3LECA 4QTUB 5AJHA 2ZB8A 4OCZA 3IB6A 4LZWA 1L3VA 3CNNA 4N5IX 1YC2A 1RRKA 3F6RA 4HQKA 4JQYA 2F8LA 3ZVRA 3FMIA 3RC9A 2D5IA 4MCAA 4LOIA 1ZI9A 8ADHA 2GBIA 3VZCA 4BEBA 1L5HB 2F00A 2ZRLA 3CZRA 1Z39A 1VJGA 3EZYA 3L4EA 2HBMA 4NI5A 5KNBD 5IJXA 4RHFA 5GQSA 1QONA 3QYFA 4WI1A 2WJIA 2Z2YA 1UT6A 1XEAA 3DLAA 4OK3A 5EYPB 1FP6A 1TMGE 4Q12A 2XZOA 3Q8QB 1MA0A 4JBWA 2F1RA 5GIOE 1U5AA 3EDOA 3FN4A 3K9BA 3UCFA 3GV7B 2X3UA 4IXDA 1LQTA 4P3YA 1ENOA 1KVSA 1U9ZA 3P19A 1J24A 3UW1A 2G06A 2EYUA 1SBZA 2AGOA 3N87A 1GU1A 1NMZA 2ZJ6A 3DA8A 1J2MA 2QAGA 1NKEA 5BN5A 1MW8X 2FETA 2IUSA 4J91A 4RL4A 5ES3A 3DE5X 4LNUA 4BO7A 4DM4A 3SVTA 3ODGA 4TURA 1JDSA 2REXB 1ZQKA 1Q0UA 3IBFA 4JROA 2LGJA 3L7NA 5J2DA 4NATA 3VX4A 1TA9A 2V8OA 4NESA 1P1IA 4QIWC 1U11A 1KFKB 4Q48A 4MP3A 1NQ5A 2Q50A 4EFDA 4LS3A 3ZW8A 2UDPA 4PYJA 1CY2A 3FDZB 1ISHA 1KSPA 3P52A 4FE3A 4OUDB 5GVSA 4FGWA 3OM1A 3LYLA 2W71A 4RVUA 4TVKA 3AVWA 3K9CA 4H6WA 1GCUA 1DB3A 1E9SA 2XNKA 1WDMA 3TG2A 5JCJD 1W0KD 1YCFA 2GKOA 4OU4A 4DC9A 3ZBPA 4LHYA 1OWLA 5H3CA 3HY4A 1C5KA 1XLUA 3Q3CA 5F1KA 5KG2A 5A7HA 3WBFA 9ICBA 1PQ4A 2HMUA 4NK4A 1Z8DA 4A92A 2AXPA 2VT3A 3IEPA 4JUDX 3OZRA 3WJ1A 1RLIA 4IJVA 1HLPA 1NE2A 1K0FA 2BFWA 4KGDA 1R1DA 5DM2A 4BQRA 4BE7B 2J7PA 3W34A 4ZVTA 2QW8A 1SJ9A 4ND2A 2R6FA 4OP1A 3HPOA 5L6MB 2J3KA 2CDRA 4KKVA 4R1UA 3AM4A 3C7DB 4I1OA 5FBZA 2ODQA 2X0NA 4NHEA 3DF9A 2G5HB 3T7JA 3W06A 2XIDA 2VSFA 4UHBA 4FZNA 4U4AA 4ED8A 1GZ5A 3UHOA 2BGNA 2PKRA 1CUVA 1UM8A 3KAPA 1SXJD 3TMAA 1SOUA 1QB8A 4OJ5A 2Q8QA 2ORVA 3MTQA 2EVWX 1OXBB 4HYQA 2C7OA 2NUAA 2I7VA 2C4MA 4HWGA 2WU3A 5DP1A 3H7AA 3JPQA 1SCIA 4OAOA 3M1IA 4YMTA 2FLPA 4X1IB 4Y1RB 3JCZA 4C80A 4LOKA 3SN6A 5JD6A 4JKOA 4BTEA 4HS4A 2BKUA 3NS7A 1B6TA 1T3HA 3DOJA 3TNFA 2PSHA 4IZ6A 1XWIA 2CSXA 2QM3A 2D1YA 4LXXA 1Q83A 3HWX1 5JBIA 3ZXXA 5EE1A 1UADA 3KV1A 4U2CA 2VIIA 2R751 3DMGA 4MWDA 2CXSA 3GLHA 4CU2A 2D00A 2WQ6A 3BHNA 4FOOA 5C1DA 4ZC1A 4KQWA 5TIIA 3V2UA 3T4XA 1XTZA 4X20A 4A8EA 4QJBA 9ICCA 1QS0B 3DE4X 3ZQUA 1Y3FE 4GQIA 3R20A 1LRJA 4GOMD 5I5EA 4BX8A 2GSWA 5DO9A 4HGPA 2C29D 3DE7X 1HZZC 2QYOA 3MPUA 3NWPA 5JNVA 4M0AA 2PLNA 1DEXA 5F9MA 5D46A 4DF3A 3HUUA 1BW9B 3D0RA 4P4GA 2H65A 1H2FA 1W88B 4HSEA 5ERYA 1DMSA 1PZMA 2FR0A 3DC7A 1R74A 4KMOA 2Q3HA 2ZG6A 4L9AA 4PGHA 2HJHA 2TMDA 3T5GA 2W8LA 3U13A 1DG3A 4HLDA 1XPUA 2OCDA 5CA0A 2W2TA 4RXUA 5IM5A 4AX4A 4HEA1 4CCHA 2HHTA 1VBNA 4CTKA 1YOVA 5L1LA 4CV3A 3WLQA 1PWXA 3R4VA 3L8YA 4ND4A 2E87A 4C4XA 4FONA 4PC3A 3FPLA 4GYWA 4TKMA 4DUYB 2BQRA 4QD3A 3WYAA 1KPGA 1QIMA 2WT9A 4WGGA 5COAA 3UW3A 5BQXA 1XTKA 3IVGA 1UC9A 2G1JA 3O4HA 4BKQA 4F7DA 5BXQC 3R6GA 2QRHA 5AW7A 1Z4QA 5AK3A 2CYAA 2PRSA 4WH0A 2I4LA 3U7JA 1TEHA 1KKUA 2H8GA 3FCCA 1S9DA 3WJAA 4I55B 5KG7A 5B58C 1S3SA 4TQRA 3WLRA 4ENTA 2OXCA 2FN4A 1Z88A 5I45A 1GPWB 2Z4TA 4WKBA 1EJ2A 2NU9B 3RR2A 4F5DA 5AM5A 4A6DA 2VK8A 3AEKB 5ENDA 3KSAC 1SY7A 4CQJA 3QI2A 4M9NA 1ZK2A 1L4EA 1ZVVA 3R3UA 3M9OB 5K4HA 2PVSA 4MWZA 5CVCA 1VGVA 5L9AA 3CVJA 2GJSA 4U6SA 4W7SA 4YAFA 1KFJB 4M9RA 5U9CA 2XUKA 2ZTMA 4WADA 2QX8A 2FKNA 3ORYA 4N65A 2JA1A 5JS2A 1E9CA 3EZNA 4KUEA 3KKLA 1J7JA 4NMLA 1D2AA 4LJ8A 3OHMA 5LP6B 4YJ2A 3H4DA 4FPXA 1KI4A 4TMYA 1DUIA 4UEOA 2DKNA 2X42A 2F1HA 1AF7A 1NP6A 5IW8A 4UB3A 3F96A 9ICWA 1IOZA 1M6WA 1TQ2A 2UYQA 3CF4G 3AUOA 4HWKA 2HHSA 4IDCA 4KLEA 4QWMA 4QXQA 4XIJA 3I64A 3EXHC 1PT7A 2W7TA 1N75A 3B52X 3CNBA 4NBKA 4E5VA 4HX9A 3T5KA 1NXOA 2WYHA 4G0WA 1BNOA 1NSTA 3VOAA 2HT6A 1GUFA 4OM7A 1M76A 3I2JA 5TARA 1XT6A 4TSFD 4DLGA 2KEYA 3JQFA 4DFJA 3CX4A 3P32A 2PX5A 3F3MA 4X61A 1L4NA 3OU7A 4NEGA 3RC3A 2WAYA 1QO9A 2P4HX 2XITA 3MWFA 2RSLA 5J9FA 1PUXA 4C0QC 3GP5A 3S44A 2CSUA 5DTRA 1W4ZA 5FKJA 4AS2A 3BQ2A 2Z83A 3M81A 1ISJA 1FYDA 2CVZA 2VL7A 1F6BA 2PA0A 4WZZA 2PEZA 2VCHA 1BE6A 1KYYA 1M6VA 2WJZB 3CUYA 2QRLA 3K31A 1TZCA 4PS0A 1NBIA 1AGXA 4R1QA 1HY3A 4JWKA 4O25A 3HU2A 2C99A 1HBJA 1KH1A 3GGJA 1IXYA 1DCFA 4KUGA 3BTOA 3ZCUA 5FL7D 4N9QA 1AY0A 1WS6A 2CVQA 1OFGA 3H1AA 4FQ5A 1YDFA 4F2HA 3I4CA 3UYKA 4MCJA 721PA 4O5AA 4ZU1X 2BDPA 5C80A 2G25A 1P2BA 1W19A 2IUTA 2GAFA 3GVIA 4M8NE 1N2GA 1N5OX 4HL6A 1MIOA 2CF5A 1P4SA 2PFKA 2IUFA 2XCIA 3A26A 4X8MA 3X1WA 1GARA 2G4CA 2IZ1A 2YYYA 4QEKA 4EY8A 5IK2D 5JT1A 4QM6A 1L9KA 3D2CA 3H9GA 1W1WA 3HKDB 1XRNA 3JAWB 3HB5X 4GD3Q 4NCXA 4PHGA 4Y9TA 4E5PA 3M5WA 3TZBA 5GZ1A 3EEQA 1FUUA 3JQBC 2CVHA 3U7IA 3J81A 1E5VA 4I2EA 3OURA 4LZJA 4M49A 5CJPA 2N75A 4LOJA 2Q5EA 3K15A 2UU9B 2Y3IA 2PUVA 1URJA 5KG3A 9ICIA 3DZCA 3NHKA 3UUGA 4UHFA 1VKNA 1USWA 1U3VA 2D4AA 3KSMA 3GRCA 1GCGA 3L5OA 2E3TA 1RRMA 1T9AA 2AFHB 2QTAA 1NIPA 2BGJA 2OV1A 3F6PA 3HB1A 4LN1A 4BV8A 4JMUA 4JN6B 4YMUA 4I2AA 2B78A 1NQUA 2O52A 4YECA 5EJ4A 1EGAA 2AT1A 4DCUA 4EKYA 1XNJA 1HDIA 5CHEA 1DRKA 2PX8A 4EEKA 3A1CA 5I01A 1P8JA 2X0JA 1MXFA 1N2ZA 1N34B 1G21A 4Y1FA 3DAHA 4EEZA 5GJCA 1ESDA 1ORHA 3DFZA 4FGSA 1KK1A 1RVV1 1T8PA 1X38A 1FF9A 1QH8B 1Y7IA 3NHJA 3BE6A 3T3PB 2BSXA 5JYEA 3GY0A 3TFQA 4QUJA 3E9NA 5ENZA 1J0BA 4LOHA 4G0YA 1U48A 1XVVA 2BTQA 5EIBD 4ENQA 2C03A 3L0YA 3NQ41 2QTTA 4FCWA 3UT6A 3VR6A 4EY6A 4CM3A 3EDRA 5HUJA 2XGJA 1X7XA 1X80A 5BSGA 2XY4A 1O6FA 2ORED 4BUZA 4D4MA 1DXQA 2RQ5A 1XNSA 3BQTA 2GN0A 3ABIA 4MO9A 3WC4A 1K6JA 2Y1GA 1KWGA 1L3BA 1YZYA 3HA2A 2OC9A 5L1MA 1DOAA 3ETRA 4UHHA 1JPNA 2QROA 4PHAA 1TM5E 1Q74A 2WZBA 2ZRCA 2ECPA 2ZWOA 3Q9LA 5K4LA 1SVOA 3JW8A 2R65A 5EP4A 1BGXT 4D9KA 1ZG3A 2FZ5A 1LF5A 4HDSB 4YT8A 1QFSA 1LV5A 3OJUA 1A2QA 1COWD 1QBKC 2C7GA 4JY7A 2ZE6A 4ZVPA 1BQ4A 2HA6A 4KMSA 3LP8A 4RTQA 3GYGA 2A1TR 4MQUA 2BJVA 2GWRA 4HUJA