1U0LA

Crystal structure of yjeq from thermotoga maritima
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
291
structure length
278
Chain Sequence
LRRRGIVVSFHSNMVTVEDEETGERILCKLRGKFRLQNLKIYVGDRVEYTPDETGSGVIENVLHRKNLLTKPHVANVDQVILVVTVKMPETSTYIIDKFLVLAEKNELETVMVINKMDLYDEDDLRKVRELEEIYSGLYPIVKTSAKTGMGIEELKEYLKGKISTMAGLSGVGKSSLLNAINPGLKLRTTTTAQLLKFDFGGYVVDTPGFANLEINDIEPEELKHYFKEFGDKQCFFSDCNHVDEPECGVKEAVENGEIAESRYENYVKMFYELLGRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable GTPase engC
publication title Crystal structure of YjeQ from Thermotoga maritima contains a circularly permuted GTPase domain
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 79
structure length 278
sequence length 291
chains with identical sequence B, C
ec nomenclature ec 3.6.1.-:
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03193 RsgA_GTPase RsgA GTPase
A PF16745 RsgA_N RsgA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.50 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Probable gtpase engc; domain 3 1u0lA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1u0lA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u0lA02
1IHUA 1IJFA 4CEIB 4ZCMA 1ZJ6A 3T1OA 4GOKA 1WB9A 1Y63A 5ELNA 3QG1A 4A6PA 1OE0A 2CDNA 1P8LA 3FKIH 2ZRAA 4Q19A 1XJVA 4ZI2A 1P73A 1OXTA 2OE2A 2NO6A 4ZV4A 2YWFA 2AHOB 3V9PA 1G8PA 1EESA 2NVYH 5FJ8H 2IF0A 4ZIRB 3L8ZA 2WOJA 1MO4A 2D0PA 1ZNYA 3W1GA 2YTYA 3JAMc 3KKMA 4JVNA 4Q4LA 4Z8YA 1VQCA 3MCAA 4YDSA 4KVAA 5JRZA 1WBBA 2RHMA 3CP0A 3TREA 1ZM7A 3R7WB 4Q9IA 1G4AE 3V00A 4L9WA 1FX0B 2F6RA 1II9A 5DN6A 1Z6TA 2GAOA 4LNQA 2ZSAA 4KHPQ 1GNQA 4POGA 2ONKA 4BFSA 2A5YB 2KBFA 2FMXA 4IXMA 4DR6L 4RVCA 1KRSA 2B21A 1JPNA 3M1IA 3REGA 1G1MA 2YZ2A 4A92A 3ADKA 2ZANA 4RMFA 1YZGA 2ZI5A 1HURA 3KUDA 4LJ6A 4O25A 3KDFA 1RC8A 4UNSA 1SE8A 2BM0A 2E5LL 2MNAA 2Q6TA 3AKDA 3FKSA 3THYA 4ITRC 3MMPA 3TSWA 3U7EB 3JC66 1U81A 5DGXA 2JA5G 1QRAA 1AS3A 1XMOQ 2WKPA 1G51A 4US0R 2G3YA 4BEBA 3RZOH 5BR8Q 3ZD6A 2L15A 2P6RA 1D5CA 5M3FG 1KOFA 4P0TA 3T12A 3G5UA 3K0SA 4Q9LA 4CGZA 3BBPA 1PH1A 4Z54A 4E03A 2WWYA 1M7GA 4A4IA 4PR0A 3TMKA 1VCMA 4G5OA 3BC1A 1JMCA 3QUSA 3QKUA 2NVXH 3GLIE 2IF2A 4C2UA 1PH4A 2DYKA 2F9LA 3U2QA 2DY1A 4HJ8A 3K1JA 1FGUA 3W5OA 1NVVR 3HU1A 2ZUCA 3QENA 5AJZA 3VTKA 1PUIA 4V02A 1DO0A 1XCMA 1IN5A 1PLJA 2OFXA 4YONB 2ONJA 1G4UR 3IBGA 2Q3MA 2J0SA 4IOLA 3HKSA 2R6DA 3NDBB 1TPZA 2BJWA 1W46A 1YHAA 4GPTA 1VQ4A 2PLRA 1W5SA 1R2QA 4UXHA 1N6HA 2WJJA 1HZ9A 1QHNA 4I81A 2VHCA 4DV0L 4WW0A 2YTXA 2GZDA 2IS4A 5C2JB 2CJWA 1KAOA 1XBTA 3EZ2A 5H8WA 3TQYA 1VPLA 2QTFA 3B5JA 3NELA 2V1XA 4XVUA 1XEWX 2XOKA 5DH9A 1E9FA 1OSNA 1VS0A 2CKZB 4BE7B 4FWTA 3CO5A 2GJSA 4S2EA 1SVIA 2OZEA 4O2DA 4LYFA 5CYPA 1VKJA 5JEAJ 3OYYA 1I3QH 3LQQA 1K73C 1K0RA 2W00A 1IN6A 1M1YE 3ZZUA 3VR6A 3R9WA 2YWGA 4TYNA 3GFPA 4DVGA 4GOJA 3AVTA 4LOAA 1E1RD 3ADBA 4FMDF 1AE3A 1U8YA 3HOWH 4TT3A 1UM8A 2VLIA 4Q02A 3P32A 4MTNA 1N33L 3I5YA 4YWKA 3TIFA 2R6GA 3NBZC 3EIQA 4V0LA 4GN4B 3KJHA 4PAMA 1YZLA 3LBIA 3WXMA 4R4CA 3STBC 4URWR 4DSTA 3X1XA 2ERXA 5BR8L 2ZI6A 2E2HH 1TEVA 4C2MH 3TH5A 2IX3A 1D9XA 3C8UA 1N3BA 1Z0KA 4X8HA 1FZQA 3CKLA 2CL7X 3SEAA 1DAGA 2DCUA 1JI0A 2VSOA 1HE1C 4DR5Q 4H9GA 5EE3A 221PA 1KO8A 1JR3E 2VUMH 2I1QA 4LF8L 2TMKA 2B3GA 1G7CA 4LF7L 1DTSA 4TL6A 5E7MA 1G5TA 2Q9CA 2ZJ8A 5B58C 1XMSA 5H70A 1AM4D 1WFQA 4NH0A 1G9XA 4BA1I 2V4ZA 3IIJA 3K9NA 4EJSC 1BYIA 1CJUC 4MRRA 1A0IA 4AYBE 3L82B 2ERYA 2I5MX 1Z2CA 3BS4A 2GXUA 3L0IB 4UKDA 2EWWA 2O8DB 1E0SA 3CZQA 2CWAA 1ZUHA 1KIMA 1Q1BA 4RFSB 1YZTA 3FMFA 1E9CA 1GTVA 3CRQA 4B73A 1YZQA 5GADl 2ZR0A 4Z51A 4LHYA 5IT9c 3EPHA 3ULLA 4KV9A 2VQEQ 1PUJA 3X1DA 2V55B 2X2FA 4OO1G 1G6OA 3M4OH 2ZJZA 4BLTA 4F4IA 2RAPA 2GAAA 2Z4SA 3GLGB 3BFKA 4TMXA 4JLJA 1MJCA 3D3QA 3S14H 3FFAA 3CMEA 4V03A 1UADA 3PF5A 1YITA 3HOYH 3E5HA 3QG5A 5D3MA 4GOPC 1I2DA 4TWZA 2YVUA 3GLIA 5JI3E 821PA 1T3LA 4W7SA 2VH5R 3RRYA 1KIXA 3M4QA 4JLVA 4YMVA 2OSBA 4L16A 4PHGA 4BWYA 5E3HA 2HYIC 2J59A 2F55A 3OTOQ 4O2LA 5AJWA 1N36Q 5FTKA 1TMKA 3RSOA 3ZQ6A 2DB3A 3S16H 4GP7A 1BVSA 3CRMA 1G64A 1KI9A 2IYSA 1Q8KA 4AYXA 4LW1A 4ZDKA 1W2GA 3CUEF 3H1TA 1Q57A 2DFTA 3K0CC 4TTPA 4BA2I 1OB2A 5JWRA 5FTJA 4A6XA 2YWHA 1N5LA 1U99A 3ZJYA 1KI8A 1CSQA 1S3SA 3SNHA 2C5LA 5A4JA 5EZ6B 4X66L 3PEWA 3UG7A 3GLGE 2XXAB 1A7JA 3GJ6A 4Q18A 2ZJQA 2DUDA 3S17H 4IPHA 1EXMA 3SZRA 1T91A 4MGIR 3KXLA 1RIPA 4ACAA 3OE7D 2RGBA 4BZQA 1XNJA 4HAYA 1T5IA 3KQKA 2WICA 1P2UA 2DFKB 3RC3A 3I72A 2N8NA 4EIWA 3IEUA 1U98A 2V8OA 4OKSA 2FGKA 1TF7A 4OHVA 3GJ0A 3BERA 4JT2A 3RLOA 1HQYE 3ASZA 3UATA 2OXRA 5KNDA 4IVQA 5C4MA 4IPDA 2IBMA 3DHWC 1JECA 3QEOA 3DEFA 4FN5A 4XIGS 1ZAKA 3RS7A 1NKSA 1GKYA 3VHXA 1N34L 1WQ1R 1KHTA 1LVGA 4QJ5A 5EE5B 3U6KA 2JLXA 4IFDJ 5IYCH 1RVDA 1Z0AA 5K8LA 2OQ0A 1GL6A 1GD7A 1G8HA 3M7NA 4A3LG 2YWEA 3T15A 3VR4A 5JCZA 4HSEA 3W5JA 4TT3D 4RKEA 3J81j 2UXCL 2WHXA 1KSJA 3K70D 4C2TA 1N2CE 1JAHA 1YJWA 1Q7YC 1XXHE 1SR3A 2G1JA 2J87A 4AD8A 4BGDA 4DB4A 5F9HA 2VP0A 2JEOA 2JLUA 4R1JA 4DLXA 1KI6B 4FIDA 1M74A 3LW8A 4D26A 3HU3A 4ZDJA 1GIAA 1ASZA 4QGUA 2Y0SG 3MUFA 4DV7L 4V0NA 3TW8B 3C14C 2KCTA 4JJKA 4XD7D 1SVMA 2Z0MA 4HEJA 5KPDA 5IP9H 4JI3L 2FX3A 1GSIA 3T1YQ 3ND9A 4PO1A 1G19A 1FPMA 2ATVA 1I50H 1DAHA 1GKUB 1IM2A 1YZNA 3S2DH 3B85A 4PSKA 1E2JA 3R20A 2IHBA 1ZD8A 3TGPA 4HZIA 4DUZL 4MA4A 3KB1A 1XMJA 3RN5A 4GNXB 3DMNA 1BYUA 1TQ4A 4NCNA 3L8YA 2GF0A 1EWQA 2CCGA 2VQFQ 1W0KA 4JI3Q 5IWAQ 3GP8A 4BBSG 3B1VA 4PMWA 4JI8L 2XAUA 4DCTA 2B63G 3OIUA 3W8NA 1I5FA 5TB5A 4BECA 3AF4A 1X1SA 3CF2A 4FMCB 1O3YA 4L15A 3ZS9A 2QP4A 4GT1A 3GLHB 1IY2A 3KDSE 4QBHA 4K46A 3HOXG 5TMPA 1PH6A 2R7ZH 4DV6L 4JV5L 4MRNA 3GTKH 4A15A 4JI8Q 1M8PA 2B8WA 3KQNA 3U44A 5IWAL 4R2IA 4B3FX 4A3GG 4RD3A 5JS7A 3HYTA 2FV8A 1LS6A 4B3MQ 2QORA 1P16A 4LFAQ 4DR2L 2H57A 2OBMA 3IIKA 4I1OA 4JKYA 5HE8A 2RGEA 4Q03A 4S35A 4G5RA 5DNYB 3T1TA 2VZAA 4A3IH 2R2AA 4AKHA 3SHFA 3BB4A 3NHAA 1GP2A 1Y3AA 4C7OB 4PHHA 1N5IA 1NL3A 3RANA 4DR4Q 4Q9KA 3PO2H 1UF9A 2BCGY 4GN5A 3X1WA 3F2CA 5JJIA 5ELXA 1XNQL 2WAQE 1FP7A 5DISB 3W9YA 1D8LA 1M7BA 4EQ6B 4EQ6A 3K0FA 1C0AA 1KY2A 4A75A 1JXMA 1SHZA 3QF4A 3QKRB 3QXHA 3TR0A 4ACBA 4IPCA 4AIMA 1SXJE 2H92A 2HV8A 2MSDB 3QPUA 3ZLJA 5AUNB 4Q5IA 3FPAA 2VO1A 3UDXA 3N2IA 3FMOB 4UXIA 3ZD7A 2C95A 4JI1L 3T1HL 3DOEA 5KOYA 1E2DA 1FVIA 3BE4A 5LMUL 2OT3B 4N1AA 4QHTA 4M1TA 1TWAH 5FI0B 2CWPA 2OILA 2ATXA 1U8AA 2QZ4A 3B9PA 3NBXX 4DV0Q 3HKZG 2CJWB 4FMCF 4JLNA 3KF6B 4MRPA 2HJVA 2VS1A 4JLPA 4K0KL 1JJCB 1ZU4A 3RWMB 4YHHL 1EYGA 2AXNA 4US1R 3QIAA 4JI7Q 1XTSA 5J4LA 4Y7NH 4KSCA 4ZI3A 1U5KA 3ZVLA 1OH8A 4Q4AB 4TLEA 3CW2C 1MT0A 1SHKA 4B48A 1VQPA 1ZUNB 5C0XI 3BAFA 2DBYA 4FMBB 4IPGA 3H0KA 2FFAA 4DV4L 4BLRA 2WP8J 4LDJA 2ODWA 3LY5A 2YOFA 4C3ZA 2ASBA 4DIEA 1KNQA 5EE0A 4LWZA 5TDHA 1SZPA 2NO0A 2REBA 3SYKA 2AWOA 5FL7D 4W9MC 2PL3A 1R4AA 1CEEA 4IFDG 4JI2Q 4M1KA 1KAWA 3CLVA 2QP3A 3ICQB 5FTMA 3UMFA 2REOA 3KX2A 1ZD1A 1NMGA 4MKFA 4P4UA 1RJ9A 2FU5C 1ZM4A 5M3FH 4Q1BA 4AK9A 1EFHA 2QT1A 2GK6A 4GOPB 2ZRKA 5F9FA 2EFHB 2E5LQ 3DO6A 4E22A 2ZI9A 2ZSFA 3G6EA 1KO7A 4A0RA 1LV7A 1ZVQA 1YVDA 2VEDA 5EXSA 3KXIA 5EXXA 3CWZA 3KZ1E 2R92G 3LAWA 2JA1A 2QRZA 2ZROA 4LPSA 1M7HA 2BJVA 3KFUA 2ZETA 1D6JA 2I5LX 2D2FA 3FMIA 3I56A 4DR6Q 3WNCA 3P4YA 1W4AA 1U9IC 3OTOL 2JATA 1X9NA 1AE2A 3I7FA 4R4IA 5GAHC 4LV8B 4A3DG 1RE0A 3K0XA 1D9ZA 3ZIAA 1E79A 2AD1A 5A5GA 8OHMA 1F2UB 1VQ5A 1ZC4A 4AG5A 1FMJA 2FSFA 2HF8A 3EG5A 4DC9A 2MO0A 4JYAL 2V6JA 4F91B 4CF7A 2AR7A 2WVJA 3QEJA 1ASYA 1CP2A 2IA5A 2G1KA 3RS2A 5IHPA 2IT1A 1K9MC 1E9RA 1E3PA 2WWXA 2PH1A 4PC1A 4A3IG 2Z5FA 4ZDIA 1G20E 1L1OB 1XRJA 2XNSA 4OBEA 2VQEL 2V9PA 2ZVQX 4IJMA 1E6CA 4MGKR 4Z8XA 1NJIC 2JA8G 2AD5A 1D2NA 3ZS8A 1HYQA 1YIJA 3FKSD 3K53A 3O47A 4LJ4A 5C3EH 4HUTA 2QAGA 2W6JA 3DZDA 3VKGA 4UY8C 3AP3A 2HXSA 2V3CC 1X6OA 2J0VA 1VTKA 1W3SA 4DHEA 1RRFA 4ZCLA 1ODFA 2IXGA 1TQ2A 3QXCA 3DKPA 1R7RA 3PIOA 3L0OA 4KFTA 3RSLA 4ARZA 3EIHA 2O8CB 3GD7A 5C3EG 3J81k 3G0HA 3HFZB 5DYGA 4X8OA 1OH6A 1Z6AA 2ZRLA 4A1FA 3CX7A 1IBKL 2P5TB 2HF9A 4OXPA 1KMHB 1YJ9A 3MJRA 721PA 2F9MA 4GSYA 1JPJA 2VHJA 5BN3A 4X6AH 3REFA 1IJEA 3LXRA 2FE4A 4G01B 4JL6A 1E2GA 2CQOA 3THXB 4XOIA 3KJOA 2XSZD 2GVBA 1SGWA 2F1JA 1GVPA 1SKYE 4A3FG 2NVQH 1ZM3A 2GCPA 3FDIA 1B0UA 2WKQA 4XVQA 1E1OA 4JBWA 4LSGA 1FW6A 2ODBA 2VP4A 3D6TB 1KO5A 4JLKA 1ZCAA 4DSNA 1WI5A 1SVWA 1HT1E 4BY7G 2ZVPX 3I8XA 4M9QA 5IDVA 4CT4B 3LX8A 1QHYA 4OQXA 2UXDQ 2HIVA 4X62L 3AEVA 5JHGB 1FUKA 2PMDA 1VCNA 2QUZA 1CR1A 4M9SA 5KTYA 2FSHA 4D25A 2WWWA 1HEIA 4OHYA 4P31A 5CM9C 3KXKA 1X55A 4GOPA 1EFCA 4A3KG 3S1AA 2BOVA 3N5CA 4AY2A 1XXHA 1TXYA 1GUAA 2G88A 2B29A 4YMTA 1PV4A 1E9AA 2X1VA 2VBCA 1UAAA 1LUZA 1RPZA 1ZINA 4XJXA 3AFQA 2VHTA 3UANA 1G3RA 4AIIA 2XB4A 5LB4A 3CC7A 3ER0A 1MO6A 4NBSA 1K6MA 1E3MA 4D4KA 2FJUA 2P67A 5IE8A 1NSFA 3A36A 2DGYA 2Y0SE 1GAJA 4LHVA 4UXJA 1SRUA 2VP9A 1L4YA 1J90A 2C03A 2GKSA 3NBFA 3Q85A 4RD0A 3X2SA 1XFAA 1EOVA 1IN4A 1CS4C 1DE0A 1NIPA 2JIZD 1DG1G 1UKZA 1E0KA 4Q9JA 1JJGA 4Q7MB 1VQLA 2ZE8A 1E0JA 2GK7A 2B63H 4TSFD 3RS0A 4A82A 4ZKEA 2QENA 3I55A 4HYYA 4JLMA 5LBIA 3R7WA 5FUXA 2A5GA 1G3IA 4ZCIA 3PF4A 1JEEA 3UWOA 3VKHA 3LFUA 1YI2A 2WJHA 4Q1AA 4PHTA 3WRYC 4LWCA 1NMXA 2ZJYA 3B13B 2ZS9A 4X65Q 2W2TA 4JOIC 3VAAA 1UDWA 1VHTA 5FLMG 2P2LA 4M1MA 3MWYW 4CEHA 2KSQA 4OHWA 2LSSA 3I3SR 4DB2A 3VU9A 2OLJA 2L0XA 4TMTA 4IVRA 1PH2A 3TJZA 2JLSA 4C0HA 1IBKQ 4DV5L 4YMWA 3A74A 4U7DA 4EFLA 3KF8B 3M4PA 2GJ8A 2XNDD 3B60A 3EA0A 1X8KA 1NY5A 3RNUA 3HYRA 1W48A 4D4JA 1NVUQ 3U4ZA 4D4LA 2C78A 1ELOA 5FJ8G 2QG6A 1E1TA 5FL7A 2PT5A 3J7A5 3U5ZB 1KK3A 2JQOA 4DKAC 4A0GA 4PSVA 2QMOA 3J7ZC 3WBKA 1LS1A 1XTIA 3GTOH 1Z9FA 1EFRD 2CBZA 4DUGD 1N8RC 1Q0UA 3MSXA 2JA6H 1E2FA 1E2PA 1WF3A 3FTQA 1ZCBA 4HZUA 4YMUA 1W49A 1VDZA 4B3SQ 3I4NG 1VQ6A 1VYUA 2ZR9A 3CR7A 4AWXA 2OFWA 3HOUG 4NCIA 4NYIQ 2P3SA 1P9WA 1Z0JA 4OI1A 4O3MA 3WP1B 4PZLA 1SULA 5FTNA 4KYUA 2SHKA 4A2PA 4OONA 3BORA 2KBEA 2QL6A 3EC1A 2J7PD 2XZOA 1O7IA 1YRBA 4KFRA 1TF2A 4KFSA 1HZCA 2QY9A 4PX9A 1XXHB 1GWNA 3TAHA 1BBWA 3CCUA 2Q0HA 4GLXA 1DAKA 4AG6A 2A78A 2VP5A 3Q8XB 1K5DA 1EK0A 3U3JA 4DV3L 3QQ5A 1AS2A 5F2EA 1NBMA 5EE9A 1C1YA 4ESHA 2QSYA 2QRNA 3B78A 5HCIA 5C4XG 4TLDA 2WB1E 3PUXA 2IYTA 1GL9B 4EJSA 4EJSB 3CQZH 4UNPA 4JYBA 3PFIA 2LKCA 1ZRHA 4DK3C 2GDJA 2OTLA 5E95A 4DRZA 2GA8A 5E7IA 4RFVA 2ZRFA 3RC8A 3FE2A 4FW9A 1FMLA 1S4QA 2F4VL 4E09A 1KC8C 2Z6KC 4P32A 2ASEA 1JJ2A 3F0TA 4DV5Q 4GNXC 1BKBA 1CUKA 4JYAQ 2G9NA 2GBLC 3EIVA 1F3OA 2E9SA 2YV5A 4HDQB 1XCGB 4FDBA 4LV6A 4RCYA 5M5WH 4KI0A 1NI3A 2B6HA 1SLJA 3HOVG 2ZU0C 3IQXA 4A3KH 4X8MA 2QP9X 3LVRE 2O8FA 3BXZA 3TRFA 2X19A 5KO2A 3KDFB 5LMUQ 4JI0Q 3TBKA 4KODA 3I4NH 1ZW6A 5IK2D 2V7QA 3M9BA 2ZTCA 5JJLA 4JI4Q 2Z4RA 1HZBA 3AFPA 1YU9A 2ZRBA 3BWDD 3HR7A 4KITB 2JJ2D 2P6NA 2LXKA 2Q21A 1XMQL 2PI2E 4KU4A 3TK1A 5HR5A 5JSZA 4NXMQ 2CNWA 4B3TQ 4UNQA 2QT0A 1P61B 2NN6I 3HOZH 1IOZA 4MKIA 5KSPA 5JRJA 1SXJB 1TUIA 2QAGB 1IBRA 2RGDA 2Z83A 2BIFA 4DT1A 1WCMG 4QM7A 3D8BA 4DR4L 2ZI4A 1RFLA 1E2MA 2FEMA 4LBYA 3SQXA 3TR5A 2EQBA 1VQJA 4BFXA 2NO9A 4OK6A 3KF6A 2UUCL 1E99A 5HKKA 3KJGA 5F3WB 4C30A 3MD0A 2FSGA 2Y8EA 4KBFA 4YDHB 4BLQA 1XMVA 4EDHA 3W34A 3MLEA 3U7FB 2CCZA 1VCOA 3MG9A 1A63A 5GJBA 3J80i 3KKPA 1RYFA 2B7CA 3SFZA 5KDLA 4NCKA 3NEMA 3EBEA 2JJ1A 3P4XA 1HTWA 3VX4A 2C04A 1PHJA 2ZYWX 3K0AB 3DL0A 5BYJA 4BUJA 3PJRA 2V1CC 3ECCA 3F2DA 4FINA 3OEED 5L3VA 3LO5A 1QBKC 4AKGA 3DM3A 1NVWQ 4CRWB 1ZIOA 1VQ8A 3SJCA 5SZIA 1PA6A 1KMQA 2UZIR 3GFTA 1Z63A 4ALPA 2NMVA 2IX1A 1H65A 1F2TA 2QM8A 4A8JB 4TQ9A 2BA1A 3K80C 4Q4AA 5CJPA 5GAEC 1E9EA 4F4JA 3KOJA 2IK8A 4MYUA 1LTLA 4JOIA 1ESMA 2WJVA 1DAFA 2NIPA 4GOXA 4DR2Q 4TYWA 1M1KC 1QUQB 2ZJRA 2NG1A 4OJQA 3U4QB 5CLQA 3ULPA 3RN2A 5CIWA 4GKJL 1KI2A 3HOVH 2H7VA 5G3ZA 2HJGA 1FP6A 2NO7A 3BH0A 4HIKA 4EAQA 5B57C 4LF5L 1A8VA 3BFXA 1YR9A 3D31A 3FWYA 3GTLH 1EFUA 2K52A 1Q1ZA 4Y52H 3H0GG 2IW3A 2Z43A 2OBLA 4IKEA 1TAGA 4TMZA 5JMTA 5KSOA 4LF5Q 2ZU6A 3J81i 3OFND 4M8NE 1NN0A 4B35A 2IYXA 2ECKA 4RY2A 3S1MH 3EPLA 3ZVNA 2IL1A 2W0MA 1QZGA 4DLSA 3AEZA 4ERNA 3THWA 1SXJD 4LZZA 3RNLA 3WNBA 3A4LA 2BC9A 2ZITA 4AKEA 4QGHA 4NPHA 3A1VA 5FOVA 5FPTA 4DCNA 2R93H 1JXOA 4B2LA 3P27A 1S8FA 3TNFA 1D2EA 4D81A 1FL0A 3GDEA 2BBTA 2BM1A 4G5GA 1H8EA 4J0QA 4JVSB 3HOZG 4A2QA 5BYKA 3K8AA 1XJ0A 2A5DA 3GLHA 1RYHA 1GFIA 1KZ7B 2ZSBA 1HH2P 3H84A 4J15A 4WZ6A 2GNOA 1QVFA 2BCJQ 3I73A 3DMDA 4P3YA 1KY3A 4A3EG 4CT5A 1G21E 3K7AH 2CCKA 4LF4L 1QG2A 2DR3A 2GVZC 1SVKA 2QN6A 4HAVA 1U2RA 2ATWA 3Q5EA 2VHUA 2FF7A 3CF5A 3PCRB 1OXXK 3ZYCA 4ZPXA 2BEKA 3AF0A 4NMMA 4TLBA 3I4MG 4HLCA 1IXRA 3CRVA 5FR1A 1OIWA 3Q7PA 3QF7A 2J7PA 4DUZQ 3HOYG 3OF5A 4WA7A 5AWFC 3W90A 1S9DA 1CJVC 3L0SA 1NF3A 3O8DA 4QIWE 4JS0A 3GJ5A 4CEJB 4NL4H 3HJNA 2NGRA 4OQLA 4IJLA 2JA5H 4NP6A 3UWKA 4GNXA 3BIFA 3DZ8A 2PNHA 4BFTA 3HOXH 2JDIA 1G7SA 4DV7Q 3A4MA 2UU9Q 3SQWA 1J5EL 1N6LA 1PH3A 1EUJA 4A2WA 4LJ8A 3NIBA 2ODEA 3JAMi 2KI5A 2JLQA 1XMQQ 1QHIA 1DPFA 3PEUA 3RHFA 1P2SA 1P2TA 4B76A 4LF6L 1C9KA 2JJ2A 5ANRB 3PIRA 1XP8A 1UKVY 4Q66C 1Y14B 2WWGA 2IC5A 4CDGA 4PC7A 1NLFA 2UKDA 4PAOA 5DI9A 2HHHQ 2QMUA 3RRZA 1TU4A 4EFNA 2ZS7A 2O8BA 4B3RQ 5GROA 1D7QA 5JEAG 4HLQB 3ADDA 1OIVA 2ZRDA 1AQYA 1I4DD 1EFWA 2IUTA 3SOPA 2GXSA 1GO3E 4B43A 3M4YA 4BFVA 4DBLC 4JI7L 1E69A 3D7MA 2G0NA 1F5NA 4DLRA 1YQTA 1HH4A 2XZPA 3CF6R 4TL7A 4QL3A 2XEXA 2F4VQ 1GILA 4OI2A 1OHHA 2PQAA 3ZVMA 2IYUA 2PT7A 3VDYA 1VQBA 4LFCQ 4B3RL 5EQTA 1HUQA 1E4YA 1G7RA 1TX4B 1Z29A 2FA9A 2IUSA 4HLUA 2IYVA 4NYIR 4Q4JA 4U00A 5FBQB 1H8HD 1TADA 3KUCA 3IEVA 3K09C 1NMYA 3IIMA 2RH5A 1Q3TA 3K81C 4EPWA 3WRXC 4JKIA 4C0LA 2HT6A 4PQRA 3WWVA 3ZIAD 2NPFA 2XB2A 2J5XA 5DO9A 2ZRMA 4NYMR 4TMKA 3AVOA 3BRWD 1M90C 3QXJA 3T34A 4BFZA 3WNDA 1J5EQ 2ORWA 1VQDA 2YNMA 3CPHA 3JZMA 4OYHA 3LQRA 4POAA 4R2HA 1XNQQ 5AUQA 3U3MA 3ASYA 4OK5A 1YJ5A 5FUWA 3GJXC 1G6HA 3U3RA 3CCEA 3P1JA 4KLNA 1BBUA 5AJYA 5EXPA 4Q1FA 4C4PA 1VQNA 2AKWB 1KI3A 1T3SA 3DPUA 1YEZA 2OCEA 3HKZE 4YCUA 2R44A 3AGQA 3LBNA 4B71A 4II7A 4P4SB 1Y1WG 2I5HA 5DLQC 2ZI3A 3SHWA 3FHOA 4DR7Q 3SYLA 2H16A 2B7BA 2XXAA 4BBRH 5IT5A 4TYPA 4JBKA 4D4MA 3KQLA 4B3ML 1E0AA 1YHQA 4DKXA 1VQOA 2CE2X 2E8GA 4WZAE 3SJAA 2UXBL 1JNYA 3WMGA 1X3GA 1SVOA 3VR5A 3TKLA 2QMHA 1W0JD 2ZQ5A 3UMRA 1HZAA 3U61B 1PYBA 1CJMA 3LX5A 3FHWA 1S3OA 1SFOH 1LTQA 1WMSA 2DHRA 5EJEA 2LXJA 1EGAA 3KLWA 5HCNA 2IS6A 4LI0A 2CL6X 5HTKA 4MYCA 4TMWA 4BQSA 4LUZA 4QBIA 1GVNB 4HB4A 3RRMA 1W44A 3ERSX 4ILEA 2QA5A 5ELOA 1UEIA 2GETA 2ZRHA 1GRNA 1IONA 1N6OA 2WBLC 2A3RA 3GJ8A 4LC0A 2JAQA 4B3CA 2RGXA 2D74A 1XNRQ 3A6PC 2FPLA 1X65A 3K9GA 5CDFA 4DV2L 2CCJA 5L3QB 5AK0A 1IBML 1XZQA 3IO5A 2N49A 1SROA 1Z08A 2O0JA 3BB3A 1RL2A 4B3GA 1OKKD 1KDOA 1HNZQ 5LB2A 4WOPA 3Q9LA 2O8EA 4CEIA 3PUZA 3ND8A 1QVGA 3M3YH 1CR0A 3F3YA 3I61A 4DT1B 1RW4A 1TWGH 3LNCA 1DVRA 4KXFB 1S3GA 4LF8Q 4EUNA 5FPKA 4B3TL 3SYNA 2WWHA 1XTDA 1NMFA 2MSEB 1P3JA 2BBOA 3GTGH 2DWPA 2JIZA 4G5SA 3WHLA 1Z5ZA 4HB0A 4C0SA 3S1QH 4EPRA 2FPKA 4PZ7A 1Q86C 2JASA 3VR2A 2OFOA 3LLMA 1UJ2A 3NBHB 3HPQA 3OEHD 4PTLA 4IDOA 4WZBE 3THXA 2QQEA 2IEYA 2QAGC 4F4CA 1ZM9A 4DLYA 1KO1A 3W6PA 5DN6D 2CXXA 2BV3A 2FPMA 4G0NA 4H1UA 2VNUD 2FH5B 3QBVA 5IYBG 4N0EA 2VRWA 4MUAA 3RS4A 1W2HA 1E32A 4KYIB 3GTJH 1AIPA 4XH9B 1OXUA 1N33Q 4P74A 1UKYA 4WVFA 3RS5A 4A0HA 5CB6A 3WYAA 2O8CA 4LHWA 5BXQC 1QVRA 2BMFA 1UE5A 2WM9B 2WAYA 2O8DA 1N6KA 5AJ3Q 2D2EA 4DDUA 4DLUA 3TSZA 4QQBX 1E2LA 4C0QC 2JA9A 3LBHA 4CEJA 1YR8A 1WJJA 1NRJB 2CL0X 4X62Q 5BN4A 4M1SA 5HZKA 1N6NA 3DKVA 1KDTA 2EXDA 2MFIA 3H0GH 4YY3Q 4QY7A 1KDRA 3A8TA 1OF1A 2YHSA 1QHHA 4WJ4A 4EPYA 2AKYA 1ZIPA 1W4CA 4UP8A 3CCSA 1TWFH 1KI7A 1YHBA 3UMSA 4IDPA 1XD8A 2H8KA 4XVRA 3C5HA 2O8FB 4QXAA 2IYLD 3EPKA 4B33A 3CB4A 1D2MA 1QHXA 1QHSA 2BKEA 3CCQA 4LY6A 4LYHA 1XMOL 4Q7LA 5CITA 1OB5A 3TEHB 1IAQA 2C2HA 2V54A 3GEIA 4RD4A 4C9BA 3AVWA 2GILA 3PVSA 3HOWG 4BXXH 3W8RA 1C9OA 1FFHA 1V1QA 4O0AA 1F2TB 1KTVA 4YCVA 3PO3G 4IDNA 3F1ZA 3W3ZB 4AURA 4DLTA 5L3SA 3F2BA 1EX7A 2JA7G 1XB2A 5C46F 1YVCA 3W6NA 2JJ1D 4DIDA 4L4UA 1WOCA 5LMNQ 3THWB 1AZTA 121PA 4I1UA 3S15H 3NENA 4MYHA 2K50A 2UVQA 5P21A 2QGQA 3H3VI 2PX0A 3KFXA 4Q1CA 4Q9HA 3GMTA 3CCLA 4RG1A 2JEBI 3RLFA 1WRBA 3HDTA 1R9TH 5HKKD 4DPGA 3C16C 3BK7A 3QKSB 4A3BH 1E2HA 3PQCA 4IEEA 5TV2A 3ZJYC 1XTRA 5CK5A 3J81c 1XD2B 1KJZA 2IHYA 2XSZA 2RCNA 2AFHE 1B7YB 5M3MG 3CPWA 5FI1B 3TSOA 3A5UA 1U0LA 1O87A 2NO1A 2BBWA 1JQLB 1RRGA 1N6IA 2VA8A 1NG9A 1W5TA 4TZ0A 3QKSA 4MH0R 4HZUB 4L9SA 2IHFA 1R5NA 2PZGA 3WBJA 4X65L 4DUYL 4QBFA 2HUPA 5CM8B 3U3KA 3WHKA 3I5XA 2AN9A 5EUQB 4JSYA 4LFBQ 4JI6L 2IYWA 4GKKL 1DBSA 1SVSA 4IOKA 3SC3A 1A1VA 1PH8A 4C0BA 2CMKA 3JVVA 1I2MA 4DSOA 2WV9A 5EAYA 1ETUA 2C35B 2C9CA 4Q1EA 2HIXA 3GLFB 2O5VA 2GZAA 3AH8A 4DUYQ 1CU1A 2QE7D 3GEHA 4PC3A 1UE6A 2R7ZG 2F3RA 3UXMA 5DLQE 4LF7Q 1QHGA 1S96A 5KU1A 5C44H 2NPIA 3T5DA 1P7CA 1OFIA 4DR3L 1ZP6A 5J5CA 4KHZA 4ESVA 4BY7H 4NHOA 5JZVA 1TU3A 3DVLA 3VNVA 3PV0A 2QPOA 5GJCA 1Z6YA 2ID0A 2BVNA 2JLWA 3CF0A 3KKNA 2O0HA 2VF8A 3LRPA 4JI2L 3U3OA 3EZ9A 3PXGA 1K8GA 5AR1A 2VY3A 1HE8B 4RSGA 3SU8A 2EVWX 5J4KA 1K5GA 4CZ2A 1Z83A 1I6HH 3LW7A 1WCMH 4HIDA 1OIXA 4XSHA 1XJCA 4PZ6A 1CF4A 3SBEA 4R7ZA 4YY3L 2PX3A 4DWJA 4AC9A 4W5HA 1NBMD 3OAAD 5CJ2A 5LMNW 3MAAC 1KQSA 1M34E 3CH4B 1YR6A 1TWCH 3AKYA 1GDDA 2YTVA 5KNCA 4A3DH 1TQDA 2ZSEA 1RRCA 1KXLA 3BH6A 4BXXG 4V0ME 4HAWA 2MMGA 2GXQA 2N46A 1P72A 5JFGA 5K8TA 5JEEA 3A5ZB 2EU8A 1CKNA 4NYMQ 5J4YA 1V43A 2D7DA 4BFWA 1M6NA 1XU4A 1KI4A 1MKHA 1E7ZA 5FLXc 1UBEA 1FJGL 4JVLA 1VQGA 4URXR 4C3JH 4QGGA 4EPXA 3PEVA 4AKIA 1MV5A 5JLJA 1XJQA 5GAGC 5FFMA 4UP9A 4IOAA 1E9DA 4OI0A 1FNMA 2W58A 1X6VA 1Z3IX 2E1RA 1E2QA 2ZREA 3AKCA 4ME3A 1IYJB 2PJZA 1Z8FA 2WMOB 3QPVA 4IHQA 4BBSH 1ESNA 4RZUA 1R0XA 1CKEA 1FTNA 2QGNA 4K8OA 1P9RA 1XD9A 2WB1G 1KL9A 1A5TA 1P60A 4FWIB 3GCGA 1KI1A 1AJEA 2J7KA 2J0QA 4YXWD 2ORIA 1HNWQ 2REXB 1Y1VG 2GF9A 1NY4A 3N2EA 5J4HA 3IHWA 2FDCA 4E5UA 3IHLA 4NZYA 1VYTA 4HIOA 2ZE5A 1WDTA 2J0UA 3A1UA 5KNBA 4ZO4A 1BS1A 3H2YA 3AVYA 2W6ID 1EIYB 1X54A 2H18A 2OCAA 2KBNA 1KK0A 2XZLA 1SVLA 2AFIE 4GMXA 3NHBA 4DLWA 2IY5B 2WWIA 1NLYA 3T1VA 4YC7A 3QXXA 2QROA 4YCWA 2IWHA 4NCHA 5C44G 3K8YA 4FCVA 3W1BA 1T4GA 3THYB 4JV5Q 2LWIA 2PLFA 3EWSA 1GKIA 4KVGA 4B3BA 3RR5A 1HR0W 2JA6G 5GADC 1ZNXA 3VQTA 4DR1Q 2GEUA 4GMDA 2GJ9A 2XJ9A 5K8UA 4OK3A 3CC2A 1ONBA 1J7KA 4QFMA 1HR0L 4FXPA 4EX5A 1OFHA 2QMEA 4QNRA 4A3LH 2KB0A 2VQFL 3HU2A 2OXCA 3GPLA 3AQQA 3AUYA 4AYWA 3AV0B 3RAPR 4DLZA 3KJPA 1P5ZB 4B34A 5KDOA 4L5SA 1DAEA 3CZPA 1K8AC 3TS2A 1R0ZA 1R8QA 1VG0B 1XNRL 1EFTA 3CNNA 3FVQA 4P73A 2OESA 4V0MA 1XD2A 4OO1I 1A62A 5AUPB 3T1YL 3CX6A 3G48A 2FNAA 2OAQ1 4W5WA 1G8FA 4LHXA 1W36D 4I4LA 5FBRB 3TUJC 1UFQA 1PH9A 1JAIA 1G17A 4KLZA 3CMAA 4PQFA 2AK2A 1II8A 4QBGB 4IO9A 2ZRCA 3U7GA 2W83A 3AGPA 5K36G 4R4OA 2AX4A 3SE0A 3MFYA 1XTJA 1KI6A 1XZPA 2FFBA 1L7VC 4GI7A 2RHQB 1E2EA 1DELA 2ANCA 4IVPA 1HT2E 3T61A 2J1LA 4EPTA 5C4XH 1VG1A 1G5RA 3QY0A 2GCNA 2JLZA 4AI6A 1JBKA 4BBRG 3LH5A 2PBRA 1T8UA 4JBXA 5E4FA 5JI2E 4LF6Q 2WJYA 4YWMA 5HGQA 2R6AA 1VYVA 3CX8A 3IO3A 4OQMA 2QQ0A 4UQOA 2OEPA 1QVAA 2KENA 3BD9A 4PPQA 2VTKA 3VR1A 2R6CA 5AJVB 2PCJA 3ZQJA 2ORVA 5FUYA 4X64Q 2QEQA 1H8ED 1BMFA 4A76A 3ONWA 2EYQA 3KTAA 2CHQA 1HNXL 4GZMA 3QSYA 1AGRA 1Z06A 2D7CA 3OHMA 3KL4A 3EASA 2BH2A 3UE1A 2PI2A 4L5RC 4WJ3M 1D8TA 1Q22A 1VMAA 1QZXA 1T9HA 2J9RA 1NMZA 3E2IA 4OQNA 5DE3A 3MGCA 2NZHA 3H4MA 4RZ2A 2HYDA 5G41A 2YJTD 2ZR7A 4GRAA 2QPTA 3DM9B 4R71A 2HEIA 4NDZA 3X1YA 2EYUA 5H68A 1NP6A 1FQKA 5JEDA 4A3JG 2HT1A 4HUQA 2RGAA 5GJVC 2CHGA 1NN1A 3I8SA 4LJ9A 5FOSA 5EUMA 4B47A 2HCBA 3E0EA 1G6PA 1XDBA 1VG8A 1ZU5A 5SZKB 4A3FH 4K0KQ 1N32Q 4Q7KA 1L8QA 3EC2A 4BLPA 2N1BA 1UEJA 4JLBA 2O8BB 4JMPA 2AKAB 4B32A 1Z0FA 2OBNA 2WSSD 4Q21A 5TARA 2R62A 2RGCA 5LPNA 4A4DA 1US8A 4NXNL 1MIUA 4JLDA 1GRQA 4D6PA 3PO2G 1DOAA 1LF5A 1XWIA 621PA 2Q2TA 2WOOA 2DFNA 2GZHA 5IP9G 5EP4A 4GLVB 2H5XA 1UBCA 4DV6Q 2VSFA 1E24A 1E96A 1LW7A 5DI3A 5DI3B 4KJZA 3TUZC 1C7YA 4NCJA 3PCOB 1Q12A 3EIEA 1ZNZA 2QTHA 2NQ2C 1KSFX 4DCSA 3U50C 4TZ6A 3EPJA 3FGNA 2XOKD 1L4UA 2OLKA 3NH6A 1IL2A 3OW2A 3B8HA 1A2KC 2PMZE 3BH7A 2ZIAA 1TNDA 5FBLB 3HP1A 2GEDA 2Q9AA 3MWLA 3ZVRA 2C9YA 5FR2A 3TLXA 4P72A 3B7GA 1XX6A 1YZUA 2D0OA 4TQAA 5CB8A 2DFLA 1CR2A 1MABA 4TMVA 2IYQA 1PVOA 2QBYA 2XTMA 4JZKA 1MOZA 2ZM6L 4D0GA 2HDNB 1JALA 4JVMA 4KLKA 2J3EA 4C3IH 4HJ9A 3G4SA 3QKTA 3NEJA 2CNWD 4A9AA 1CULC 4HJAA 3CC4A 2QAJA 1N5KA 1SXJC 2KCMA 2V6IA 4LX0A 1VIYA 4A3MG 1ZNWA 2YC4C 2YYZA 4BLOA 1BIFA 1TL7C 1H8HA 2YINC 4KSBA 1XEFA 1J70A 3LWNA 1OV4A 3AVUA 4A0FA 3OIWA 4M1OA 4MKHA 4OI4A 4OQFA 5FBWB 5B30A 2CLCX 5FLMH 3T06B 2CFMA 1MRSA 1ANKA 1VIAA 3BU2A 3GO5A 2F52A 4DR7L 1G18A 3EARA 3L43A 3U4QA 5BN5A 2ZTDA 3V4RA 2F3TA 3IRBA 1VQAA 3LVQE 1S72A 1AK2A 1EQQA 4QGAA 3SFVA 4A8JA 5E7JA 3W5IA 3W3AA 2R8RA 1FQJA 4M4SA 5FOWA 1KK1A 1B70B 4JI5L 4TN1A 5KSZA 4PZZA 3RLNA 5C4JH 4GDFA 2VSXA 2NZ8A 1NJFA 1OTCA 2ZM6Q 1ZC3A 2YC2C 3TQCA 1XTQA 5A0FA 3R8FA 2I3BA 4Q4HA 1E9BA 2ZJBA 1NBWA 3FKIG 1VCIA 1NN3A 3NXSA 5M5YH 3PG5A 5FOXA 2YU9H 1VQMA 4BY1G 1U8ZA 1US8B 1Z6XA 2VP2A 4G3XA 4A93G 1E4VA 4U02A 1PLKA 2K5NA 3BGWA 1N6RA 4MGZR 1G291 3CM0A 5H1YA 1X86B 3O8BA 1UE1A 4X66Q 2QU8A 2F3IA 4HDCA 5FBVB 2R7FA 3OIYA 3VNUA 3TE6A 4TQUS 521PA 2W6IA 2QA4A 1OH7A 3CD6A 4GBMA 3MXNB 2VW9A 5G3YA 4B44A 2JLYA 5C18A 3L0PA 1E1QA 4DCUA 1ZD9A 4RD6A 1IXZA 1YHNA 4RZ3A 1UPTA 3U6BA 4YXWA 4PO9A 2JCSA 3C4JA 4GZLA 4QJ4A 1E1RA 3RWOA 2WIAA 4PC2A 5BW8A 5C0XG 2FZLA 3C7KA 1JE5A 4PZ8A 2VP6A 4LPKA 4JI4L 4OHXA 4Q1DA 4RD1A 1P62B 3S1RH 2G83A 2P65A 3K70C 1LYLA 2OG2A 3T35A 3ZZ0A 3U7HB 1ZUIA 1S0UA 1X3EA 3S24A 4F93B 1G3UA 3A0JA 1AQUA 2ZYVX 3QF4B 3C41J 5GVRA 2GBLA 5GQOA 5HPYB 1GG2A 3CNOA 2R92H 5EP1A 4IFDI 1N32L 3IQWA 3K9HA 2NZOA 2VUMG 2FFQA 1GOTA 3ADCA 2JDID 2UU9L 4URVR 4MNOA 4ZIRA 4NE2A 5FPYA 5FPHA 2KE5A 2X8AA 2PCLA 3MJHA 1CTQA 1NLZA 2F43A 4URUR 5AJXA 3THOA 3RYTC 3CH5A 4PPFA 3SJBA 3A37A 2QM7A 3VKWA 1AKYA 3M0EA 1CJTC 1LFDB 3H3VH 3L2OB 2WKRA 5JCPA 4HB3A 1R5OA 2MSCB 4A3JH 1W2BA 1U90A 4FCTA 4OHZA 2P0EA 4A93H 4HJ5A 1PLLA 2JGNA 3IDQA 2MQHA 4EQ5A 4NONA 2WAXA 2FG5A 1J2JA 4L5QA 2K14A 4P33A 1Q21A 3K09A 3DLLA 1VG9B 4LFBL 4C3HH 1HR0Q 3EZ7A 4KHPL 1YZKA 1TUEA 3VR3A 5JHHB 4TL9A 2FZ4A 2RGGA 3SS8A 5JSZB 1W47A 3FHTA 1UDXA 2WSSA 1CJKC 2JA8H 2GESA 4AQYL 5D3MB 2R9VA 4IFBA 1H95A 1IY1A 2NTYC 2OUKA 1N6PA 2QGZA 4LV5B 4OL0A 2EFCB 4HJ7A 1XEXA 2VHQA 3K0EA 2F7SA 3F8TA 2PEYA 1JB1A 1N25A 1CRQA 2ZE6A 1R5BA 4LJ5A 4LYJA 4PANA 4WBSA 5CYOA 1CRPA 3I4OA 4UPAA 1I4TD 1OHHD 2VF7A 1E2NA 2UUAQ 1C4OA 3O8RA 1UEBA 3AF2A 4APVA 4ASUA 3EW9A 3AVXA 2WFWA 2F1RA 1NJGA 2FWRA 2ZE7A 3WP0A 1VQKA 4A3CH 1CKMA 4GL2A 3BJIC 2YKGA 4TTRA 3EN2A 1ZYUA 4QM6A 3SGIA 2BA0A 4JBJA 2QE7A 1YE8A 1Z0DA 4QC2A 2C8VA 2J0UB 1KNXA 1KZGB 3UPUA 3HPRA 4YLGA 2A2ZA 1JT8A 1JR3D 1XEWY 1IXRC 4N0DA 1YNXA 2ANBA 4G1UC 4KCGA 4ZDWA 1MR3F 421PA 2D4HA 4BEJA 3A1WA 3SR0A 1CLUA 4A3CG 2IX0A 2RMKA 2WMNB 4DR1L 2HXYA 2O52A 3I1FA 4YQFA 3WYGA 1N0VC 2ZXUA 3B2EA 1BMFD 3O8CA 1KSHA 4M53A 3PO3H 3ZH9B 1XEXB 4I99A 3GLFE 4GKJQ 4BRWA 3QVUA 5E7NA 2AMCB 1N5JA 5EP2A 1E94E 5J3BA 1W1WA 3E70C 2RKOA 1BH2A 2K75A 3RZDH 1KJWA 3KJEA 1DO2A 4MGYR 4PAQA 5KHOC 3T1QA 2ZTSA 1X56A 2HLDD 4HLDA 2A8VA 1DARA 2G77B 3LD9A 2JEAI 4JBYA 5DIFA 1P4SA 3RDPA 4LF9Q 4OWXB 1Q3HA 2E87A 5CDFE 4A3GH 2LKDA 3VFDA 1VQ9A 4DSUA 5J40A 4DCVA 1NVXQ 1NIJA 1W0JA 4R4QA 1W4RA 3FFBA 1AA9A 3GLFA 3RS3A 3GLHE 1AGPA 5BQ5A 3UKDA 4DXAA 3CXCA 2V7QD 4IJHA 4PZYA 4OX9Q 3SN6A 5AUOB 5CIQA 5BWMA 2D62A 1DADA 1II8B 1VQHA 1X8LA 4FD2A 4K81B 4TL8A 4E07A 5B2ZA 2GVDC 2RHDA 4MZ9A 2ZS8A 1IXSB 4ZKDA 1OYYA 3ETLA 3V4FA 3NBYC 3X1ZA 2R6FA 5KDDA 1F60A 2MMCA 2X2EA 2IEZA 3B82A 2CEAA 1G8YA 2IYYA 2C98A 4LBVA 6Q21A 2EQSA 1E9SA 1G5PA 1UKEA 2ZPTX 1Z6GA 2QI9C 3FYHA 3KJIA 5SZHB 4GN3B 1Q1QA 2GJAA 5JS8A 3U58A 3MWKA 4ON9A 3TVTA 5L8VA 2A5JA 1NG1A 3NVAA 2J41A 4QL5A 4Z1MA 4U5XA 5LD2B 3OIVA 4WXRA 1Z28A 2A30A 1S9HA 1G3QA 1SXJA 2ZRPA 3BZKA 3Q3JB 5L3RA 3EXAA 3EX7C 1JR6A 1DG3A 1MO5A 1A4RA 3KFVA 4M22A 1FL9A 1OH5A 3EZ6A 3MRSA 2AK3A 1OFUX 3LA6A 2I0QA 4M9ZA 4XTRA 4RJLA 4TLCA 4Y0VA 5IYDG 4A8JC 4HAZA 4LF9L 1XPOA 3QJYA 2IYRA 5FOTA 4B2IA 1B23P 4JI6Q 4C0KA 2WJIA 4L8GA 2BMDA 3PITA 4MYTA 3E1SA 1FJGQ 1R6BX 2QNRA 2IHEA 3KQHA 3AP1A 4RD2A 4WXPA 3M85A 2F43B 1FX0A 2UUAL 4XWAA 1GL7A 1KSGA 4Q7JB 2EFDB 3A58B 4Q4HB 3IBYA 3GLGA 1MO3A 1T8TA 1COWA 1T6NA 2D06A 4GNKA 3LGJA 4YWLA 3PUWA 3B6EA 1DAMA 3A1TA 3QNUA 2N42A 2EIFA 1WCV1 4A3BG 4OWTB 2UXDL 3I2ZA 4R98A 2OWOA 5CK4A 2IS1A 2XITA 1WA5A 1AH9A 2KWIA 1KKLA 4V0OA 2UUBL 1ZM2A 4DLVA 3GJ7A 3OZXA 5IF9A 3TQFA 3LXXA 4H1VA 1NE3A 3J80c 1PH7A 2WIBA 4GKKQ 5LMNL 3GEEA 3IPYA 3CR8A 4LBWA 4PPGA 4LHZA 1A2BA 4I1SA 1OKKA 2WTUA 4PSAA 1N0UA 2XTNA 2ZRJA 5G53C 3R9XA 1COWD 2JA7H 1S1MA 5HZHA 3ZDQA 1KMHA 2WPDD 5B64A 5L3SB 4BRUA 4JC0A 2OQKA 1CR4A 2KJQA 1VQEA 3BOSA 3PEYA 3I92A 2PEZA 4DR3Q 3C15C 1GITA 1OJLA 4UJ5A 3I4MH 2BDTA 3PUYA 1QHHB 3GQBA 4IW3B 1L2TA 3GTQH 4M9XA 4B3SL 4BY1H 1TQ6A 4NTZA 2CVHA 1QVCA 2OCPA 2LCFA 4PQYA 5FTLA 3CCMA 2PZFA 4QGFA 2P6UA 4GP6A 2H1LA 2BH8A 4TTQA 1X3SA 4UJ3A 3K0FB 1IN7A 2G0TA 3TAUA 4LBZA 4QJFA 1J8YF 1KK2A 4POFA 3R9IA 3KKQA 3QE0A 5J4VA 1S40A 4GS3A 5IK2A 1JQJC 4CYMA 3DM5A 2BKUA 3PGZA 5M5XH 3RRNA 3TW4A 5AJ3L 1HA3A 4OWWB 5KSYA 2PQAB 4IOCA 3AP2A 3NKVA 1HY3A 2NVTH 2ZJ5A 1CKOA 4O0MA 1U94A 5IP7G 1Q81C 3GFOA 4AYTA 4CW7A 4GFDA 1NTGA 4RCZA 1Z07A 4PPNA 3W6OA 3SBDA 3TVDA 4LUCA 3NDPA 3AVPA 3U60B 3Q8DA 2EFEB 2ALYB 1CKNB 4LUVA 4DNIA 2Q2HA 3Q5DA 4D80A 3CIOA 3CPEA 1A82A 4JT4A 3LLUA 3PIPA 2NN6G 1I94L 4QRHA 2DWQA 3K70B 2MO1A 1RKBA 1GM5A 3I4LA 2V1UA 1J8MF 1E2KA 2GRJA 4EKDA 2W2XA 5C1BA 2OCBA 4DK6C 1NNEA 4XWOA 1MRNA 1BKDR 2UZ3A 5FL3A 1EX6A 4ABYA 2CK3A 4CVNA 3AM1A 3IUYA 4DDTA 1IBMQ 4TLAA 5TXGA 1X8JA 3CAMA 4PG3A 4DV2Q 2XJ4A 2CLSA 4I1VA 4KO8A 3AF1A 1IY0A 2G6BA 1K83H 4HI0E 2ZM5A 1Q1EA 1IN8A 4Y0AA 2AHOA 3AF3A 4UNRA 1F2UA 1FNNA 2GEVA 5FOUA 4DEYA 2E2JH 5JBQA 2HCJB 2ZYTX 4JIMA 4F7WA 3HOUH 3GJ3A 3GTPH 1IBLL 1AS0A 4DV4Q 3EZFA 5KUTA 4B75A 1EFRA 4QOSA 1G16A 5JWHA 5SZJA 3FOZA 1XTKA 1ZMXA 4A36A 2FGJA 3KYHC 3NC0C 4LK2A 3QBTA 4F92B 1FOEB 5DSZA 4IOJA 1LM0A 3JVUA 3KTAB 4OJKA 2AXPA 1HQCA 1UBFA 3I62A 1LY1A 2I4IA 4D0NA 4BASA 1HJPA 2QTVB 2RGNC 4A3EH 1QG4A 2H17A 4LGMA 1Q20A 4Q01A 3CPJB 3CBQA 3FP9A 4ASUD 2D3WA 2JJ8A 5L3QA 5KPJA 4M1YA 4DEXA 2XNDA 3U4VA 2CK3D 5EP3A 5IYBH 1KO4A 3E9HA 4TVAB 1NSTA 1F6BA 1TEXA 4LJYA 4Q48A 4WAUA 3UIEA 4DDVA 2GN5A 1R8SA 2ZRIA 3KQUA 1U0HC 3AVVA 1G3MA 1R10A 2ZUDA 3WMFA 4DAYB 3T1HQ 4HIMA 4Q00A 1KAGA 2O0KA 1Y1VH 4NPSA 1BO6A 1P2VA 3UK6A 3VMFA 4HUQB 4R4TA 2ZAMA 4MDFA 2A7QA 2JK8A 2RB4A 1YJNA 3OFNA 5IY0A 1EWRA 1RIFA 2BWJA 2ZI7A 4KFUA 4NYJQ 1E98A 5GJWC 4BZXA 4D0LB 3BB1A 1II0A 3AUXA 1KRTA 1JR3A 2QPAA 3EA5A 1SKQA 4F38A 1HNZL 4NYJR 4C7OA 1MH1A 5TY0A 4LRWA 1YZ6A 2K4KA 3DOFA 1AKEA 1Z0IA 3T5GA 2Q3FA 3PENA 1WBDA 3L7ZC 2W6JD 4HLUC 4R9UC 3Q72A 3SJZA 2PZEA 4D2IA 3FHCB 2Q2UA 1EWIA 1FTSA 3CWQA 1PH5A 2WAQG 4LFAL 3CNLA 2ZRNA 3AKEA 4MRVA 1W36C 5IYCG 4AH6A 2RF4A 5M3MH 5FPSA 1Z2AA 3OEHA 5LD2C 4IFEA 2FN4A 3K7UC 4IRUB 4JJZA 4Q47A 4TYQA 2GVAA 4MITA 3WMEA 2RHSB 1TWHH 3CRRA 3IGFA 4MRSA 1GNPA 2A1AA 4AQYQ 4M1WA 1MKYA 3UDFA 1P9NA 2XTIA 1X3FA 2JE6I 2GCOA 5C0XJ 3EAQA 4KBGA 2GXAA 2WWFA 3C5CA 4C0AC 2W0SA 2HQLA 1CIPA 2UXBQ 2OV2A 4LC1A 2GJKA 3RABA 4EPVA 4GLAC 3L2PA 4DV1L 4LUOA 1T0JB 3IILA 4HDOB 3VHLB 1OPXA 2BMJA 1GZSA 4NXNQ 2A19A 1YBYA 1KGDA 2BMEA 2J45A 3H86A 3PR1A 4Q4JB 1CXZA 1Z47A 3PUVA 4QKQA 3E9IA 1NBME 1AZSC 4LFCL 1JEDA 3FKQA 2HLDA 2VIIA 2OHFA 1I4LD 2K5UA 2XX3A 1RJ9B 2NZJA 1OFTA 5CLLA 1T5LA 4FCWA 4LCBA 4B3DA 4JBMA 1KJYA 4A3MH 3TRZA 1L1OA 1G8GA 1LNZA 2IYZA 4M0LA 2JJQA 4DUGA 1RRPA 3AQ4A 1I94Q 4N3NA 4NU0A 4FI3C 1VQFA 3B6YA 4NXML 1DS6A 1R0YA 3TS0A 3OEEA 5HY6A 3ULJA 4IEIA 5H1SE 2GHIA 4G5QA 3B9QA 4QG7A 2HHHL 5J47A 1IQPA 2Q3HA 1N36L 1PJRA 3AYHB 1WE2A 5M04A 4JI0L 4DJTA 4DV1Q 3P26A 2VYFA 1YR7A 4HATA 1EIFA 1OYWA 3KB2A 3MWJA 4HAUA 2IXEA 5LDDC 1S1CA 3CCVA 1E1QD 3A1SA 5FUVA 2PMKA 1QDEA 3K0CA 3QPWA 4EFMA 4X64L 2BEJA 1N9WA 1OXVA 2H5EA 2O8EB 1SKYB 4UNNA 4B74A 2ZUBA 1W4BA 1N34Q 2K5VA 4YHHQ 2OTJA 1LB1B 1QF9A 3Q7QA 4P4SA 4QNMA 1J6QA 1OW3B 1JB7A 3NH9A 2PJRA 3NWJA 1IZ6A 4JYCA 4PXAA 2A9KA 2A5FA 2W2VA 4P71A 1J99A 1T0HB 4IXNA 2OCYC 2ZAOA 2DPXA 1KHIA 1KKMA 1WXQA 4HB2A 1NN5A 3LDAA 5G40A 5UKDA 1E22A 1JJ7A 2GTPA 4JI1Q 3BZCA 2C99A 1E79D 1OLOA 1TF5A 4X8LA 4DV3Q 5F98A 2B92A 5KYKA 3S1NH 2VPPA 4BPBA 4JLOA 3B1ZA 5D3QA 3I32A 3IPXA 1S2MA 5JWOA 3D0FA 4JI5Q 1W0KD 4O2RA 3OESA 4JG2A 1U0JA 3MEFA 1WP9A 1K8RA 3EWAA 1SN8A 4DR5L 3GJ4A 2C77A 2X77A 5JJKA 1Q82C 1YRAA 2N78A 2WSMA 1Y1WH 5EXTA 1V9PA 1VQ7A 2ODNA 2WPDA 3FMPB 1E2IA 5IP7H 2AWNA 3SI7A 3LV8A 5IYDH 4WIAA 1V5WA 3STBD 1UE7A 3F5FA 4RFSA 2YOHA 2AL7A 2FFHA 1M2OB 1Z22A 4CIDA 3U44B 3CCJA 3R8CA 2ZTEA 2EFGA 1Q46A 3P20A 4IDHA 5C4GB 2UUBQ 1XPRA 4MUBA 2J46A 2EW1A 3BJUA 4BFUA 4LF4Q 3UG6A 3QI2A 1LF0A 1YKSA 3CW2A 4XWKA 5EZ5A 1DGSA 3B1XA 1PYSB 1K3RA 2C96A 3QXSA 5DYIA 3CRW1 3IKJA 4BLSA 3QKRA 1FUUA 4RKFA 3OAAA 1CBUA 3K0AA 2YOGA 4QJ3A 2Q9BA 3CPFA 4H02A 4BZPA 2QBYB 1KD1C 4US2R 3ICEA 4C0JA 2N3SA 1QZHA 4XSGA 1MJEA 1QUQA 2OO7A 2Z0SA 3HR8A 2VQSA 3HWSA 4URYR 2VL6A 1PZNA 4FMDB 1WYDA 3N70A 4CEHB 2EWVA 2E2IH 4QHYA 3AVQA 3S1AB 2UUCQ 4AYBG 2IS2A 2C9OA 3A4NA 2BBSA 4JL5A 4RZXA 5DHAA 5FH9A 5K8IA 4URZR 1BOFA 5HE9A 4XD7A 3KKOA 3DDCA 1R0WA 2I1VB 2WZQA 3B1YA 3G82C 3RVBA 4TYYA 3NG1A 2RGNA 2F1HA 2QSZA 2IUUA 3WYFA 1B8AA 2ZJAA 2XGTA 1N0WA 1XF9A 2ZJOA 1TTTA 1PFSA 1P75A 1CSPA 2FXQA 2CLDX 4PHFA 4D82A 1VECA 2VL7A 2CE7A 3GLIB 4B3XA 1RZ3A 1IBLQ 1KDPA 4DZZA 5JECA 1NVVQ 5GVSA 1XPUA 2IXFA 4BFYA 4MQBA 4P4TA 2UXCQ 3CCRA 3NC1C 3ZGXA 3H15A 5DHFA 2KHJA 4JLAA 4M21A 5TVKA 3PSIA 2QEXA 2F1IA 2ZRGA 2ZEJA 1G7TA 1GRRA 1OXSC 5IRCD 4IDQA 1EQRA 2BHRA 4PO8A 1MABB 2Z6KA 2OAP1 4LJ7A 4PFSA 2FEOA 1GKHA 4ARZB 4XTCS 1F48A 3B1WA 1HNWL 2P5SA 4QHSA 1Q44A 4NKRA 3CONA 3UE0A 1XCPA 3K9LA 1SQ5A 4JL8A 4OX9L 1XMIA 1G41A 2GWHA 2CVFA 1DEKA 3NEYA 4L5TA 4LJAA 4DDWA 1HV8A 4HAXA 3AB3A 3BFVA 4M2LA 1UBGA 4KAXA 1L2FA 3FB4A 2XGJA 1SMXA 4TSFA 2ES2A 4B2PA 1X1RA 4MDEA 2IWRA 3M6AA 4PC6A 2ZJPA 2NOAA 1P6XA 3OE7A 2XTZA 4W5JA 4P75A 2Z6VA 4L5BA 4V0KA 1ZBDA 1W7AA 1DAIA 3SDZA 4Z1MD 4B6EA 1UWVA 1OT3A 4YMSA 4DAMA 1W36B 2JLVA 2GCOB 1L0WA 3NTUA 2CHVA 4IOMA 2ZJ2A 2B8TA 2Q2IA 1HNXQ 2DWOA 3VX3A 2R7DA 1GNRA 1NKTA 4LYAA 2ZYUX 2WJGA 3VU9B 2KHIA 1EG7A 1L1OC 1VQIA 4JCVE 2R93G 2ZSDA 2JLRA 5EE1A 3TUIC 3WY9A 3S2HH 2OM2A 2R65A 2K5HA 1AN0A 2FOLA 2FSIA 3QVVA 4B6FA 3JZAA 1JJVA 4UP7A 4JSTA 3ZZTA 3G71A 1NY6A 4MKGA 3GTMH 1VHLA 1T3HA 3QOFA 1KYIA 1U9IA 4NB3A 3UDGA 3UDIA
chains in the Genus database with same CATH superfamily
1IHUA 1KFJB 1IJFA 5C3MA 5K3FB 1ZJ6A 3PNMA 3VTFA 5KQMA 4O4JB 3JARA 4S0XA 5IGEA 1Y63A 2Z56A 1KYVA 1PL7A 1T8RA 3HY6A 4YMHA 2H1OA 3FD8A 3I9KA 1OE0A 2QDXA 4G2TA 4W1QA 2NZYA 3V1KA 1POWA 2ZRAA 3BJZA 3ESBA 3KBBA 3MJCA 5EMMA 4YP9A 1G21A 3AR3A 3E61A 4ZI2A 1M0EA 4JI1B 2VJNA 1T34A 4LYGA 3V9PA 2V7WA 4KN7C 5FJ8H 5CLGA 1E3WA 2BFBB 2IF0A 5DM0A 3AESA 5BXYA 2Y1KA 2Q7OE 1MO4A 2D0PA 3BXHA 3W1GA 3JAMc 1BRTA 1A6XA 1E3TA 1NZFA 4JVNA 4FGWA 1VQCA 1GZVA 4OMDA 1ODCA 1QOZA 4KVAA 5JRZA 8AT1A 2RHMA 3CP0A 3HWRA 5FA6A 3C5VA 1ZM7A 4INZA 1FE8A 3U81A 1G4AE 1I6LA 1UBHS 1M5TA 1NW8A 5FUQA 2GAOA 2BPOA 1GNQA 3Q12A 4IJKA 1R66A 3S5JA 1QB5D 5FI5A 4AZVA 4A3DB 4IL5A 2NVUB 5J43A 2HWKA 2YCBA 2FQYA 3Q8WA 1VKZA 3VKFA 3UB4A 1YK1A 1N5DA 2B21A 2PT9A 2CT8A 4NLLA 1IG3A 4RE5A 5LL6X 1HC7A 1NOJA 2GB4A 2XNAC 2ZANA 1RLJA 4LJ6A 3V7WA 3W8DA 3HWWA 4TWJA 5I51A 5B5SA 1FTYA 2VKQA 2RK6A 4GSKA 2BM0A 2E5LL 4UNSA 2VYNA 2ZUTA 1UOEA 2ZDQA 2C29D 2SKCA 3NQIA 4CM3A 3JC66 1XT6A 4KBYA 2JA5G 2A69C 1GQ2A 4US0R 1T1GA 2ZYGA 1JQ3A 2G3YA 4MO2A 4YQYA 3UW3A 1IYVA 4I1IA 4NWIA 1BGXT 4BNUA 4DWWA 5JMPA 4MW1A 4ESEA 4P0TA 5C8VA 5F12A 4CM9A 1ONPA 4DK1A 1E5VA 3QA9A 4PIVA 2BKAA 4B6GA 4YRMA 3K0SA 2CW5A 2HCRA 2IZ1A 4RCVA 4E03A 1M7GA 2E9FA 2ZXFA 3HKCA 1F9SA 3TMKA 4AJEA 3BC1A 4WOCA 1Q7BA 2NVXH 2FP3A 4FT2A 4JB2A 2AQ2B 2IF2A 1ODLA 2BGTA 3OEWA 2HSGA 4WACA 2A59A 2DY1A 2MYPA 3SGLA 2MR6A 2ZXEA 4HHEA 3ZU4A 1MN6A 2ZUCA 2IZ5A 1PUIA 1Z7BA 1AEXA 2AQHA 1PLJA 4KH0A 1KQGA 2ONJA 4HRAA 2Q5QA 2Q3MA 1Z7EA 4NJOA 4RULA 3MM4A 3S55A 2BJWA 1W46A 2NVBA 2JPDA 1NMQA 5IAAA 2ECFA 1OZGA 2F9FA 4UXHA 5JQGA 3A6EA 4FXDA 1HZ9A 4G8CA 2HSZA 4BNVA 4YAWA 2VHCA 2QSUA 4DV0L 3AU9A 4MB0A 3NXKA 3ESZA 1XBTA 3OZDA 3TQYA 1VPLA 3B5JA 4OPMA 2PRSA 2B1JA 3NELA 2W37A 3V42A 2Q3LA 4B8ZA 3L18A 3QMVA 5MGBA 2K32A 3P2IA 4LY0A 2ZWAA 4BE7B 4ZCTA 4RGOS 2GJSA 2HLHA 3DOHA 1G8JA 3K35A 4NFSA 3VPFA 3HBMA 1UXKA 3BYTB 3OYYA 1U2ZA 4YUVA 2JJMA 4JJGA 3MA0A 3T9CA 3VHRA 2FKAA 4ZI7B 5KCZA 1M1YE 4PSCA 1L4LA 3GV0A 3UNXA 1KAHA 1M2GA 1NW6A 3A9CA 2V9CA 2YWGA 3R9WA 3GFPA 3TDNA 5JD5A 4DVGA 5EEGA 5IGBA 3Q1KA 4N8DA 5AW1A 3EGDB 3EJ6A 3HBJA 6CHYA 3ADBA 1U8YA 3H2BA 1IHZA 3V4PB 3IBTA 3VR5H 5M2QA 4D0RA 1TAUA 4Q02A 1N33L 3I5YA 4Y2VA 4YWKA 1Z7YA 4YJ3A 1SE4A 1MGPA 5BNTA 1SNDA 2V96A 4YPOA 2D1SA 3TZDA 1NR7A 3CZCA 4YJ3F 5LCXA 5JY1A 2VDWA 5JAVA 2BGUA 4R4CA 3STBC 1VJTA 3D81A 4DSTA 1BCRB 2ERXA 2HBQA 4IZ8A 3TH5A 3F47A 4GYYA 1FFEA 2B1RA 4C05A 5FV4A 2A6PA 1N3BA 1Z36A 1NRWA 1Z0KA 2ISQA 4X8HA 4R8KA 3N28A 1E92A 1RBMA 1G0OA 1O6GA 2GPBA 1IUNA 3JYNA 2HB6A 2XRQD 2VSOA 5EE3A 3RGGA 3RHZA 3SF8A 3TL6A 3T9DA 3U40A 2B3GA 1MDBA 1GPJA 3OWHA 3BFJA 1P7YA 1DCNA 1TK9A 2DFPA 3FFXA 1IUKA 2UZ0A 5DNAA 1C9DB 1EQ2A 3FRHA 1G9XA 2Q1XA 3ZWAA 1BYIA 1CJUC 4U68A 1ZOOA 1A0IA 7REQA 4WECA 4KN4C 1PJZA 1YZHA 2W48A 4DWOA 3BDLA 4E1BA 2DR0A 2GXUA 3OPNA 2O1EA 3BCSA 2IEDA 4YIHA 1E0SA 2PO7A 4K6OA 3L4KA 1UC5B 3S6JA 2CWAA 2O8DB 2ZUVA 1Q1BA 3FMFA 2ZUFA 1GTVA 4BY1B 1QS0B 5GADl 3KNZA 1F77A 2F0QA 2XNCA 4Z51A 4NENB 1RD4A 4LYYA 2CN1A 5JSFA 2QQFA 4CMBA 4OO1G 3NIGB 3CJRA 3OU6A 1QANA 5A4FS 4P0QB 2RAPA 2GAAA 3WWPA 4JLJA 3LT2A 1BCPF 4EWLA 1Y6GA 2NO4A 4XQNA 3GOHA 1R6TA 1UADA 4UUOA 1XVUA 3IERA 3G5LA 4X1KA 5CV4A 5IFKA 1ICFB 1C3EA 1MTZA 1R8XA 5JI3E 4LZLA 2RHWA 1PQUA 2F0HA 1LJLA 2DQYA 3FSGA 3I2JA 4MV1A 5CLFA 1OU0A 1ZAYA 3M4QA 1XROA 2CLHB 2OSBA 3TS1A 2IUEA 4RA8A 3GRYA 3OY2A 2Q8RE 3PNQA 2XUAA 3IOYA 5MHTA 4D8XA 4K9MA 1N36Q 1CD5A 2IYPA 1SXTA 5FTKA 2CMDA 3RSOA 3GBPA 1QP4A 3OT1B 3AR7A 4V1CA 1KI9A 1Y1TA 4FFBB 3I2YX 4KZPA 3KHUA 5BNIA 1K08A 1XL1A 2QL5A 4ZDKA 2WVGA 4ZK6A 4O2BF 2YN0A 5IJ9A 3DW3X 2VDPB 3FUUA 5JWRA 3LBAA 1G2SA 1ZUWA 2ZBDA 5LNK1 4CKBA 4EKNB 5KJ1A 4BO3A 2HOQA 3SR3A 2HDHA 3SNHA 2C5LA 5A1TA 2BELA 4X66L 5A4JA 3PEWA 1LDEA 1A7JA 3GJ6A 3D3WA 4MLCA 2ZJQA 1X7YB 5DRYA 3LPNA 1UINA 2GM3A 2B2YC 4HCEA 1RJWA 1Y9JA 3C3JA 4OB7A 4X60A 5E6RB 5FULA 3VC7A 2PKXA 3NBKA 2P9BA 2QRKA 3UHPA 1CHNA 4BZQA 4ECEA 1GU7A 4NARA 5G1OA 2WICA 3Q6IA 1P2UA 3KQKA 4D57A 5EFOA 1G4HA 3I72A 1G9TA 2PUEA 3MC1A 1ZN8A 4AJPA 2EKPA 3K4PA 1QWYA 2RB5A 3RWBA 1LTGD 4OHVA 2P77A 5C8YF 1PZEA 2PQEA 3GJ0A 4XQ0A 5H3CA 3D64A 3RLOA 4WDQA 3D6HA 3UATA 4H7PA 3OQ1A 4W1RA 3JY6A 3PQ8A 3QEOA 1UODA 1F9RA 1STGA 2MIIA 3U7HB 3DT8A 4XIGS 1NKSA 3SM3A 1TTPB 5HW2A 1Q0HA 1QLHA 5LQUA 1LVGA 1S5PA 2SNSA 4BUCA 3NETA 4IFDJ 5IYCH 1Z0AA 3ZU3A 5K8LA 2FWPA 2FZ5A 3P0FA 1VI2A 2ZSJA 2B5OA 3ZWDA 2QLNA 4OOFA 3ER9A 3AJRA 3VR4A 4F84A 2HHCA 2D13A 2LVBA 3J81j 4LNHA 1SB8A 4JUCA 2O7NA 1KAMA 2PUHA 4DA7A 3K70D 5H83A 1DIAA 1JAHA 1N2CE 2J87A 1HO3A 2V7XA 3PPXA 4BQRA 2HA7A 1AKWA 2D2VA 4DFDA 1NC1A 4RH3A 5AJUA 3TG2A 4DB4A 3GFQA 1STNA 5A2QL 2EJUA 2GD6A 4OQZA 4ZAVA 1I80A 1JQEA 1PKXA 2ZBVA 5EMKA 3BJRA 3D6CA 1BC5A 3AIIA 2I6XA 2PKWA 1IM5A 3EJIA 4D26A 2Q3CA 1JE0A 2XWSA 1JHOA 2RE8A 4QGUA 3MA2B 3TW8B 3ZE7A 4BIIA 2V4MA 2CJXA 2V6GA 1K5PA 3H5LA 1T9ZA 4R31A 1MD2D 1GUTA 3ND9A 4CKZA 5AJHA 2FHPA 3JQEA 4L72A 1ORRA 1A72A 4PGAA 3TPFA 4QULA 2QX6A 2NT4A 2VDQB 4CODB 4NENA 4L3WA 1NJ8A 1SRQA 3GB9A 1ZD8A 2A6EC 2ZUUA 4CM1A 2PZBA 2R8OA 2C5HA 3KB1A 4EB6A 5ALPA 5BV8A 4NCNA 1GKLA 3CZ9A 1T5HX 5G3LD 2ACWA 3L7LA 2NMVA 1C41A 1AB5A 2C8JA 2RG1A 5AYVA 5KYNA 4C3JB 3WWCA 3NWEA 3B1VA 4PMWA 4DCTA 4UREA 3T38A 4BECA 4ZRDA 1I4QA 1RIIA 2YXDA 4X7BA 1U2DA 4L15A 1ZKOA 1W6RA 4AIRA 1BOSA 4K46A 2R7ZH 4JV5L 3STWA 3GTKH 3T0FA 4AP5A 3EMKA 4QO8A 2B8WA 2OQIA 4JSRA 2AMJA 4WH0A 2C4KA 2OP1A 3AINA 3C2QA 3CO0S 4OLHA 4RD3A 4RTJA 3N0RA 3RBZA 4AYTA 1EP3B 2H57A 1WR8A 4IGAA 3MJFA 4MROA 2YICA 4S35A 3IP7A 1EX9A 3IL2A 1IVNA 3EY4A 2FAXA 4FUQA 5ALTA 1HYEA 3ZDYB 4AKHA 1PQWA 2FY8A 2I8AA 1JAXA 1U7PA 1NBAA 2IIBA 2PH5A 4IV8A 5FXMA 4C7OB 3M5WA 1GUZA 1N5IA 1PWHA 1TCBA 5IHXA 4L63B 3FPPA 2OR3A 2RHOA 2ZKIA 3DFKA 2IQIA 4BP3A 1DKLA 4UUMA 5KOJB 5EOVA 5ELXA 4ARIA 4MW6A 4RNDB 2VOEA 3QU5A 4DC1A 4K6CA 1KVUA 2PUWA 1H2EA 2PFGA 1KY2A 3K0FA 2APJA 4ZOLA 3SXPA 3TNLA 4AIMA 1SXJE 1THZA 1DEHA 3DBHB 3GRRA 1DTWA 3SSAA 4JAVC 4WFKA 4ZOLF 5ALZA 3FPAA 3ZLJA 3UDXA 1P0QA 1YZVA 2R1TA 2ZW9A 3T1HL 1U9JA 1UCFA 4X1KB 3VM6A 3IP9A 1FVIA 1J3UA 3URYA 3PIO3 3BE4A 4PZCA 2OO5A 1ZI8A 2FMHA 4C6TA 3W4IA 4PRYA 1D2RA 3K5NA 1FVFA 4M1TA 3NBXX 4B7XA 1USGA 4C20A 4DV0Q 2XT9A 3HKZG 2PLNA 3KF6B 1PGJA 4UCWA 1H2XA 4H08A 4LGVA 3RWMB 1B6TA 1ZU4A 3PSAA 2DJ5A 4MCHA 4ND3A 4US1R 1EYGA 3K1ZA 3P9CA 4E6PA 3QIAA 4G57A 1XTSA 5G0SA 2ODQA 3TRDA 5IUNC 3FMGA 1C7JA 4KSCA 1Z5PA 4P84A 4RMGA 2P7IA 1WAMA 5DMHA 4Z0TA 2IH2A 2OORC 3DMRA 1MT0A 1ENPA 3HDVA 4BOYA 1DJMA 3JRNA 4GH5A 2F0OA 3BAFA 2DBYA 4P5EA 1HG0A 2YMMA 3H0KA 4QIHA 2AB0A 2PS9A 2ODWA 3N3BC 2CNKA 2O5CA 2V7TA 3ZGZA 2BHLA 1C48A 2ZWMA 1K4KA 2XMQA 2C5AA 4X6LA 2JD2A 5EE0A 3JQRA 4IUDS 5FB3A 4ZVRA 3DLBA 3ODGA 2ZAGA 4UMEA 3BL5A 4WPGA 1CZWA 4IFDG 1QGOA 1EE1A 5FTMA 3RC2A 1P5HA 1A76A 1ZD1A 2ACVA 2VJYA 3KX2A 4O4IB 1ZA1A 4P4UA 3R2IA 1GTJ1 1U7OA 2MUYA 2FU5C 4CBVA 1HT3A 3Q15C 3QOWA 1ZM4A 4LRYA 1PR6A 5AHOA 1I5RA 1U5AA 2BKXA 4OA8A 1ZA2A 4AK9A 3PXDA 3TNJA 1SXPA 2ZRKA 2NP6A 2E5LQ 5JH7A 1TKCA 2ZSFA 1NQWA 3KWJA 1TWAB 4HBZA 4JA0A 5EXSA 4M1EA 3HXTA 3NKFA 1O4WA 1WCIA 4PGMA 2I54A 4YNBA 2QRZA 4QD3A 3UAXA 4LZNA 3TSYA 4N7MA 3D4WA 4E5MA 1IB6A 2I7DA 3KFUA 2C31A 2I5LX 4A6DA 3CRZA 3K7AB 3NUZA 2OO3A 1E77A 3EIXA 3PC7A 4WADA 1IC6A 4BO9A 4G9GA 4BNGA 1S2NA 4LV8B 5A02A 3IA2A 1HZZA 4MI3A 5KQSA 2I9KA 2YFHA 3GA0A 5EXDA 3EMDA 1GTSA 3D0RA 4CKXA 1F2UB 3AIMA 4FDUA 5BSWA 2DNCA 2FSFA 2HMUA 3D3NA 2G82A 1SCIA 2HSEA 2Z04A 3E81A 3VVLA 2P5UA 1SCDA 2V6JA 3W1EA 4EABA 2KPOA 3QEJA 1YR3A 2IA5A 3ZQ4A 3JAMA 1VDKA 3UAVA 3SF8B 1LT6D 1K9MC 3V8MA 1BQQT 1E9RA 2VR1A 2B8NA 4MULA 4NICA 5G0TA 5JPIA 4PC1A 4A3IG 5LDGA 4EQOA 2F0KA 1EJ2A 4DV0B 3N2KA 4OBEA 3CFYA 2ZVQX 1E6CA 2C1EA 2HWUA 5J22A 1D1SA 2IP1A 1B43A 2JRLA 1YIJA 2Q4OA 3FKSD 1RE5A 2QAGA 3OQIB 1RXYA 2GPWA 3DZDA 4WL0A 4UY8C 4IIYA 4RPLA 3W05A 1ZHFA 3UPDA 3NX4A 4OHBA 4UMFA 2ZJFA 4O59O 1VTKA 3K9CA 1W3SA 1E3EA 2BLNA 4OB6A 2R4UA 3J80L 1TQ2A 3DKPA 1Z5WA 3HV0A 3Q3IA 1IPFA 3HZHA 3ELBA 3QXCA 1J23A 3GP5A 3LYHA 1EDZA 2SDFA 3FYUC 4I66A 5LC1A 1NPYA 5I7VA 1HNNA 2Q9UA 5C3EG 1C9NA 2QV7A 3BG5A 2D8MA 5ESRA 4E11A 4N5MA 4YV0A 5B2FA 1L9XA 5IJ9B 4H7JA 5LBTA 6GPBA 1OH6A 2M6SA 5CNJA 4QU8A 2JFGA 1VIDA 1P80A 2P5TB 3MJRA 1KMHB 4IDGA 1XWEA 3JD3A 2M1XA 1ENZA 4E13A 4GSYA 4BX3A 1XMOB 2LFNA 3REFA 4YUXA 1OPRA 3PL1A 2BF4A 2CQOA 1C9MA 1TJ5A 2GVBA 2F1JA 2GN4A 3OTIA 2OQ2A 4URFA 1FLNA 4A3FG 1THMA 2WMDA 3KQOA 2GCPA 2WKQA 3FWPA 2COEA 1FW6A 4J07A 2VDOB 4OJYA 1UFKA 4KQ6A 5IJ0A 4HYQA 1BA3A 3BCRA 5IDVA 4L0DA 1ZXLA 2XT0A 4J90A 3WLHA 4B4DA 2VJAA 3S27A 4X62L 3HJCA 2DQZA 2PMDA 1VCNA 2GYUA 3D4RA 5JOBA 4JHXA 5EY5B 3PFGA 4QG3A 2VPTA 4JBIA 3U17A 4UVEA 1X55A 3ZTYA 3KVOA 3KEMA 5JZ9A 1JLHA 3COPA 5LBUA 2AJDA 2VJMB 4R40A 1TXYA 1VGRA 1CQWA 3CZ4A 1E5DA 2G88A 4EZBA 4Z4GA 3RRPA 5TJ9A 4R8SA 4YMTA 1SXQA 1UAAA 2VBCA 3ORFA 1LUZA 3RRBA 1AUWA 2WT4A 3R4VA 3UANA 3CHYA 3MBIA 2XB4A 4FYIA 4KQGA 3ER0A 1MO6A 4NBSA 4ZICA 1DTEA 1PGOA 2NTTA 3M33A 3DZKA 1CDOA 3C8ZA 2XUZA 3K73O 4LHVA 5NLLA 4UXJA 1SRUA 3V46A 3FOAA 3K9BA 1XDWA 2C03A 3X2SA 4CTNA 4DLLA 2JIZD 2BZ1A 1PW7A 2IU0A 3FTEA 4JUAA 1RCTE 3TD2A 1JMYA 4BKUA 5A5EA 4Q7MB 1A7KA 4IJWA 2JA6B 1E0JA 2GK7A 3VJMA 3NNDA 4ZKEA 1U65A 2QENA 1T5XD 4W9NC 4RTPA 4KD3A 3R7WA 2CVQA 4ZCIA 1RQXA 3C43A 1TAQA 1Z17A 4DN4M 2QRPA 3LFUA 1YI2A 2GUWA 2I4NA 5A2QE 2V7VA 4PHTA 3JVEA 1NMXA 2C88A 3GGSA 3B13B 2CSXA 1NYRA 1VE1A 1VSQA 3BREA 4FQ5A 5CVDA 3UH1A 5BNZA 4LE1A 4NJEB 5IZ4A 1VHTA 1VXRA 1F0KA 2IZOA 3FWZA 3MWYW 2HK7A 4KWEA 1X7ZB 3I3SR 5DK4A 3RRFA 1Q7GA 2OLJA 3DLHA 3GHYA 4RANA 3CZMA 4IVRA 4TMTA 5ARCA 2JLSA 4NDAA 2B8JA 3VHQA 1YMQA 4DV5L 3JD2A 1E3DA 4YMWA 3WDKA 4U7DA 3R0QA 2XNDD 3TM4A 1XHFA 1X8KA 4X3PA 4GGPA 1NY5A 4RYLA 1NVUQ 2YWJA 4O4HF 4G0WA 1KRWA 4QYIA 1ZJYA 2BZ0A 2B1GA 1LX6A 3SHOA 2GFIA 1OI4A 2ECQA 4EEKA 2QG6A 1E1TA 2MOKA 2P0YA 3DXFA 5T6MA 1XQYA 2OZLB 4CTKA 2QSJA 1QYRA 3SSOA 3HKEA 1SYGA 3WLLA 4DILA 4DNTB 2MINA 3GTOH 3QPCA 4L73A 4LHEA 1EFRD 1I0IA 4EG7A 2C97A 5HFNA 2BFNA 3CISA 1Q0UA 1YFEA 2RSOA 4KGVA 1K8MA 1LRKA 2JA6H 1E2FA 1QZ3A 1B3BA 1WF3A 2I03A 3OCCA 4ARUA 1YFJA 3L3OC 1W49A 3DWFA 2CXTA 1VQ6A 1VYUA 3K5IA 5HJ2A 4BKOA 4AWXA 2FW6A 4ZODA 1M2VA 3EBLA 4AB1A 1ZGZA 1Z4NA 3GGPA 4MQLA 1JUDA 4CF6A 5FTNA 4KYUA 5IFLA 3Q6MA 1KC1A 1X13A 1UUFA 3WHPA 4P3PA 3OD1A 3ISTA 4CLRA 3H6HA 2KBEA 2QL6A 5DWQA 3AUFA 2XZOA 4KFRA 1MJHA 4KFSA 5TE9A 4PX9A 2QY9A 1R4NA 3L9AX 1U1DA 4GLXA 1M76A 4AG6A 3HXOA 2D8AA 1RF2D 1K5DA 2D5CA 2K01A 1BCSA 3QFRA 2IX9A 4KMRA 3U3JA 3UXYA 4DV3L 1W6JA 4BQOA 5F2EA 5JCOA 1NBMA 2HR1A 4QQ8A 3K5LA 1M4VA 1R6DA 2DHQA 2QRNA 2FEPA 1Z4MA 3B78A 2WB1E 3COSA 5TF0A 2O50A 4MHTA 4IHJA 3KYJB 4UNPA 4JYBA 3KQWA 4PYRA 1ZRHA 4DK3C 2GDJA 4K9QA 4ZOQI 2OTLA 5E95A 5HA5A 1XLVA 4E31A 2GA8A 2PL5A 1D2GA 3KXDA 4RFVA 2HA6A 2Z6AA 3RC8A 4G4KA 4IH1A 4CDMA 5EHGA 1ILWA 1S4QA 2F4VL 3D4BA 3ZV6A 4BYGA 4F56A 5IU6A 1JJ2A 2FWAA 1H0RA 2H7YA 2JA8B 4NCAA 4NZZA 1FA9A 3EIVA 4HR7A 2YV5A 4L6TB 3R8XA 1HM5A 5M5WH 4KI0A 2B6HA 4YIJA 1SLJA 3HOVG 1AUOA 2ZU0C 4JJFA 4RESA 5CGZA 4EGFA 2UUCB 1LK0A 4FVMA 1M5UA 3BXZA 3I52A 3CF4A 2X19A 3LO8A 3PCTA 3TRFA 4MQUA 4JI0Q 3C4VA 3MS4A 3TBKA 1HTTA 4COKA 3Q7IA 5HF9A 3BRWA 3HMKA 5LLSA 2H85A 4AP6A 2MU1A 1YU9A 3C3BA 2WQ6A 1D03A 3WLSA 2BGNA 2LXKA 2MDTA 2P6NA 2WHPA 3DFUA 3PXEA 2CNWA 5BW5A 4ZJYA 4G9BA 3GROA 4L07A 4A8TA 1I6WA 2Q5HA 2Z83A 3EOBI 5HOQA 4YLEA