1U81A

Delta-17 human adp ribosylation factor 1 complexed with gdp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
164
structure length
164
Chain Sequence
MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 1
publication title Conformational changes in human Arf1 on nucleotide exchange and deletion of membrane-binding elements.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 41
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u81A00
5JS7A 1KNQA 3A1UA 4G5SA 2XTNA 1EX6A 3D8BA 3NBXX 4QG7A 2D74A 3X1ZA 1FL9A 2PX3A 4B3GA 1E0SA 3HU3A 2QORA 4N0DA 4ZKDA 2WMOB 4C0KA 5IHPA 2DCUA 2DHRA 1P2VA 5GADl 2OLJA 1UBGA 3QEOA 2GKSA 3KFXA 2ZPTX 4DCVA 2G0TA 2ZYVX 1RFLA 1N6RA 4QBHA 1W46A 5C4GB 3MCAA 3W90A 1MABA 1JBKA 3EAQA 4Q21A 3SOPA 3VKWA 1I4LD 4URZR 1XZQA 4TSFA 4LJ9A 1D5CA 2GA8A 2Y8EA 1IQPA 3B82A 1Z0AA 1E2JA 2ZANA 2ZUDA 3AF4A 2EVWX 4M21A 3TJZA 3ZD6A 1FQJA 2ODWA 2H18A 1TU4A 5TV2A 4RY2A 2QM8A 2W6IA 1ZU4A 2CE2X 4FIDA 4C0HA 1ZM4A 3R8FA 2CEAA 4ASUD 2AWOA 1A5TA 2C03A 1AA9A 3K0FB 5CB8A 1KMQA 3THWA 4Z51A 4AK9A 4ZIRA 4HB3A 2VLIA 1EG7A 3SU8A 1KI2A 3SZRA 4JVSB 3P20A 1Z07A 2R6FA 1KK0A 2Z0MA 3LBHA 3SE0A 3GFTA 4B32A 4HZUB 1J90A 1W4RA 3U44B 5IK2D 2P5SA 3EIEA 4JLAA 2IHBA 2ZU0C 1CJMA 3IDQA 2GXAA 4AIIA 3AVOA 2V4ZA 3UXMA 1O87A 3LAWA 1NLZA 3WYGA 1WF3A 2WKPA 5JEEA 3BGWA 2QL6A 3LVQE 4IOMA 2J0QA 3QOFA 2ZRPA 4LC1A 4JLKA 4O25A 4F7WA 1ZD1A 1VHTA 1MOZA 3K9NA 4OHWA 5B30A 3AQ4A 3KXIA 1YR7A 3NHAA 1DE0A 2QU8A 3KFVA 2IWRA 2HJVA 4IOJA 2JCSA 3CBQA 2YWFA 3GLGE 2OAQ1 4CEHA 3DKPA 1XPOA 1XX6A 2IEYA 3AF1A 1P4SA 5EE0A 4OYHA 5EE9A 4C0QC 2EW1A 1GL6A 4C2UA 4WBSA 1KZGB 3IO5A 1T0JB 4RKFA 4B75A 1CBUA 3ADCA 2IYXA 2ZJZA 4M2LA 4CW7A 4PQRA 2R6GA 3FB4A 3VR3A 1EESA 3CPJB 1I2MA 3E2IA 4TQ9A 4MYCA 4ACBA 1CS4C 1WXQA 3DEFA 421PA 1Z5ZA 1ZNWA 3IEUA 1COWA 4GZLA 5P21A 2ONJA 3U6BA 2GWHA 1E9SA 3MFYA 4PO9A 5DI3B 1X86B 2Z83A 1TX4B 2F9MA 2GCOB 2QPOA 4JKIA 3ZIAD 2GJ9A 3ZZUA 1NL3A 3H1TA 2J0SA 3EZ9A 4FD2A 4QC2A 3BOSA 4TLCA 1RJ9B 4MYUA 4UNPA 4EAQA 3LO5A 2JJ1D 1R2QA 2ZETA 5DI9A 2GAAA 4HB0A 3VKHA 1T3LA 4Z8XA 1ODFA 4IKEA 1KYIA 2E1RA 2FEMA 1NN3A 1KK2A 5EZ5A 5CB6A 4G1UC 4M0LA 3D6TB 5J4VA 4NTZA 4U5XA 2QP4A 4TYNA 2O0KA 3CB4A 4JSTA 4B34A 4D4MA 2H7VA 4DT1B 2JIZA 1PJRA 1KJWA 4A8JB 2JDID 4JYCA 1Z0DA 3LRPA 1OV4A 4JVNA 1I4TD 3SJAA 2PBRA 1NVWQ 2O8DA 4BFUA 1BOFA 4TZ0A 3LNCA 4GFDA 5FOUA 2J3EA 221PA 2CJWB 3QG1A 4NU0A 3X1DA 1U9IA 1R7RA 1P2SA 2FE4A 3FHTA 2DR3A 5AUNB 5K8IA 2X1VA 2F55A 1U9IC 2EU8A 2G1KA 2IYUA 4Q7MB 3CWQA 1S3SA 1UBFA 4BLPA 3KKQA 2ZREA 5DLQC 2ZUBA 4EQ6B 5CM8B 1UEIA 4LYJA 3EZ7A 5K8LA 4MDFA 1R4AA 2J59A 2PT5A 3ZD7A 4D2IA 621PA 4DT1A 3K1JA 3B1WA 4B3BA 3ZQ6A 3GJ7A 3F8TA 1TEXA 2H57A 4QHSA 3QUSA 4BFSA 4NONA 3GJ8A 2VF7A 2ZRJA 3U4QA 1HT1E 1VG1A 1MO5A 2BIFA 1TF5A 4ON9A 2CE7A 1P9NA 2WMNB 2ZRKA 1F2TB 1FFHA 2NO0A 5DNYB 2AD5A 4ILEA 1E2DA 1EWQA 2BV3A 5EP1A 4C4PA 4KBFA 4BLOA 2RGNC 5C18A 3KQLA 5KOYA 1KKLA 3SBDA 3T5GA 2ZSEA 3D31A 2NO9A 1AGPA 5IK2A 3WMEA 2F6RA 3WP0A 5JECA 4WOPA 4Q03A 5G3ZA 3QBVA 1QVAA 5AJVB 3U3OA 1RYHA 3HYTA 1ZM2A 3BH7A 2AL7A 3RLFA 1OH8A 1YVDA 4A1FA 2DYKA 1XPRA 2GEUA 1FTNA 1M34E 4JT2A 1OKKD 2DWPA 1Z63A 1XWIA 1R0ZA 3Q3JB 3KKPA 2TMKA 2AXNA 3RANA 2W0SA 1B0UA 3BAFA 3FHOA 1SXJA 1YZQA 2G0NA 5J4KA 2BJVA 1AZTA 2ZE7A 1OSNA 3AVXA 4QHTA 3WYFA 4DLVA 5IDVA 3SNHA 3P27A 1TF7A 1JXMA 2R62A 3R8CA 2EQBA 3BS4A 5DYGA 2LCFA 1B23P 3AKCA 4OQXA 4JZKA 3K09A 4FCVA 5FUYA 2VP6A 4BFWA 3U3RA 2QM7A 4MKIA 1X3SA 2D62A 4PC7A 3BERA 4RZUA 2BBOA 1SGWA 2FOLA 1I4DD 3B1XA 3JVVA 3K0AB 4TYYA 1MKYA 4LJ4A 1W2GA 2QY9A 1ZAKA 4KSBA 4TSFD 4B2PA 1N2CE 5L3QB 1ELOA 2VP5A 1VYVA 1G17A 3U2QA 1XEXA 2CL0X 1IN6A 3BC1A 1CJKC 4D82A 4JMPA 1OE0A 2VP2A 2ZI5A 1KSFX 1DARA 2FG5A 2FV8A 3EIHA 5JSZB 4TN1A 1E96A 1Q57A 4L8GA 1G18A 3CM0A 1HT2E 5JFGA 3EARA 4Q4JB 5CLLA 2YWGA 1E2PA 2XSZD 1XD8A 1D6JA 3BORA 3NEYA 2REXB 3TVDA 4AKHA 2FSGA 3H84A 4Q7LA 3ZS8A 4DEXA 1AZSC 1LB1B 2GJKA 3HDTA 4LC0A 2O0HA 2ATXA 4EDHA 4TLDA 3NKVA 4Q01A 3H86A 2GF0A 4GMXA 5C1BA 4LPSA 1Z0KA 3HWSA 4QBFA 4GOJA 3B7GA 2J9RA 4LHVA 1QG2A 1Z83A 3UATA 3X1YA 5FL7A 2C98A 3GLFB 4KYUA 3CF2A 1W0KA 4LWZA 3W6OA 2ZI6A 4BFYA 5FBLB 3VX4A 1GG2A 3KJIA 4QGHA 4JBYA 1NBMD 1II0A 1KI6A 2QMHA 1G1MA 4KXFB 4EJSA 3AF0A 5EE1A 3DDCA 4URXR 1UDXA 2ZJ8A 4C0BA 4WW0A 3KUDA 4LY6A 2KB0A 1AQYA 1M74A 3Q5EA 1M8PA 2OBMA 2AWNA 1E4VA 4MRRA 2IS2A 2RGDA 5KSYA 1SVOA 1AN0A 4HB2A 2X2FA 3FMIA 4JKYA 4Q4HB 1AJEA 1TU3A 4X8OA 1IN8A 4TLBA 3RSOA 1F5NA 3JVUA 2D2EA 1JEEA 2ZQ5A 3CONA 2HUPA 3TUZC 2JLVA 5CIWA 5JJIA 4DLUA 2O52A 1X1SA 1JPJA 3CR7A 3D3QA 4XVQA 1S96A 1L2TA 3TAUA 4DVGA 3R20A 4Q9LA 1FX0A 2RAPA 1XEFA 2ZI7A 2GNOA 3KB1A 4LBVA 4IEEA 5JI3E 2O0JA 2WJGA 4GP7A 3U7EB 1Z0FA 2ZSBA 4GL2A 1GNQA 3MAAC 2AHOA 2D7DA 3UK6A 3I8XA 1NMZA 1OFUX 3IBYA 3CKLA 2XOKA 2KBEA 4B33A 1E98A 5FOSA 2I3BA 4BRWA 2C2HA 3UANA 4TMTA 2J46A 4D80A 4MGZR 2J87A 1XU4A 2HV8A 5EXXA 1WBDA 1FPMA 2PCJA 4O2LA 2NZ8A 5G53C 1SVWA 4LBWA 3OAAA 1A2KC 1KDRA 3QNUA 4QNMA 2DFTA 2W6JA 1OH7A 3D7MA 3RSLA 1CIPA 1A2BA 1IHUA 3CNOA 3OFNA 3FOZA 2NPIA 4NHOA 3B1ZA 3A4NA 4Z8YA 1RPZA 4LV5B 3DHWC 1CF4A 2WAXA 4TL6A 1QVRA 1IBRA 4MUAA 2IYQA 1OFTA 1S1MA 3NH9A 4MYTA 5D3MA 5J4LA 2FGKA 4RJLA 2IC5A 2WSSD 3C4JA 1BS1A 4B76A 4P4TA 5AJZA 2RH5A 2R6CA 3CPEA 4A15A 3NIBA 3GLHA 5BN3A 3A4MA 2D4HA 3EXAA 2HLDD 3TRFA 1UADA 1UBEA 3NTUA 3WBJA 4W9MC 4PXAA 1P9WA 3KJEA 3SI7A 3EZ6A 1Q20A 1EWRA 2ZSAA 1ZNXA 1DAKA 3KTAA 4LJAA 5DE3A 3EG5A 4QRHA 1V43A 3P26A 4XVUA 2ZS9A 2JJ1A 2R6DA 3VR4A 1Z2CA 2YWEA 3K0CA 1NY5A 2DY1A 4AKEA 1FMJA 1G5RA 4PX9A 3FWYA 1RZ3A 4OQFA 3NVAA 2HYIC 5HCNA 4TMKA 3U6KA 1TADA 2BOVA 2EFGA 4POAA 4TL7A 2YHSA 3VR2A 1KZ7B 5H1YA 1MT0A 2OUKA 2ZRNA 2Q9BA 4V03A 4ZCMA 4P3YA 2ZRAA 5K8UA 1PLJA 1XMVA 2W0MA 3L0IB 4B6FA 3IILA 1IXSB 2ORIA 5TARA 1VTKA 2WIBA 3CO5A 8OHMA 4LYFA 5KDDA 2VF8A 1KI9A 1U98A 2OFWA 4TMVA 5FTMA 3CZPA 1XJCA 1XTJA 3WRXC 3VR5A 3M0EA 3T1VA 4CF7A 3KB2A 3ZIAA 1E9DA 4HDQB 4LYAA 4WAUA 1DOAA 2N1BA 1G3UA 3X1XA 2NG1A 4F93B 2Q3HA 4DRZA 4CEJA 3I32A 4GSYA 3NBZC 2IYWA 1EGAA 2NOAA 4KAXA 4PC6A 1XMJA 4OHZA 2OCAA 1XTQA 3WMFA 2F7SA 2OLKA 3BJIC 3IHLA 5DN6A 5JI2E 5F3WB 3LBNA 2C99A 2GHIA 1TQ4A 3L43A 1HE8B 3TW4A 5KNCA 1DG3A 4PTLA 4A9AA 3L0SA 1KTVA 3SEAA 2NO7A 3AVPA 3RS4A 4M8NE 5LD2C 2PLFA 1DS6A 3EWAA 1MH1A 2CCJA 1CXZA 4GBMA 2IA5A 2ZSFA 3L8ZA 4JL5A 1IN7A 2J41A 1G19A 2DFKB 1NVUQ 2EFEB 4BZPA 4QHYA 3FDIA 4AG5A 1SZPA 4HLDA 4OI4A 4TT3D 2ERYA 4KJZA 1ZUHA 2CBZA 1HTWA 4H9GA 4IW3B 4NCHA 2BCGY 1E32A 4OHYA 1TL7C 3PQCA 4HUQB 1G8GA 2ZXUA 2B7BA 1JAHA 2JASA 3A8TA 4PSVA 1HQYE 4Q4AB 5CK4A 5KSOA 2ZEJA 3EPKA 5KUTA 1N6OA 2BKEA 1HA3A 3I72A 3NBFA 1Q3HA 2J1LA 3GJ0A 4URVR 4M9XA 3QVVA 3PEWA 4B44A 1W0KD 4I99A 4IVPA 1UKZA 3SHFA 4AWXA 2Z43A 1VG9B 2WJIA 3IBGA 1KI4A 2QQ0A 4MYHA 2XJ4A 1JXOA 1MRNA 2IYYA 3PUWA 3EX7C 2RGXA 1AS0A 1SKYB 2GXQA 4N1AA 3G5UA 4EPWA 1BYUA 1P61B 1DAHA 4FW9A 4BLTA 2XGJA 2QMEA 2ERXA 1G3QA 2VHTA 2EWWA 4FMDF 4CEHB 2RGCA 2Q3MA 2VTKA 1CJUC 3AF3A 3SFVA 3X1WA 2NIPA 2O8FB 3LBIA 3IPXA 2FF7A 3Q7QA 4DCTA 4NDZA 3GLIE 1JNYA 4O0MA 2GILA 2H8KA 2XSZA 5FPSA 3SQXA 4Q1EA 3A1VA 1FTSA 4QOSA 2RHDA 4OJQA 4BECA 3B78A 4P4SA 3QSYA 3K0SA 2ZI4A 4JIMA 2RKOA 1JI0A 4NP6A 4QBGB 1L7VC 2PJRA 2XZOA 1T5LA 3RC3A 4LRWA 1OF1A 4DLXA 2OV2A 1OB5A 3MWKA 2ANBA 4V0LA 2ZS8A 1SHZA 3PFIA 3P4XA 4IOLA 1U0LA 2J0VA 5J4YA 5LB4A 4L16A 4D25A 5SZJA 3WP1B 3AM1A 1IY0A 2D3WA 1Z3IX 3QKRB 2C95A 4TTQA 2IX3A 5IT5A 1L4YA 1D2MA 1P73A 3I3SR 4G5OA 4KBGA 1R5NA 2JAQA 3U44A 4Q1BA 3K70D 1IOZA 1JJ7A 3ZZTA 5G40A 2QT1A 2QEQA 3MWJA 1F2UA 1E2QA 1KIMA 1H8HD 2NO6A 3CRQA 4J0QA 2A9KA 2ZRMA 3QJYA 4RZ2A 4B35A 4HUTA 5C46F 4HAWA 2GK7A 1J7KA 1QHHB 2BC9A 4F92B 2ZJYA 3GMTA 5JSZA 4LBZA 1T8TA 1RC8A 2KWIA 1NI3A 5EP4A 4A0GA 5A5GA 1GRQA 2PCLA 2YC2C 4PAQA 5DISB 2P67A 4Z54A 4QM7A 1CEEA 1YR8A 4DLWA 4FMBB 3PXGA 4FWIB 5JWHA 5BYJA 4NZYA 1W0JA 4MRNA 1XXHE 2CHQA 1DO0A 2FSIA 4QNRA 1Q1ZA 1VPLA 3DOEA 4BZXA 1VYUA 1LV7A 2ZRLA 2FWRA 2QENA 2ZITA 4IDHA 4A2QA 2JEOA 5C4MA 1NMXA 3EW9A 4MKHA 3GEHA 1EK0A 1KAGA 4B73A 1ZNYA 2KSQA 1WP9A 2H5EA 5FPYA 4BLSA 1G4AE 1W7AA 4LV8B 1P2TA 5F9FA 3R9XA 3CRMA 1NG1A 4PPGA 3V9PA 1XXHA 3KJGA 1PV4A 5FBVB 2BBSA 4BWYA 1OB2A 5FPHA 3OZXA 4DSNA 1F2TA 2GETA 3ZH9B 1A1VA 2XOKD 3R7WA 1W47A 2ZM5A 4B2IA 2V7QA 5FBQB 4ZDIA 2QSYA 2ZVQX 2ZYTX 3HU2A 2QRNA 3C16C 4IDQA 4XJXA 2ZVPX 3UG6A 4CZ2A 1Q44A 4V0KA 5A0FA 2CLDX 3S1AB 1RJ9A 4BFZA 4L5BA 1Z29A 2DWOA 4BRUA 4KFUA 2IXFA 1E2MA 1Q0UA 4HLQB 4TMWA 2IYSA 2A30A 3MG9A 4M9QA 4PPNA 4QJ4A 3CF0A 3VU9B 5F9HA 1XEWY 4ESHA 2QTHA 3EPHA 1Q22A 4PFSA 2YNMA 1GRRA 3KKMA 4NYIQ 3RWOA 4PPFA 4DDUA 3UPUA 3NC1C 1C9KA 2WJVA 4GPTA 2NZJA 1E79D 1ESMA 1UJ2A 2A5GA 2IHYA 1XCMA 3U3KA 1HY3A 1NN1A 1DG1G 4OI1A 2UVQA 4EJSC 3BK7A 4DC9A 2CJWA 3MD0A 1QBKC 4Q1AA 1YZTA 4HSEA 3I73A 3CIOA 3KKOA 3MGCA 4BPBA 4BE7B 3IQWA 2QSZA 2KE5A 3GEEA 2RGAA 5L3SB 2FZ4A 2GZDA 4MRPA 2HEIA 3IUYA 4DKXA 4IJMA 2GAOA 1E1QA 2FX3A 1KKMA 2UZIR 3J81k 1EFHA 1K5DA 1D2EA 3L8YA 2FH5B 3W5IA 2JLSA 1A82A 1QDEA 1QF9A 1WMSA 2WBLC 3THXB 1P5ZB 4DLTA 3DO6A 4TLEA 4ZDKA 5E7IA 2A5FA 2ZJAA 4NYJR 2VHUA 3IGFA 3VNVA 4FCTA 2JJ8A 1UFQA 1NBME 2XITA 1J2JA 4RCZA 1QHYA 1W1WA 1GOTA 1P2UA 4PHGA 4NYMR 4QBIA 5F2EA 3EA5A 2PL3A 1MO6A 2Q9AA 1W44A 4Q18A 3K70B 3DL0A 2OSBA 3QG5A 4QXAA 3BIFA 1XTSA 1E9CA 1NSFA 4HLCA 2BHRA 1VG0B 1J70A 3LLUA 2LKCA 5CYPA 3WXMA 5AUPB 2VL7A 3TH5A 4R9UC 1GP2A 4C0JA 2ODNA 3DZDA 3CR8A 5TB5A 5J5CA 3RRNA 4XWKA 2FSHA 4LBYA 3TIFA 4BQSA 1SXJB 3FKSA 2IYTA 2X19A 1GKYA 2H17A 3K0EA 2KJQA 3O8RA 2AFIE 1ANKA 5L3RA 1SKYE 4LDJA 3A1SA 2ZS7A 3DVLA 3PV0A 2FFQA 2GCPA 4ZPXA 5FOXA 1W2HA 1NMYA 1FNMA 1ZM7A 5JWOA 1ZJ6A 2HXYA 3UIEA 1NY6A 1EFRA 1II8A 4DCNA 3SFZA 1HE1C 1W4CA 4TWZA 1ZMXA 2QAGC 4CT4B 1BH2A 4PC1A 5FR2A 3NWJA 4M1YA 4DZZA 4LZZA 4R98A 2W6ID 4OI2A 1HURA 4YC7A 3QXHA 5BN5A 1PVOA 1SXJC 4RSGA 3TNFA 4KFTA 1CR2A 1YZKA 1GWNA 2ANCA 2ZRCA 1QHGA 2MMGA 2GF9A 1GSIA 2V55B 4FXPA 1ZD9A 4MGKR 4IFBA 1JQJC 5AUQA 3RABA 2OT3B 3GFPA 1M6NA 1J8YF 4B3FX 4RKEA 2IUSA 5KPDA 1N5IA 1VMAA 4HLUC 2CMKA 3C5CA 2GJSA 5CYOA 1UPTA 1K8RA 5FFMA 2A2ZA 2ZI9A 4FMCB 2Z4RA 1DVRA 5FBWB 3ZVLA 3FYHA 2JGNA 4G5GA 3H2YA 3WYAA 4ZDWA 4DJTA 3GP8A 2IYVA 4KYIB 4MA4A 4Y0AA 2NMVA 1RE0A 3H4MA 4CDGA 1MRSA 2JLYA 5H8WA 1IY1A 2R9VA 4C30A 1WBBA 1AM4D 2Q3FA 3HU1A 4IVRA 1OHHA 3B8HA 2V1UA 1CKEA 2PJZA 1Q1QA 4ZCIA 1DEKA 2ASEA 4KHZA 4US1R 5CJ2A 3VQTA 3OHMA 5KDLA 4F4IA 1S2MA 5GJWC 4RD0A 3OE7A 1E0JA 5DYIA 1OH6A 3KDSE 3A6PC 2QRZA 1Q12A 4HAXA 1N0VC 2QP3A 1KSGA 1Z08A 5B57C 3MJRA 1G4UR 1KNXA 1GNPA 5KPJA 4FWTA 1E9EA 4WXRA 1T8UA 2F43B 4PZLA 4D0LB 4YMTA 5EUMA 3X2SA 4DCUA 4YMUA 2RB4A 3A58B 2AK3A 1KJYA 2J7KA 2YJTD 4EIWA 4O3MA 1Z6YA 3DKVA 4I1OA 4RD3A 2CVHA 1KMHB 3T12A 3H0KA 2VPPA 2JIZD 2PMDA 3Q9LA 3VNUA 1FQKA 1N25A 1R0WA 5HZKA 1US8B 1DBSA 5HTKA 3M6AA 3SBEA 2R44A 3EASA 1JEDA 2OBNA 5A4JA 3W6NA 4DDVA 2C9CA 2EFHB 1KI6B 3K70C 5UKDA 2F43A 4Q1FA 1NG9A 5AJYA 4EPVA 4JVLA 3IEVA 1G5PA 3RYTC 1U8ZA 4Q47A 4AURA 4RZXA 5B2ZA 4C3ZA 3L0OA 4DLSA 4QGAA 3ZQJA 1K5GA 2MSDB 1KDOA 2ZJ5A 3QXSA 1COWD 4AD8A 2D7CA 2CLCX 3OFND 4E22A 1SXJD 5DIFA 4DSOA 4XTCS 1G7RA 1LVGA 1E2FA 1UF9A 3EA0A 2Q9CA 4JLDA 1BMFD 2IF2A 4TMZA 4DUGA 2REBA 3TGPA 4BFXA 4OBEA 2WVJA 1CRPA 3CX6A 3OAAD 3T1TA 4UNRA 2QTFA 4M9SA 2B21A 3AUXA 1P60A 2F1HA 2HXSA 2J0UA 2P6RA 1CULC 1X6VA 1CR4A 3BD9A 5TDHA 4OKSA 4TTPA 4OI0A 5TVKA 2VHCA 821PA 1KY2A 1W48A 4KSCA 2GZAA 1BO6A 2RGBA 4UNQA 3SDZA 1XPUA 1T6NA 4FCWA 4R2IA 2WPDA 5FPKA 1FOEB 3GLFE 3KJHA 1O3YA 1QHHA 5CDFA 1H65A 3M1IA 2YZ2A 4EFMA 1OPXA 1Z6GA 3GJ4A 3K0FA 1KO4A 1QZXA 1LNZA 4KFSA 2DBYA 3LD9A 3LQRA 4TTRA 4BUJA 2B8TA 3C7KA 3CF6R 4RD6A 2CLSA 4R71A 3I5YA 3PEUA 2GRJA 3RRZA 2A5DA 2WM9B 1KI7A 3EPLA 4M22A 2R6AA 3KTAB 1E1RD 1Z22A 1AS2A 2NO1A 4IXMA 2OHFA 4ITRC 4L9WA 4PSAA 3TUJC 1NIPA 4U7DA 3C15C 2YOGA 3AP1A 1U0HC 2GCNA 2QPTA 4IXNA 3IQXA 4E07A 4GP6A 1OT3A 1WA5A 2K5UA 2ZR7A 1H8EA 3Q85A 5LD2B 3AVYA 3GLHE 1FP6A 2EFCB 3GD7A 2WTUA 2FNAA 3CH5A 5FR1A 2WZQA 4GRAA 1NNEA 3M4YA 5HE9A 4JLNA 4TYWA 3GFOA 3BFKA 1YKSA 1E0KA 3PUZA 1ZUNB 1NBMA 3W3AA 1ZIPA 2YWHA 2PT7A 2ECKA 2YINC 4OHXA 3ZLJA 2IS1A 4YMWA 2QMOA 4L9SA 3JZMA 4Q7JB 4V0ME 3FHCB 3L0PA 4HDOB 2C9OA 3LH5A 4OJKA 3LW7A 5CJPA 4ERNA 4XSGA 1OXUA 4QM6A 3OIWA 2BM1A 2FSFA 1RIFA 1VHLA 2GXUA 5FL3A 5FL7D 4CEJB 2V6JA 3SJCA 4LHXA 4C7OA 4WVFA 4NYMQ 1IY2A 1CTQA 2YYZA 2VEDA 4LHWA 5HE8A 4V02A 4MGYR 3VR1A 5FI0B 5DN6D 5JHGB 3K09C 4B74A 4JLBA 4WXPA 1DAEA 1Z6TA 2WKRA 3LVRE 2B6HA 4LHZA 1F60A 4H1UA 3U7FB 4ZDJA 4ZV4A 5FBRB 2ZTSA 2QAJA 2ZU6A 3RHFA 1YZUA 4N3NA 2VH5R 4PAMA 1XD2B 3O47A 4OQLA 4M1WA 1XJQA 4RFVA 3HPQA 1VIAA 1ONBA 1S8FA 2CHVA 2ZRGA 2ZYUX 5KSZA 2XXAB 2FPKA 2ZE5A 4TQAA 1GILA 1RKBA 4JT4A 3VX3A 2C77A 1NIJA 3CX7A 3R9IA 3ECCA 4K81B 4AYXA 5AK0A 3ZDQA 5AJXA 1IN5A 2JLQA 3FE2A 4M1OA 3U7HB 1HYQA 1UDWA 4TLAA 3SJZA 2RGGA 1G21E 1XD2A 1F2UB 4TMXA 4LJ7A 1WRBA 2MMCA 1UEJA 4GMDA 2XNSA 3OEED 3T5DA 1R10A 2ZIAA 1CJVC 4Q19A 2DB3A 4LK2A 1TQ2A 3K0CC 4CEIA 1AKYA 2GXSA 4V0OA 4E09A 2WWGA 4A36A 1W49A 3IIMA 2O8EB 4URWR 5SZIA 3E1SA 2C5LA 4M1SA 3FPAA 4EQ6A 2WOJA 1L8QA 3VMFA 1OIVA 1LF0A 3KXKA 4Q66C 1FNNA 4MDEA 2PZFA 5J4HA 1E94E 1Z28A 4PPQA 3KQNA 1E2KA 4Q02A 3QENA 4EPXA 1YZGA 2OG2A 3SC3A 1XBTA 4A0FA 4D6PA 1H8ED 2ZJOA 4NCKA 2W00A 3SYKA 2O8DB 3RRYA 2BDTA 2WOOA 4UJ5A 4M1MA 1TF2A 3WHKA 1OW3B 3FFBA 4Y0VA 3SQWA 1GUAA 4PO8A 3W8NA 3HR8A 4YMVA 2GJAA 3T61A 4JJZA 1Z0IA 2QMUA 3THYB 2HT6A 4AKGA 4OQNA 3F0TA 1F3OA 2QTVB 4ZIRB 5KDOA 3R7WB 4DCSA 1N5KA 2WV9A 1CR1A 2OBLA 2ZUCA 4GT1A 4ZI2A 2JLWA 4XD7D 1JR3E 3SYNA 5E7MA 5BQ5A 3QPUA 3EPJA 4Q5IA 3LXXA 2WWYA 2ORVA 2P5TB 1MR3F 5FPTA 5GVRA 2H16A 4BZQA 1VDZA 3BXZA 1DAMA 1J8MF 1SVIA 1U8YA 2OESA 2XJ9A 4QGFA 4UNNA 4G5RA 3B9QA 3CNNA 1XB2A 4KVAA 2JLZA 1AQUA 1QHNA 1XF9A 1WQ1R 3AKYA 2RHMA 4GI7A 2A3RA 2IEZA 4LUCA 3TW8B 4C2TA 4AYTA 4PANA 2CXXA 3PUYA 4AYWA 5DHAA 3L82B 4JLPA 1WB9A 1UAAA 5GJVC 5EE3A 1KI1A 1YR9A 1ZC4A 2GCOA 3HP1A 5LPNA 3CW2A 2ONKA 2Q0HA 2ZR0A 4DB2A 1GKUB 5HR5A 3GLIB 3ZVRA 4DLZA 2QGZA 1TQ6A 1P72A 4UNSA 3IO3A 3RS3A 5KNBA 1VYTA 4S35A 4HATA 2F9LA 4W7SA 5AJWA 1G8PA 1R8SA 1W36C 5B64A 1W5TA 2YVUA 1L4UA 2D06A 4PSKA 4DDTA 5F98A 3SYLA 1NKSA 1XEXB 1XTIA 2HF8A 2FU5C 2HCBA 3AGPA 5IF9A 3LLMA 3OIYA 4JLJA 3TAHA 3LA6A 4A8JA 1EFTA 3IKJA 1ZM3A 2VQSA 2P0EA 3OIUA 3THXA 1JR3D 3B1YA 2OO7A 4Q4JA 1QRAA 3NBYC 3UMSA 3QKUA 4XTRA 3AKEA 4M9ZA 4YDHB 3THWB 3FMOB 4CYMA 1KDPA 3U5ZB 1D2NA 3GJ6A 3QI2A 5AWFC 1E9FA 2C96A 4HZUA 2J45A 4UQOA 2MSCB 2QROA 4G0NA 3OE7D 1ZVQA 4BLQA 1RRFA 2WSSA 5FH9A 1VCNA 4PC2A 4RVCA 1VCOA 2JA1A 4JYBA 3TSZA 4WZBE 3LXRA 4IFEA 3V4FA 4D81A 3ASYA 1QHIA 4UXJA 3TKLA 2O8BA 1CR0A 3AEZA 2GDJA 1QHXA 2ZE6A 1GNRA 4C0SA 1P75A 5JS8A 1Q21A 1ESNA 1OXVA 4PQFA 1KMHA 3T35A 4ZCLA 1W36D 4Z1MA 5EXSA 4C0AC 3T1OA 3LQQA 4LJ6A 5GVSA 1YU9A 1XXHB 5AR1A 4JLMA 3WRYC 5BWMA 1NLYA 2AKYA 2JLXA 3LX5A 4DIDA 1W4AA 5FUXA 3L2OB 4UXIA 1WE2A 3PJRA 5JJKA 3KL4A 4DXAA 2LKDA 3U60B 1G64A 1E4YA 1OFHA 2C04A 2FDCA 4NKRA 4FMDB 4B6EA 3TQCA 1CLUA 2FA9A 4C0LA 2O8BB 5KYKA 2VP0A 5HKKA 2WWHA 3PEYA 4F38A 1GITA 2P65A 2EFDB 4B71A 4FI3C 5EUQB 4Q9HA 4TYQA 4MRSA 4F4JA 2CK3A 2AN9A 3ADKA 3AH8A 3U4QB 5GJBA 1PZNA 1EXMA 1NP6A 4I1UA 2FMXA 1KOFA 1IXRC 3MMPA 3F3YA 3MWYW 2VA8A 2NPFA 4L4UA 1ZM9A 3AVWA 3PVSA 4URUR 1XFAA 4NH0A 2VSFA 4ESVA 3RS0A 2CCKA 2QGNA 1U0JA 2IYRA 1D9ZA 3A4LA 4ASUA 3F5FA 2WJHA 3ETLA 3B60A 3T34A 4CGZA 2JJ2A 5H68A 2ZRFA 3GLGA 2WICA 4RD2A 3E70C 3KX2A 4JSYA 1YRBA 1N6LA 4EPYA 1E9BA 4A0RA 4WZ6A 3C41J 3NEJA 3ADDA 4D4LA 3GQBA 3MWLA 5G3YA 3T06B 2F1RA 1TUIA 4TYPA 2JJ2D 3A36A 1E69A 4RD1A 2FFHA 1Q1EA 5JWRA 1TUEA 2WIAA 2VYFA 1C4OA 2GZHA 2ODEA 4QJ5A 3NH6A 2G9NA 1YZNA 5J40A 1ZCBA 1JECA 3Q7PA 3QKSA 4O2RA 1E2LA 4LSGA 4S2EA 3TR5A 2BBTA 3G0HA 2GTPA 4QL3A 1R5BA 2J7PD 3E5HA 3KQHA 2PH1A 3QXJA 4EFNA 2QZ4A 5JRJA 1GZSA 3CH4B 3MJHA 1IJFA 4EPRA 3MLEA 5SZHB 2WPDD 2XB4A 3BFVA 3JZAA 4E03A 1ZBDA 2CVFA 2BMEA 5DSZA 4P33A 3BBPA 2GVDC 2VP9A 4URYR 5JEDA 1GM5A 2BBWA 5E3HA 4AI6A 6Q21A 1YRAA 2VSXA 3SJBA 3WY9A 3EC2A 4JLVA 4Q9KA 3BFXA 1X8KA 4V0NA 4Q7KA 2RGNA 1P9RA 1N5LA 2FFBA 4JBXA 4KO8A 3QIAA 1FUUA 1R0XA 2JLRA 1UM8A 1P6XA 1DADA 1Y3AA 2WWFA 3B6EA 3KUCA 4B43A 4YXWD 4BEBA 5LB2A 4DUGD 2DFLA 1BIFA 3AVQA 4ACAA 4TL8A 3CWZA 2BWJA 3CRVA 2B7CA 1DPFA 5JCZA 1S4QA 3TBKA 5FOTA 5L8VA 2FFAA 5FOWA 2Q6TA 4M1TA 1XCGB 1KJZA 1JR3A 3N70A 1G8YA 1SQ5A 1PLKA 4LYHA 3LV8A 2AXPA 2G77B 2IL1A 4KLZA 1ZW6A 4IRUB 3EZFA 5TXGA 2NGRA 4HAZA 4A92A 4B2LA 1SXJE 4P0TA 3LW8A 3T1QA 3FKQA 4N0EA 5DH9A 1KO5A 4A2WA 3QF4A 4MUBA 2LWIA 4Q4LA 3MSXA 3PCRB 3AKDA 3QY0A 1M7GA 4OHVA 5CLQA 4RFSB 2AD1A 3WBKA 1G8HA 1OIWA 4P31A 2WAYA 3TQFA 3FGNA 4BEJA 4EPTA 3NHBA 3RRMA 2WKQA 1AS3A 1T3HA 3ICEA 1M7HA 1NN5A 4PAOA 3VKGA 2HT1A 1JR6A 1E79A 1XCPA 4MH0R 1GL7A 4Q9JA 3UG7A 5KO2A 2WJJA 1LTQA 2W2TA 3BH6A 1W4BA 2R2AA 1OHHD 1OYWA 1EFCA 1OKKA 2OM2A 4LJYA 3G82C 4A4DA 4DWJA 2OAP1 1NVVR 1SVMA 2XNDD 4RCYA 2IWHA 3CNLA 2BJWA 3KQKA 1GIAA 2ZRDA 3BB3A 5EQTA 1YQTA 2HCJB 1N6KA 2Q21A 5FTNA 3RVBA 2PX0A 2QAGB 1Z47A 3HYRA 4UKDA 3W9YA 2PZGA 3EIQA 4ZI3A 3PEVA 3CLVA 2QUZA 1YE8A 1Z6XA 2P2LA 2G1JA 1G6HA 3NDBB 1N0WA 2W83A 2P6NA 1OFIA 1U99A 3OF5A 1YR6A 3T15A 3TMKA 2FPLA 1T5IA 1FX0B 4MRVA 3I8SA 1T91A 3PUXA 4ABYA 3REFA 2YOFA 2WWIA 2EYUA 4NCJA 3DMDA 1U81A 2I1VB 4PZYA 2XEXA 3GJXC 3A37A 1NJGA 3BRWD 1SVLA 4CT5A 5AUOB 4Q1CA 4EFLA 2ORWA 2XB2A 1X1RA 1NVXQ 4HEJA 2EWVA 1G3RA 3B85A 4XD7A 3THOA 1IM2A 1ZUIA 3ND8A 3RS7A 3UMRA 4IVQA 2WJYA 2YV5A 3O8DA 1F48A 2G6BA 4LCBA 2XZPA 1ZRHA 4HAYA 4MKFA 3AVTA 1A7JA 2E87A 2CNWD 1G16A 3N2EA 4BASA 5M04A 1GTVA 2WHXA 4A0HA 4KODA 4U02A 2QN6A 4MITA 3CRW1 2ZSDA 2BKUA 3C14C 4HUQA 5LDDC 3VHXA 3WMGA 1E2IA 4PO1A 2O8CA 2B92A 4Q4AA 4Q9IA 2FJUA 5KNDA 1N3BA 1XMSA 1WCV1 5JHHB 4KFRA 4K46A 3IHWA 4B3XA 3FKSD 1ZINA 4AY2A 2ODBA 1G9XA 2AK2A 3PUVA 2I1QA 4YXWA 3RDPA 5CIQA 4XIGS 5FOVA 4YLGA 4W5HA 1PUJA 4IHQA 3P32A 4I1VA 1KI3A 1XTKA 1S3GA 1S0UA 2N42A 3GLHB 2DPXA 2V9PA 1RRPA 4DBLC 5BXQC 1M1YE 1XZPA 5JMTA 1ZNZA 1LF5A 1RVDA 1VCIA 3OEEA 2O8CB 2IBMA 4IDOA 3QEJA 1P3JA 1G7CA 1N5JA 3S1AA 4II7A 1XD9A 1II9A 2W2VA 2BMDA 4GNKA 1ETUA 2J7PA 2CL6X 1G7TA 1T4GA 1KO1A 2OXCA 3CX8A 3ZS9A 5JCPA 3VR6A 1MO3A 4QKQA 3Q5DA 2ATVA 4BFVA 3BWDD 2C9YA 2F1IA 2QNRA 1OXSC 1Q3TA 3EWSA 1KSJA 3WNCA 1D9XA 4DSTA 1UBCA 1PUIA 5DI3A 5FUVA 3ZZ0A 2GEVA 1FZQA 2CCGA 2E9SA 4DEYA 2PMKA 1RRGA 3I1FA 1DAIA 3RS2A 1J99A 2QE7A 1V5WA 1ZYUA 3OEHD 1MO4A 3U7GA 5B58C 4CEIB 2IT1A 2NTYC 4DHEA 2BEJA 4BLRA 3FMFA 1LS6A 5HCIA 2O8EA 1GKIA 3PITA 1BYIA 2PZEA 2V8OA 2A5JA 4TL9A 1CJTC 1XTRA 3WNBA 1NRJB 3I61A 4W5WA 4C7OB 1U8AA 1KO8A 2AX4A 4ARZA 1E9AA 5D3MB 1R6BX 1XP8A 2DFNA 1S9HA 2WWWA 3QQ5A 2ZROA 4US0R 4LV6A 4X8HA 2A7QA 5DHFA 3ICQB 1RYFA 1VIYA 1SVKA 4H1VA 2OEPA 2CK3D 4TT3A 2V6IA 5CM9C 4CIDA 4DIEA 2BCJQ 1N6PA 2W58A 5EP2A 4KLNA 2OXRA 1ZCAA 1M2OB 5HKKD 3SR0A 1XMIA 4D4JA 5EJEA 2YKGA 3GPLA 1YHNA 4YDSA 2WSMA 1NKTA 3PENA 4HAUA 4K8OA 1DAFA 1FP7A 2PLRA 3DM5A 5KSPA 5KTYA 2I4IA 2SHKA 3OESA 5D3QA 3CUEF 4ARZB 1SULA 4YQFA 5K8TA 3OEHA 1ZIOA 3I5XA 3ZGXA 2QE7D 1XEWX 5EZ6B 2O8FA 1GAJA 1FUKA 4I1SA 1F6BA 1E1RA 1LY1A 4P32A 2H1LA 1AIPA 1S1CA 1U2RA 2FN4A 4YONB 2ZRBA 1Y63A 2ZYWX 4A6XA 2Z6VA 4WIAA 4FMCF 1UKYA 4PR0A 2GBLC 2OZEA 3CZQA 5GJCA 3CPHA 2BVNA 3N2IA 3SN6A 3HPRA 3IPYA 2L0XA 1W0JD 2RCNA 2PEYA 2IUTA 4B3CA 5TY0A 1K6MA 4G5QA 4CVNA 3W3ZB 3QKRA 521PA 4DSUA 1XNJA 3B5JA 4KVGA 2XTZA 5J47A 3BB1A 2QP9X 3RS5A 2F3RA 3ONWA 4NMMA 4AC9A 2IXEA 1P62B 3RNLA 2HLDA 2IF0A 4LHYA 4DB4A 1KGDA 1Z8FA 4D0NA 1KK1A 4KU4A 4NE2A 3BE4A 1TNDA 2VHQA 4LOAA 4TZ6A 2HDNB 4ZKEA 1JALA 3TSOA 3AVVA 5KU1A 2OFOA 4JLOA 4XH9B 1E0AA 1IAQA 1GL9B 3AB3A 3IIKA 1GRNA 3NG1A 1JQLB 4NCIA 2VRWA 3U61B 4NL4H 1G41A 1H8HA 1N6HA 4FN5A 4IEIA 4C9BA 3NDPA 3SHWA 3VAAA 5L3QA 2CNWA 3BH0A 4M53A 4OL0A 4F4CA 3QF7A 1JAIA 2AFHE 3R9WA 4DLYA 2IYLD 1Z2AA 1ZC3A 2BMJA 3AF2A 3B13B 1Z6AA 3GJ3A 1A4RA 4V0MA 4A6PA 3DZ8A 3RAPR 4US2R 4U00A 3I62A 3P1JA 1N6IA 3UKDA 1I2DA 1KO7A 2W6JD 2CL7X 2O5VA 4D4KA 2QBYA 2FEOA 2X77A 1FMLA 4HB4A 3REGA 2IW3A 1E2HA 1E2NA 5SZKB 4JS0A 4NYIR 2X2EA 1YZLA 4GOXA 2ZE8A 2R65A 3VHLB 1X8JA 1MV5A 2VHJA 4B48A 5L3VA 1R8QA 3GLIA 3NXSA 2QQEA 1OYYA 3HR7A 3DM9B 1G291 2QI9C 3LDAA 4HI0E 3QVUA 4DLRA 3ZYCA 5CITA 3I92A 5EE5B 3QF4B 4WZAE 2JATA 3KKNA 4TQUS 1KY3A 4XWOA 4X8MA 2GESA 1XJ0A 2NQ2C 4XOIA 3W8RA 3NC0C 2GVZC 4JL6A 3RC8A 1RRCA 2XNDA 3K8YA 4XWAA 2QBYB 5BN4A 1TEVA 4R2HA 2QA5A 2V3CC 1XRJA 3FFAA 3WNDA 4M1KA 2UZ3A 1G5TA 4KV9A 1ZD8A 1CP2A 4QJ3A 2XTMA 3O8CA 3TE6A 3AUYA 3ASZA 4WA7A 3GLGB 4QFMA 3LWNA 3C8UA 1Q1BA 1KAOA 4PHFA 2XX3A 1GFIA 5L3SA 4Q4HA 2BMFA 2ZI3A 3VU9A 1X8LA 1G3IA 3N5CA 5BW8A 2AR7A 4R7ZA 4D0GA 3W6PA 2IXGA 4JL8A 2G83A 2N46A 4IDPA 4UJ3A 1G20E 2IS4A 1OJLA 2CHGA 3IIJA 1HUQA 4MQBA 3QPWA 2QPAA 1NSTA 5H70A 3Q72A 5E4FA 5C2JB 2OILA 2GK6A 2PEZA 4EJSB 4MKGA 4MGIR 2FZLA 3DPUA 4XVRA 2A78A 2OCYC 1IONA 3TVTA 1G3MA 2V54A 3AV0B 4G3XA 4OK5A 3I4LA 4GOKA 4Q00A 2ZJBA 1EX7A 5TMPA 1Z0JA 3QXXA 2OCPA 3QKSB 3A1WA 1SHKA 1IXZA 1U94A 1EFRD 1R5OA 3K53A 2V1XA 2KI5A 4HLUA 4Q1DA 1VCMA 4HAVA 2VP4A 5CK5A 1TTTA 1N6NA 3PIRA 1CRQA 3GCGA 4ZO4A 3OIVA 4LJ8A 1IJEA 2RMKA 2REOA 3B1VA 2VSOA 3O8BA 5JBQA 1E3MA 2QT0A 3U3JA 1M7BA 1US8A 4HZIA 1AGRA 2ZRHA 2WWXA 4GZMA 3TUIC 4BFTA 3LX8A 4RD4A 5FUWA 4G01B 5FTJA 3TK1A 4NPHA 3GJ5A 3LFUA 2GBLA 4AKIA 5IRCD 1VKJA 4PHHA 4KI0A 4XSHA 4IDNA 5JJLA 4L15A 4GDFA 4LX0A 1SKQA 1JJVA 4X8LA 3MRSA 1W36B 2IS6A 3W5JA 2C8VA 1D8TA 2A5YB 3AP2A 3KZ1E 1HQCA 3Q8XB 3UWOA 2ZJ2A 4A8JC 1E9RA 1NLFA 1LFDB 3C5HA 5EXTA 2RGEA 3W34A 4OK6A 1KI8A 3QXCA 2H92A 5KHOC 3B2EA 3K9HA 1JB1A 4IOKA 2ZAOA 5JZVA 4FINA 1OIXA 2J0UB 2OFXA 3V4RA 3QE0A 1WDTA 4NYJQ 4PZZA 4P4UA 1VECA 2AKAB 3TR0A 1HV8A 2IK8A 3ZVNA 3K9LA 1JPNA 2XAUA 2DWQA 4F91B 2GJ8A 121PA 2VO1A 5DO9A 1E1QD 3UWKA 1EFUA 2IYZA 3QPVA 4B47A 3PR1A 4KCGA 2XZLA 5CDFE 2MSEB 1OXXK 1U90A 2HJGA 1E2GA 5HZHA 4UXHA 1T9HA 1DELA 2EYQA 4RZ3A 2X8AA 1C1YA 4LPKA 4E5UA 4I4LA 3VTKA 3HJNA 4AG6A 3MUFA 1GDDA 4JVMA 1G7SA 4W5JA 3EC1A 1XDBA 1NJFA 1T3SA 1TAGA 2J5XA 2KBFA 1LW7A 5HPYB 2W2XA 1TMKA 3AGQA 3VFDA 1UKVY 1CU1A 1R0YA 4EUNA 2Z4SA 2ZRIA 1E99A 3UMFA 3ADBA 3TSWA 3KXLA 3DMNA 3V00A 2V7QD 2OCBA 1ZP6A 2D2FA 1QG4A 1TPZA 3EZ2A 4LJ5A 1DAGA 1P7CA 4A82A 2OE2A 1LS1A 3CRRA 1ZU5A 1OH5A 1RW4A 2HF9A 3BB4A 1FW6A 3AP3A 3AVUA 2BEKA 1G6OA 3K0AA 5FI1B 4NBSA 2Z5FA 2QG6A 1DTSA 1OXTA 721PA 1HEIA 1YJ5A 1BMFA 2G3YA 3DOFA 3TLXA 5ELXA 3LY5A 4Z1MD 1G8FA 2JDIA 5EXPA 1NN0A 3FTQA 3A1TA 2GEDA 1PLLA 5E95A 3ZJYA 3PG5A 4KITB 5JLJA 3B9PA 1E2EA 1UKEA 1AKEA 4OQMA 4I81A 1E6CA 2HYDA 1VG8A 1GVNB 4CRWB 4Q48A 2CDNA 1NVVQ 5FTLA 1SVSA 4EKDA 1HH4A 2YC4C 2VIIA 3K9GA 1DO2A 4PC3A 2F1JA 5BYKA 3ZVMA 4LGMA 4YMSA 1NF3A 5G41A 2IUUA 3ND9A 5LBIA 4HYYA 5EP3A 1II8B 3P4YA 5E7JA 2JLUA 2ZR9A 2ZAMA 2F3TA 2C78A 3QBTA 1AK2A 2P6UA 4OK3A 3U3MA 1Z06A 2VBCA 5JRZA 4BGDA 2FPMA 2YOHA 3THYA 4NCNA 5FTKA 3GLFA 2UKDA 2XXAA 2B8WA 1T0HB 1KHTA 2QAGA 4RFSA 1TQDA 1N0UA 2BM0A 1KSHA 4JBWA 1KDTA 4DDWA 1QHSA 4B3DA 3KQUA 1OLOA 4QGGA 1W5SA 1KK3A 1S9DA 4M4SA 3SS8A 2G88A 4D26A 3QKTA 4JJKA 3WHLA 3GEIA 5DGXA 3FVQA 2P3SA 2R8RA 3FMPB 1MABB 4LI0A 4PHTA 4A2PA 4PQYA 3RWMB 1IN4A 4P4SB 1BKDR 2FGJA 5ANRB 4HDCA
chains in the Genus database with same CATH superfamily
1ZN2A 2FWIA 4CI0B 3DJYA 2QV0A 2XTNA 4LDQA 3NBXX 1F8FA 1T8PA 3D8UA 4AU1A 4HJXA 4B8YA 1JWLA 4B3GA 2GD6A 2ZAIA 4E13A 4FFOA 4GQBA 4ZEWA 2GN0A 4MW4A 1CV2A 4X94A 5KAPA 1U7HA 3FZYA 4DQDA 2DCUA 5IWAB 1FYDA 2OLJA 5E6RA 5EWJA 1K8QA 4FYWA 3OHPA 4DCVA 4C4TA 3OQNA 1AUOA 1NQUA 4Y1RB 4QBHA 2H5LA 3W90A 7ADHA 4KQCA 2CFIA 1MABA 5C31A 3EAQA 4Q21A 1TUBB 1WTAA 3SOPA 2YQ4A 1WW3A 2FZKA 3A9UA 4E3WA 1K86A 1VPWA 3D6JA 2FW8A 3KRTA 2GA8A 3O83A 4BO2A 3OZBA 3HKBB 1Z0AA 1E2JA 1H9BA 1YUMA 2HIMA 4D9KA 4XCXA 2O20A 2WNHA 3E2PA 1Z4IA 1NVFA 1CY0A 1VMDA 3ZD6A 1Z5WA 3FPEA 1BXZA 5E0KB 2BONA 3V4VB 3WO1A 4RY2A 2CUTA 5FDFA 4FIDA 4IMJB 4K9MA 4FB4A 1DLIA 1GLNA 2CEAA 2REQB 3QTBA 5DXJA 4ASUD 4B4WA 2G70A 3VOBA 5I47A 5CB8A 3K0FB 3SSOA 5ED4A 3JD3A 5DSTA 2OWEA 3FR7A 4EG0A 3LWZA 4D5EA 4KJXA 5LMCA 2C5EA 4FYKA 3LP5A 3SZRA 1IAVA 3KQYA 1YK1A 4N5NA 4MYRA 5FHQA 3GFTA 3RVPA 4B32A 1AV7A 1QZ3A 5AQ1A 5AVUA 3FRJA 1JA0A 2O2XA 4JJFA 3DLTA 3CVOA 2P5SA 5LZ8A 3BIOA 1GDTA 1R12A 3EIEA 1GCUA 1NI4B 1VRWA 2ZU0C 1CJMA 3FJ1A 2YJ5A 3C2QA 4AIIA 1ADGA 4CQMD 1IWOA 1TRHA 4NEQA 4GKJB 1WF3A 5D00A 1KAEA 1WDMA 1YQEA 4PBRA 2Q4EA 3BGWA 4N6NA 1SIWA 3H5TA 2QL6A 2IPOA 3LVQE 4IOMA 3QOFA 4B6RA 2HK9A 4B5KA 2OWDA 2LP4Y 3DV0A 3SFTA 2V0GA 1ZD1A 1O8CA 1G98A 1GPAA 3TQQA 2HMVA 4ZCPA 1LSSA 2BF7A 5LJIA 3PSHA 4URFA 2QU8A 2HRZA 4MJ7A 1YIDA 3L05A 2IWRA 1M0WA 4RVNA 2ORED 2WUDA 3CBQA 3HB1A 4KIFA 1AQLA 1ZGAA 2B4QA 1GQRA 3MRTA 5BRJA 3ZR4B 4QXQA 3U4MA 1TU0A 1NZDA 3NTOA 5AXCA 3VVMA 2NWQA 5EE0A 5FORA 3VTFA 4F3KA 1D0SA 4IIJF 1GL6A 1R4ZA 2HBZA 2O2CA 3DYIA 3BA1A 4IWYA 1EEXB 2M6KA 1E0DA 1XQXA 3A9WA 3IO5A 4QULA 4WY8A 5BVHB 2JAUA 1OX6A 2IYXA 4M2LA 2QF7A 5BVGB 3M1YA 1OC2A 4PQRA 4CG1A 3HVUA 3VR3A 3JAKA 3CPJB 2I6SA 3IBCA 3TOSA 1CS4C 2ODQA 4MMZB 4ACBA 2NUAA 1KMNA 3CJTA 1NM5C 3ZQKA 2QL5A 3OT5A 4Y3UA 2JLAA 4E2FA 1SWVA 5P21A 3VZCA 4BMOB 8GPBA 5KYUB 3L7IA 1QP8A 4A2CA 5AD1A 2JGAA 3ZDFA 5AJHA 1SUPA 3DEJA 4B81A 1DC6A 1PR0A 3H1TA 1FFEA 5GGXA 3TLCA 5CBKA 1OASA 4PLWA 4D6YA 3EZ9A 4RK1A 3FCEA 4TLCA 1ULBA 3E5MA 1RJ9B 1UANA 4EAQA 3CCBA 3HJTA 3NDIA 1B42A 3P71T 4GZ6A 1R2QA 3GFBA 3N76A 5LMUB 3VKHA 2F64A 2DHEA 1NBIA 1RMQA 2JVJA 2JW5A 4RLHA 4E88A 4IKEA 1GFSA 3BVPA 2NZVG 2GKGA 1KYIA 3CISA 2FEMA 4WUTA 2FWNA 3AEYA 1NZFA 2HMWA 2IEBA 5EZ5A 2XR1A 3ZCSA 5AXBA 3O9VA 3PEEA 4W6ZA 3RPEA 2QP4A 3G2JA 2O0KA 2D5AA 3ZG6A 5FQNA 4B83A 2DUNA 2YZMA 1KJWA 1TM7E 4BO7A 3QEMA 1M6YA 1OV4A 1E6LA 1RAGA 5DF1A 1SELA 3SJAA 3LZCA 1CQJB 2Q45A 3SPXA 1O96A 1BOFA 4TZ0A 3LNCA 3WIDA 1XLTA 1Z0UA 4G4SP 4V0QA 1NVDA 3QM1A 3B9BA 3IV6A 4RXUA 3PVZA 3OZAA 2H29A 3X1DA 4D79A 4YY3B 2PGAA 4RV9A 3PQFA 1NDUA 1OA1A 4KG7A 2X1VA 2LXNA 4ZHQF 3N28A 3R7SA 1XJ5A 2IYUA 5LKRA 3ZDXB 2K7ZA 1QS0A 3A7EA 1YCGA 5H82A 4L5IA 3KKQA 1YQXA 1QYCA 1QKJA 2RHCA 5K8LA 4LYJA 3EZ7A 3VNRA 2I65A 5EJ6A 1O08A 4DT1A 3K1JA 2ZJ0A 2PXHA 3D02A 3B1WA 1H4VB 1KH1A 3I8OA 3ZQ6A 2H57A 3RBXA 4GI1A 3WI7A 1F2DA 2YXLA 1C50A 3HJFA 2BIFA 5GWXA 3Q7EA 4P0PB 1TF5A 1Q50A 4LQ4A 3JQEA 1RZVA 5TX7A 2GO7A 2OD9A 2NO0A 2QLJA 2ZRKA 3E7WA 2AD5A 3H0CA 4HPXB 5LQCA 1IM5A 3KHUA 4C4PA 2QYOA 2XDYA 4EJMA 3FX2A 4F9GA 5KOYA 2P78A 4ZVOA 3GJQA 3GG2A 3T5GA 4AS1A 3OCWA 4FZJA 1IJKA 4II3A 2NO9A 1AGPA 3LNTA 4BLUA 4LY9A 5IJAA 3I5AA 3WMEA 3Q88A 1P0MA 2D1RA 4HEHA 4MIOA 4Q03A 3WP0A 4EL0A 1PFKA 1Z12A 1ZHFA 3OWOA 4E1AA 4M37A 2XBUA 1GPUA 1ZM2A 2VYNA 1NUHA 3BH7A 3HYTA 1U2ZA 3Q9NA 1T2UA 4QOFA 3Q3CA 2OL4A 2GEUA 4REMA 1AO0A 4JT2A 1OKKD 1DHTA 1FDRA 4Q3AA 1CQIB 3I9OA 5AOAA 1QK4A 4HXYA 4AJPA 4BO5A 5JZMA 4KZKA 2EJBA 3VNBA 4B85A 1YE3A 2VPXA 1DAPA 5I01A 1YASA 3K9WA 1XZBA 3K4HA 3BAFA 1JDJA 2DFVA 1CQZA 2G09A 1P8JA 5J4KA 4U63A 2UDPA 1A8QA 4LMBA 1AZTA 4JBHA 4X6XA 4U2GA 3WYFA 4HWOA 2OB1A 4Z0PA 5G4LA 5GONA 4MQEA 1P4HA 1EBUA 4IGFA 1IZYA 3RFVA 4EVSA 3BS4A 3EXG2 3NT2A 1E6UA 2TS1A 4RDXA 1PK8A 3ABIA 2JFXA 3KVYA 2XKKA 2PRKA 4OU5A 4BFWA 2GS9A 3UC9A 3U3RA 2Q2VA 4ZYUA 1HFKA 4Q9AA 4MKIA 1V5EA 2D62A 2X0FA 1ZOOA 5K51A 2BBOA 2IIQA 1SGWA 3VDQA 3SEZA 3B1XA 2HA6A 1U5BB 2VJMA 3F3SA 2I71A 4ND2A 1MKYA 1OLUA 4TYYA 2BFFB 4IVNA 2Y0CA 4TV9A 4B2PA 2QY9A 2Z2YA 3DHVA 3GXOA 4KIJA 5L3QB 3FDFA 2VP5A 1P80A 4ID3A 5IU6A 4HHEA 1LTKA 3BC1A 5CXUA 4MVJH 2NXWA 3LWDA 1OE0A 3CSDA 5IEBA 3H16A 3LHSA 4NXMB 4A1OA 4TN1A 1E7RA 1C3OB 4WOJA 3CM0A 3V46A 3P8ZA 2BEWB 1D3AA 5CLLA 2YWGA 3VZBA 1K7SN 1YIAA 3H4TA 4N0QA 3TVDA 2FMKA 1ADBA 1P7ZA 2WU3A 3BM5A 4Q7LA 1PU2A 1V8FA 3TZKA 2BGRA 4RF5A 4CCWA 2WNSA 1TTQB 4MUGA 1CNMA 1AZSC 1LB1B 3WSWA 3QU4A 2R4QA 2FKAA 4MQMA 3OTHA 1QZUA 1W6RA 2B61A 4RACA 1GZ4A 1M0TA 4L8FA 4TLMB 3RT1A 3HM2A 1XLUA 2QOEA 2EFYA 2P68A 4OBXA 5FEMA 4AWBA 1Y1PA 4BYGA 4GMXA 4WZAA 5C1BA 4MI9A 3QA9A 3KWMA 3HWSA 2A94A 2X0NA 4QBFA 1AURA 1NUUA 1Z83A 1V8ZA 2XHEA 1K8XB 4RHTA 1IWPB 2G36A 1N2BA 4KQ9A 2WK1A 2HDHA 4TM7A 2QR3A 4IJQA 3QU5A 4RPIA 1NBOA 1UBNA 3GR6A 2X14A 1XWWA 3W6OA 1Y3DE 5K0GA 4JEIA 3VX4A 5I9NA 3KJIA 2CEKA 4HFRA 4AXBA 3ISJA 4QGHA 4FEYA 4JBYA 1NBMD 4B4VA 5CD9A 5EJ7A 4K86A 3C3EA 4EJSA 3W5DA 3AF0A 2GM4A 1ORVA 5EE1A 2WU0A 4PG4A 2XQKA 1UDXA 2LIVA 3OZCA 3FETA 1IFXA 4RH1A 3KUDA 1Z5VA 2KB0A 4WNAA 4E70A 3Q5EA 1BMTA 3S81A 1M8PA 3RADC 1D6NA 1E4VA 1V4BA 3JQ8B 3ZWQA 2IS2A 2RGDA 3W4KA 5HOEA 4JJAA 1XK7A 4HB2A 2X2FA 3T7CA 3IKMB 5LZ9A 1TM1E 1M2WA 4JKYA 4Q4HB 1AJEA 1LNQA 2YASA 4C4RA 3RSOA 1PNVA 4ZGGA 1ODKA 4JLWA 5DNEA 3GDOA 4C04A 4CMEA 1DQPA 3CONA 2RI0A 4YALA 2HUPA 5FCDA 3DBIA 5JJIA 5J43A 3SZLA 1NOIA 3KAKA 2G1UA 2O52A 1L9XA 1D2GA 1ZQ1A 2PVCA 2FN3A 1S96A 2W93A 4IZIA 4RL4A 1W5EA 3BEOA 3R20A 1KBQA 2RAPA 4IM7A 1JHUA 5HIJA 4CLOA 3BHMA 3W6UA 1QX3A 3KYBA 3MJFA 3HKEA 4M86A 3VYWA 4LBVA 1X7ZA 5JI3E 3S2UA 4GL2A 4GP7A 4MOWA 1GNQA 3MAAC 3PC4A 1A7AA 2C31A 3I8XA 1NMZA 1DKRA 1OFUX 2ZBRA 4WEQA 4X7PA 1FX1A 2KBEA 3DE4X 1E98A 2HLNA 3D0RA 3WJ1A 5LLDA 4WGFA 2C2HA 1S2OA 3GZJA 2EL9A 3W05A 1HO3A 1JEYA 1WXIA 1E1CB 4FC6A 5JCJA 5EXXA 2HFJA 1IB0A 1ZG3A 3DFZA 4WNYA 4CKBA 1FPMA 1EDZA 3U31A 4XEUA 5I7WA 2AG5A 1Y1TA 1EFPA 5LOVF 1ENYA 2NZ8A 3EGDB 2OUIA 4EENA 4LZOA 2EEPA 1YACA 3D7MA 3RSLA 3C6XA 2PGLA 2WT9A 1X39A 1HDXA 1TCCA 3CNOA 3FOZA 4G36A 4JJ4A 5IYZA 2H7XA 2RH9B 3B1ZA 4B3HA 4NENB 1D1QA 1XZGA 4Z4EA 3CUTA 1X19A 4JNKA 1IBRA 1WPRA 3KVOA 4E2ZA 1F3LA 2FGKA 2LR0A 3KBBA 2H1VA 2QLLA 4H7IA 4QOJA 3C4JA 5ECGC 2NSDA 1L4KA 5AJZA 2R6CA 1CS0A 1N0HA 2GD1O 4J9UE 1CE8A 2AUNA 5FT9A 3E4CA 1NQ5A 2E82A 4OQ4A 4M0UA 2IODA 3L7CA 1IZ8A 1NR1A 2FPIA 2HLDD 2F62A 1IN1A 3NTUA 5LOVB 1D03A 3WBJA 3OD5A 4WH0A 1NE7A 5CFOA 3FUWA 4Q6WA 1VBKA 1Q20A 1EWRA 4GQAA 2Q0QA 3VHXB 1XRSB 2KM1A 3KTAA 5DE3A 3EG5A 4YRKA 3ZY2A 2FOXA 2J3LA 1XGKA 1UAYA 3IV9A 2ZS9A 3KQOA 4HC4A 2R6DA 3VR4A 4DCPA 1Z38A 3G7SA 5JMOA 1YDFA 1NUQA 3K0CA 3CU5A 3UKJA 4PX9A 4ZWNA 3FWYA 1RZ3A 1ENOA 3FOWA 4J49A 3NVAA 3UJ7A 1KORA 4ND8B 4HOYA 4JU8A 4TL7A 3ZXIA 3WG9A 2Q9BA 2QTAA 4QUDA 1T36A 3LF1A 2NUAB 4LF8B 4KE6A 3RAEC 4KGVA 5K0ZA 3PU6A 3D8TA 2WP0A 5DKFA 5TARA 1JT2A 3SAJA 1VTKA 1JKJB 4PVCA 5AIBA 9ATCA 3MAGA 2VF8A 2P90A 1WV1A 5KDDA 1HWYA 2YY5A 4OUKX 1P2DA 4X1YA 5IWCA 1RXEA 1J25A 5HUQA 2H59A 5JYEA 5CT6A 3ZDYB 4QJBA 2QRQA 5ER6A 4AJEA 5C7OO 5KTMA 4K3VA 4CF7A 1HBJA 4XARA 2H4WA 5BMVA 1N3LA 1RM4A 5L7YA 2GOYA 2IDJA 3MNFA 4FSHA 4Z9FA 4NJEB 3RTCA 2GFHA 3D43A 1HEUA 3PF9A 4PPYA 5BSWA 3I23A 4J29A 1G4HA 2JHCA 4GSYA 2B2XA 3Q40A 1J8FA 4D74A 4YCDA 1XPJA 2QVLA 2CKMA 3TRDA 1E66A 5IAJA 2B4TO 4QPJC 1RPJA 1D2HA 2OLKA 3IHLA 4GX1A 3S2EA 3UFBA 4A8PA 4AECA 2ADOA 2R5FA 1LBIA 3HEBA 4YRRA 2C99A 1MHPA 4N18A 3A2NA 3W9SA 2PK3A 4AP5A 2XQVA 4BX0A 1PS8A 2WYUA 1IB6A 5IX8A 4IIVA 1K3TA 4PTLA 2E4AA 3OI7A 2CY0A 4A9AA 4E15A 3L0SA 1Q7TA 4UMDA 3AVPA 3UGTA 3PI7A 1CY6A 5G0WA 5LQUA 2PLFA 1DS6A 4YTEA 1CXZA 1DC8A 2WAOA 2IA5A 2ZSFA 4M9CA 3TWOA 2PSEA 4GU5A 1B0PA 4HN2A 4YLEA 2AOXA 3SNKA 3HL0A 3FDIA 4QHYA 4CMAA 4DE5A 4I5FA 5ICCA 2C3YA 4LI3X 4WN3A 1JZTA 1U0RA 5E3JA 5E4YA 4KJZA 3PGKA 1ZUHA 3O9ZA 5EWMB 3D4NA 3BCSA 5IAEA 1DJQA 1T34A 4OYLA 1E32A 2GN1A 5ESDA 2CVZA 2Y6UA 2ZXUA 2W42A 5GY7A 1JAHA 3DEIA 3FR8A 1HQYE 3HB4X 5JS6A 1PD1A 1KDVA 2FPPA 1KHHA 4MW0A 2BKEA 1HA3A 3I72A 4J0DA 1OLSA 2PZLA 4OATA 4P93A 3JYQA 3WICA 2J1LA 4D43A 1OD6A 1F4PA 5FYDA 2Q5FA 3A4YA 3CN7A 5FPPA 4URVR 3PUJA 2VCHA 4B44A 1W0KD 3DZBA 1UKZA 3S44A 4AWXA 1TLTA 1X7XA 2AXEA 3M82A 1EUQA 4E5VA 1CY4A 2P9GA 1EUDB 4UHBA 2X5KO 1T6YA 3K7EA 4N7JA 2JFHA 1MRNA 1PD0A 2IYYA 1N36B 2XB8A 3ZJTA 5LYJB 2PPVA 4FQ8A 3WWDA 3G5UA 1VSTA 5AOVA 5LP6C 5LZ5A 4EQZA 4TX1A 1DAHA 4BLTA 2WR8A 3V9AA 2VHTA 3I9NA 3JQRA 3WK5A 3ROMA 3ELUA 1VHQA 1V6CA 1WXGA 3KCQA 4F56A 3QBDA 3EMVA 4FEGA 5BOSA 4CEHB 2Q3MA 2VTKA 4WKPA 4DMUB 1R0RE 2W4MA 3ESDA 3NFYA 2ZIXA 3X1WA 2O8FB 1K1EA 1KBOA 1OBOA 1JNYA 3SR3A 3ZZMA 2XCTB 2GILA 2XSZA 1ZH2A 3QQPA 3GEPA 4FOOA 5FPSA 3SQXA 5U9CA 3SKVA 3HO6A 4UOZA 1FTSA 2C07A 4MCHA 1LRJA 1E4EB 1GGNA 3GBVA 2BHLA 3IYLW 1UC5B 4R81A 3ZWDA 1Z2PX 1QH1B 2X0EA 5B3AA 3D1LA 4Y6GB 2HU7A 3HZRA 1AKQA 1NDQA 2PH5A 3AB8A 4HMOA 4RQUA 2RKOA 4WZBA 3E1GA 4F4HA 4W5NA 2PJRA 1DTWB 4YYEA 3AR5A 1T5LA 2JS7A 2WTAA 2XZOA 4S1PA 1FFXA 3N05A 4LRWA 1OF1A 2OV2A 2ANBA 3PFIA 3P4XA 1U0LA 1JU4A 1P6UA 1V39A 2XWBF 3C6KA 4Y0NA 4AX4A 1LPOA 4F3RA 4MXDA 1IY0A 4TTQA 1Z3IX 1PS0A 3QKRB 1VIMA 4EB8A 5J23A 1P73A 4KBGA 4CPDA 3K20A 1I1OA 4EKGA 3NDJA 2H0RA 3DE6X 3K6JA 1R5NA 2JAQA 4DARA 1UM9B 4RQAA 3BICA 3U44A 5CA1A 2WMYA 1GVHA 1T15A 2QT1A 2YJGA 1X0XA 3QV1A 2B1QA 3CRQA 2B3TA 1KIMA 3OQBA 1E6MA 3ZGNA 4B35A 2C0PA 1H2AS 3FVRA 4HAWA 2GK7A 5EYPB 2HRRA 2VRBA 2EKQA 2ZJYA 3WTBA 4LBZA 5FTWA 4EI9A 1JFSA 2ZSJA 4A0GA 2IZZA 1L7MA 3AC0A 3K8OE 3VBEA 3KALA 2EARA 2BEWA 2CXNA 5DISB 2DLDA 1ORTA 3ZNPA 3FLEA 3KVRA 4NBUA 1QPZA 1ECJA 1CEEA 4DWOA 3CC8A 3N8GA 4DLWA 3NAZA 1DJOA 1MENA 2XGGA 3SGLA 4J1TA 3SJUA 4IV8A 4BV3A 1W0JA 4JVOA 3JARB 3OMXA 4C89A 2CD7A 4QEKA 2H31A 4EA7A 4YR7A 3T7TA 2ZRLA 1M2VA 2FWRA 4R1OA 2OK8A 4JI1B 5IAAA 1Q15A 2BL4A 1PJ3A 5F23A 2ZITA 3IAXA 2WUWE 4E30A 5LIRA 2DPLA 5EQFA 1NMXA 4YNBA 2AZDA 5KC8A 3UAZA 2ZAGA 4MQUA 1ZNYA 4LNAA 2MCFA 3Q0EA 1KXJA 2H5EA 2JGLA 1U7PA 1W5AA 2J6BA 1T4BA 3IE0A 3JYPA 3PP8A 2QV7A 4U3JA 4BLSA 1PZFA 1W7AA 5F9FA 1SC1A 4PPGA 3V9PA 3R5XA 4LRUA 2QRPA 2Z6AA 3LQ1A 4I55A 2BBSA 2J3HA 4BWYA 3KIPA 1EUCB 2W5UA 4RWZA 5FPHA 3HXLA 4CMJA 3R0VA 3R7WA 2GZ3A 2J4DA 5G4KB 3MWDA 3TRJA 1V2HE 2QSYA 3A6HA 2DX7A 4M0CA 4B40A 1PEYA 2GM3A 2PS1A 2QRNA 3C16C 4IDQA 2J67A 4ITVA 3MQ2A 1WAMA 4GYKA 4Z86A 4UD2A 4CZ2A 1DCTA 4MWGA 1CFZA 3DXXA 4V0KA 5A0FA 2A33A 3SDBA 2CUKA 5E2AA 3AG6A 3OP1A 3QU2A 3JQ6A 4QOGA 1FXSA 4KFUA 1Q0UA 4M9QA 2J31A 4PPNA 3Q7RA 1Z88A 3NV7A 5F9HA 3ITNA 5FBHA 2VZEA 2ICAA 2QTHA 3DUFA 1Q22A 5CDUA 4HGYA 4PFSA 3G2QA 4TXMA 2YNMA 4IINA 1J2RA 2E4YA 1UBKS 3NC1C 1L6RA 2E85A 2XYQA 4YI3A 4AVYA 2WJVA 3NM4A 3R3JA 1UBRS 1N75A 1QQ7A 2H2GA 1DXOA 2NPOA 4O4HB 2IHYA 4DGSA 1M73E 3CFYA 1YS1X 1RLUA 3G2KA 4KGXA 1XCMA 4MP6A 3RUDA 4BAZA 5JAIA 4BNKA 1UJ6A 2BR5A 3GFVA 5H7XA 5KNLA 2PSJA 4ODIA 4Q12A 1RBZA 2CJWA 4E5NA 1ZUWA 2AYXA 1VPDA 5F21A 1ZO8A 3PHIA 5AXDA 3WVNA 1BX1A 3M4ZA 4AKSA 1T9KA 3B89A 1F8UA 1Y6FA 2YIMA 2YMLA 3QWIA 3L0ZA 2QZPA 4GM1A 3ZK8A 4AZSA 3V8RA 3L4KA 3G68A 2F3QA 2KE5A 3GEEA 3N0RA 2C1ZA 3IXLA 5I9LA 2NQTA 1OZGA 4OL9A 3IUYA 1GPLA 4KPFC 1DIHA 2PX2A 1P0IA 5BWNA 1MB3A 3J81k 4XIIA 1EFHA 2X3UA 4WESA 4Y9TA 5FYQA 3W5IA 2XDAA 1A82A 2FW6A 3E84A 4B0OA 4EF6A 1UWVA 3FDZB 3FF1A 4D3YA 1E1DA 3REOA 3RW9A 1EH5A 5K4HA 1UXGA 2ZJAA 2J32A 3I01A 4YRCA 2GPAA 4RTNA 1DNPA 1Y33E 3ITEA 4FCTA 1MW8X 3HJCA 3HR4A 4D9EA 1J2JA 3IEIA 3K96A 1DQSA 4PLZA 4C21A 4HDRA 1HDRA 3UYKA 5ALUA 4FOLA 3BGOS 1LPPA 3INYA 4NENA 3KTOA 3OE4A 4H27A 1Z56C 3UTDA 5KYGA 3HA5A 1WABA 2GM5A 1QS0B 3QFTA 3V2HA 2XOEA 1EQ2A 3QG5A 4RAOA 1YOBA 4KTTE 1UMBA 2L69A 5JR3A 1SZJG 5JT1A 4WGGA 1A3CA 5DK4A 2WHRA 3EGEA 3ILSA 5EQDA 2BHRA 5WRFA 3TLAA 3AEQA 3ZXYA 3BWEA 1BDBA 1YDWA 3AETA 4O8ZA 4ZVNA 1IU9A 3WXMA 3F46A 3TH5A 1PZGA 4R9UC 1XZ8A 4NZOA 3R5SA 1GP2A 4C0JA 4HVLA 1P0PA 2R96A 5ADVA 2PUJA 3CR8A 1JIIA 2X4GA 3RRNA 3TKAA 4RHYA 4XWKA 5G0VA 2XYHA 4LBYA 4ZVQA 1WTCA 2GYVA 5D5PA 4BQSA 3FKSA 4KUGA 4B87A 1IOLA 3I05A 5BN5B 3F9RA 1WCXA 2H17A 3OG9A 2AUTA 3IHTA 3K0EA 5AKYA 5DLEA 1K4YA 2HKIA 3F97A 5FP0A 5LXTB 3FTEA 2AFIE 2VDQB 3FLBA 4OEHA 1N3IA 1SKYE 3ORQA 1K7CA 2NV6A 4ND8A 3IOCA 2PV0A 2FFQA 1VE1A 4HS9A 4ZPXA 1LQ2A 2H9YA 1OI4A 4AF7A 1C4WA 1T36B 1FNMA 1YR2A 4CKEA 3EF0A 5JWOA 2AJCA 1ZJ6A 2ZW9A 2VJYA 1GV1A 3M9XA 3G8AA 1NY6A 3ODGA 3UKOA 1EFRA 3HJRA 4P38A 5CDTA 4WN9B 3WLJA 3KOYA 1X7YA 1ZMXA 3JQAA 1KA9H 4Z4QA 3AHEA 4DHWA 1NMQA 2A58A 3C1UA 1O9BA 1TK9A 3IUEA 3L8FA 3OFSA 2Y1KA 4OI2A 4YC7A 1DP4A 1HOXA 3HKCA 4RSGA 4ENWA 3TNFA 1RSZA 4CNBA 1YZKA 3P0IA 1DHRA 3FYUB 3LQKA 3V2UA 1QHGA 2A14A 3ZV5A 3RVLA 1PTKA 2I0FA 1ZD9A 5BW4A 4EHBA 4MGKR 4IFBA 3WIEA 5LNK6 2OT3B 4CL2A 4IICA 2C4VA 1BCSB 1KJJA 4CF5A 2J9FA 2WG0A 2WJWA 3UJAA 1KWGA 3VC7A 3IP1A 2E2WA 1YMVA 4R5HA 1KVRA 5LA6A 5CYOA 1K8RA 4RX1A 4S0ZA 5JD4A 5FFMA 1EBFA 1JG1A 4FMCB 1SY7A 2X3FA 2Z4RA 5ADHA 2CWDA 2Q7XA 1VA4A 1WVMA 2JAWA 1C81A 4W1QA 4MV7A 3KSBC 3ZDDA 3PT5A 5A1TA 2JLYA 1YB6A 2D1QA 2KMLA 1AM4D 1DJLA 1RJEA 3GGCA 3B8HA 3A4VA 1CKEA 3D6HA 1FLDA 3P9IA 4ALMA 1QWSA 4ZCIA 2JF0A 4KHZA 4XRRA 5CJ2A 4IDEA 4LGVA 1MPXA 3JQFA 5KDLA 2JGMA 4QUIA 2GLUA 2R8XA 4DABA 3L6BA 3IULA 2GK3A 3A6PC 1ZONA 3BCRA 3ZCUA 3CX4A 2PRJA 3DA8A 3K2QA 2IHVA 4HAXA 4GKAA 3WGJA 4JYZA 1AMNA 1G4UR 2I2FA 1OLSB 4JQCA 1E9EA 3T6KA 3QUQA 4RK5A 1K92A 4J6FA 5JYCA 2OD7A 3OKAA 3QPCA 3G0BA 3ZE2B 5EUMA 3X2SA 3VUFA 3T0FA 4BGUA 1XKTA 3O4JA 1W85B 1FEZA 3ROXA 1M1UA 4MHOA 2Q3BA 3R44A 4H31A 4RD3A 1QIKA 2DEUA 1WS6A 5KJ6A 4HWRA 4I3HA 1JIXA 3Q9LA 2BGNA 4N5HX 1XQVA 3W2HA 4C2BA 4M87A 3FRHA 5EGSA 4C6SA 1YB1A 4HL6A 1GKLA 5A4JA 4DDVA 1F4VA 2EOAA 4PYJA 2WKSA 5BOSB 2I80A 1XMQB 4D3SA 1TCUA 4EECA 3LUKA 4EATA 2JFQA 5UKDA 2IHNA 3VJRA 1NG9A 3A4IA 1LCIA 3TIVA 4WCFB 4G8BA 1VJGA 3D3WA 3NHKA 1DC7A 3G5TA 4I0WB 1PEDA 5ALJA 1U8ZA 2IJGX 4KDEA 4E08A 1TVEA 2P62A 3RVOA 2G76A 2WB4A 4UPDA 5L9AA 3TLYA 5COAA 4ZO8A 1HDOA 1ORWA 3CE6A 3O7WA 4O4IB 4K6HA 5LR6A 4Y67A 3AJEA 4JQZA 5IAOA 4HQ6A 1RE1A 4E22A 3AFOA 1L4NA 1LVGA 2Q49A 4DUPA 4HDMA 4MRMB 2Q9CA 1Z4PX 2IF2A 3I2KA 4TMZA 2REBA 3VR3D 4OBEA 1GG9A 3OAAD 1AK1A 4UNRA 1M2NA 1Y5MA 4M9SA 4XYMA 2NVUA 2HQOA 1EVLA 1Y4ZA 2J0UA 3T4PA 2IY9A 3FPKA 1C7EA 1FDOA 3ZXXA 2G9ZA 1P1CA 2ZPUA 4QVKA 3SHQA 1FFDA 3MJVA 1AKVA 5TVKA 3S2YA 4UNIA 4KR6A 1WHTA 2V74B 1KY2A 1U04A 5DM70 1JA1A 5AT1A 1GGVA 4J03A 3DTVA 5FPKA 4HVAA 3S3TA 1DBRA 5EYPA 3GLFE 1X1EA 1GNVA 3JQPA 3Q5GA 5JQGB 4ABTA 3DFMA 1FXUA 2PS0A 1MTOA 4UM8B 5JAUA 1WZIA 3PRJA 1QV6A 2LUOA 3GJ4A 3AT1A 2PQMA 2CVOA 3K0FA 1QZXA 1LNZA 3OJ0A 3LD9A 4XUCA 2C7QA 1HR0B 2EP8A 1SOMA 3UGQA 3LVFO 1A5SB 3ND7A 4UZSA 3E9CA 4ZU3A 4ZI7A 4EI8A 3I5YA 4DLAA 3RRZA 2PZAA 2XA1A 2WM9B 1JYFA 5HK8A 4QQFA 4ZAVA 1QV9A 3UV7A 1CDDA 4HNUA 1E1RD 4PRKA 5KIAA 2OHFA 1Q74A 1NXTA 1S5PA 1JHRA 2YOGA 1J4AA 3AP1A 1X1QA 4Y2VA 1N2SA 1BXKA 2FVXA 3DLAA 5I4IA 2QPTA 2AOUB 3GIWA 2E5FA 4BLVA 4DC0A 1WA5A 4KWEA 3DZFA 4U3JB 1TZMA 2YFQA 5IFLA 4DSZA 4IX9A 5LD2B 3CXRA 5KWJA 4RY8A 1JDBB 3DVSX 1ECBA 4EY3A 3ZIDA 5FR1A 4B3MB 3ZWYA 5JO9A 3T5BA 4GRAA 3ER8A 13PKA 2RGYA 3KPJA 1CS0B 3LUDA 3LT0A 3DT6A 1EUCA 2XD9A 3PLRA 4QT4A 3BFKA 5IJWA 1O54A 4J4HA 3PUZA 1XVUA 3W3AA 2YXEA 1ZIPA 4JK3A 2AR9A 2FPIB 3B6KA 4JENA 5HF5A 3F5QA 2IS1A 3I09A 2IVFA 1YJBA 4YMWA 1O2DA 4G67A 4AB1A 4JB3A 1VL2A 3JZMA 1F0NA 2VAPA 3DNFA 3V1UA 2C9OA 4NWIA 2BFDA 4QM6A 3HZOA 3OIWA 4Z49A 1U31A 3HWX1 4HQLA 2GXUA 3NHPA 2A67A 3SJCA 1KFKB 4D8TA 1NX9A 1TAQA 2VEDA 3P0FA 1GAEO 1GPDG 4V02A 4GUAA 3VR1A 2W2QA 4KFCA 3TG8A 4EB6B 2JH8A 1ZITA 4B74A 5GZ3A 5A02A 3EHEA 1M54A 1UOQA 3AW9A 4JLBA 4HY3A 1JRLA 1M1XB 4GOND 1PJ8A 5EIXA 4PLFA 3WGIA 2WKRA 1HYGA 4ZVTA 2OCIA 3ZHYA 4H1UA 5KYYA 2AJBA 2HJRA 4RF3A 2ZTSA 4ES6A 1CIVA 3OZEA 1YZUA 4JT9A 4N3NA 4EB0A 2VH5R 1XD2B 3WTCA 1WSAA 2QLTA 2OCDA 4UHCA 2RARA 2CNLA 3ER6A 1VIAA 1XZEA 2JRCA 3HPQA 2I9KA 2FAXA 1YBVA 4DMLA 1TC1A 4YUVA 3DBOB 3E3AA 1VE3A 2HRDA 2XF8A 2JZOA 2FPKA 4TQAA 1GILA 4CU2A 5I48A 3QFFA 3VX3A 2C4HA 2VAVA 1HZZA 3GV0A 2K2QB 3IP6A 3L7LA 4Q6BA 1FS6A 1JTEA 3FCUB 4IILA 3ABRB 3M4XA 2EWMA 3R9IA 3PNKA 3TRKA 1LSJA 5AK0A 4PX2A 2KPOA 3L7KA 4ENVA 5JAOA 3FE2A 3U7HB 2ID4A 1BCRA 1PWEA 3FDZA 3I6IA 4R54A 1G21E 2ATIA 5B3JA 2BDUA 4HNRA 5KOJB 1F2UB 5CVVA 4TMXA 1CQPA 1LU9A 4QUEA 2OORC 3C70A 5FFFA 4TVBA 1E64A 4C7XA 4H2DA 1UEJA 2FPWA 2Q0SA 3T41A 2DB3A 2G7ZA 1TQ2A 3K0CC 3O8LA 1AKYA 4UPVA 4I08A 2YZGA 3RLIA 4E09A 4CEIA 1FP1D 3VGJA 3IIMA 3DPSA 5JXWA 1URPA 3E1SA 2JCGA 3DVQX 2NZ2A 1PJBA 3P96A 4LMPA 4PYOA 1L8QA 4YJ3B 3K9FC 4R40A 4IX1A 1LF0A 1ZOPA 3KXKA 3UJPA 4Q66C 4C07A 5HMLA 2VWHA 1E94E 3JU3A 3NHUA 4QU5A 2H3EA 1B00A 5DLPA 4UMEA 5ILOA 3AQIA 1YZGA 2XQFA 1XBTA 4CV2A 3DQZA 1H3NA 4EY5A 3L04A 3SYKA 3UAWA 2IQIA 4BKQA 4I2NA 3H87A 4BEWA 1N2CA 3RRYA 3BT7A 3MXTA 5FI5A 1VGQA 3GEGA 3GO4A 4R7GA 4K2AA 3IUQA 3PWTA 4G9GA 1E3EA 3IUMA 4BJ1A 3EXHC 1S7CA 3N0VA 3KKZA 3O0DA 2PSSA 3ZNQA 3THYB 4GD3Q 4TM8A 1RLOA 4AKGA 1ZN9A 2HLPA 3T5PA 3ETHA 1EVZA 2QTVB 3MTQA 1W30A 4QG3A 2O2DA 1H2YA 5LP6A 2RIRA 1MHTA 2WV9A 1CR1A 2OBLA 4A03A 3UA3A 4G4GA 1E7WA 1YGPA 3G8YA 5B58T 4EEXA 2I34A 3U3DA 1U7DA 1PQ4A 1JDSA 3PD1A 2P5TB 1SXIA 4MWEA 3FWKA 5HF8A 2E48A 2AHRA 2MSNA 1PBNA 2H16A 4MA5A 3UUEA 1PTJC 1I33A 1S3FA 2IXBA 1XE3A 4C87A 1I3MA 1U8YA 2GI4A 1N77A 5EZYB 2XJ9A 1PKXA 1ZEMA 2QR2A 4XIFA 5LQJA 3G13A 3JY6A 4X6LA 4G5RA 4MUFA 4FFLA 3HKCB 2GZSA 5JSHA 4TRRA 1NAIA 1GCAA 3KAPA 2JLZA 3WWYA 3AI2A 1XF9A 4CF6A 3BULA 3TLJA 4C2TA 2FZ5A 2AV6A 3FGOA 2CXXA 1JHOA 1NR7A 1VLVA 5AKEA 1GG5A 3L82B 4MIEA 5AK5A 5DHAA 3SDSA 1UAAA 5GJVC 4G65A 1KI1A 1YR9A 2Z2XA 1UBTS 1ZC4A 2GCOA 3HP1A 5C8YA 1E3TA 5A4AA 1VLLA 5LPNA 1BWRA 2HRBA 2ONKA 4LZNA 4WDRA 5T3UA 4CIXA 2AN5A 1UJCA 4ENRA 1KVQA 3K6RA 5LA6B 2J08A 3D6UA 3QI7A 5I7HA 3GVIA 3N6RA 2VJMB 3ZGZA 3KVNA 2IPLA 4FFMA 3IT1A 3SF0A 1W5TA 5G0SA 1WKVA 1NP3A 1NPTO 3TZEA 2YV2A 5B64A 3VYTB 2R5NA 3ETJA 2O7RA 3SZGA 1FRNA 3T4UA 5IF9A 3E9QA 4QYSA 4MIKA 3F1LA 2BGMA 4KPUA 5DWDA 3TAHA 4EJ2A 3NHJA 4HP8A 2BFCB 3SLRA 2P0EA 3H19A 3ANSA 4I8IA 3B1YA 4OP3A 1QRAA 4MZDA 1GTSA 1Y3HA 4MV6A 1ND5A 4H3SA 3VOTA 2YDYA 3NUGA 5J63A 1ZK2A 3FMOB 3W9UA 4RTLA 1KDPA 1TM5E 3HUUA 2VDUE <