1U8ZA

Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
168
structure length
165
Chain Sequence
SLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Ral-A
publication title Crystal Structures of Ral-GppNHp and Ral-GDP Reveal Two Binding Sites that Are Also Present in Ras and Rap
pubmed doi rcsb
source organism Saguinus oedipus
molecule tags Signaling protein
total genus 61
structure length 165
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u8zA00
1UM8A 3K0FB 5CIWA 3SJZA 2Q9BA 3B6EA 4TL8A 4PX9A 3EZ7A 1NSTA 4FI3C 1YZLA 2H1LA 3F0TA 1WMSA 3GEEA 3MMPA 1EFHA 1W5SA 2RMKA 1CS4C 4A0RA 4B43A 1T4GA 1T91A 4LSGA 4ZI2A 2O52A 1KGDA 2A9KA 3L0IB 3U7HB 3THWA 3CX7A 4RFSA 2HLDA 3GMTA 1NBME 2WMOB 3VAAA 3PENA 1U8YA 2PBRA 2VLIA 1KI9A 4HLCA 5DI3A 3WY9A 2XXAB 2IWRA 4QHSA 1XNJA 3THYB 1CR2A 5FI1B 1E2IA 1OFIA 3E5HA 4JVMA 4GOKA 1KO1A 2J41A 1OB5A 5KNCA 2BJVA 2KSQA 2A78A 2BBTA 1H8HD 2J0QA 5K8TA 1R0YA 4OBEA 3GLGA 1JR6A 4TYPA 1NKSA 3RLFA 3W8NA 2ZSAA 1EGAA 2FPMA 5J4YA 2OAP1 2BDTA 3RRNA 3W3ZB 1SXJE 1M7HA 1XEXB 4EKDA 3REFA 4Q21A 2JA1A 4TL9A 4B35A 2O8CB 2EFDB 4OK3A 2WM9B 1RFLA 2ZE6A 2C78A 3FDIA 2IC5A 1JEDA 3GJ4A 2ZI6A 4Q1CA 4N1AA 2AD5A 2ZJ2A 3IHWA 2FF7A 3RWOA 1N5JA 4C9BA 3A37A 3TH5A 1X3SA 3K8YA 1W0KD 1TEXA 3OFND 2Z6VA 1W36B 1KSJA 4ZCLA 2WPDA 4LBZA 4QNMA 2QTFA 4ZKDA 4S2EA 2A5GA 2RKOA 1W0JA 1UAAA 3VMFA 4HSEA 4PC1A 3NIBA 4K81B 5JJIA 2QSYA 4KYIB 3ZVNA 2IS6A 3IEVA 1DAEA 4DUGA 2DHRA 2REBA 4IFBA 4PC7A 4F38A 2PEYA 2RH5A 4D4MA 5GJWC 2D2FA 3HJNA 5IHPA 3X1XA 2YOFA 5FPKA 3FMFA 4S35A 3IILA 4OQLA 3WRXC 3MFYA 3GJ0A 2ORIA 4DSOA 1SKYE 1P73A 3R9XA 4GI7A 2WHXA 3ZZUA 4D4KA 1E6CA 3OESA 1GRQA 3K0AA 1N0WA 3UATA 1NVVQ 4A15A 1QHGA 2GKSA 4A2QA 5EJEA 1SVOA 4W5WA 2OBLA 3TBKA 1FQJA 2XNDD 4DWJA 4HATA 4MH0R 2C04A 4C7OA 1OIVA 1GG2A 1OSNA 2ONJA 1F2TA 2VHCA 1RYFA 3CR8A 1CJVC 4Q01A 5GJBA 4Q1FA 4AYXA 1RC8A 5AR1A 3CRQA 1AQUA 2BHRA 3IHLA 2ZS7A 4YMVA 2QBYB 1ZMXA 2IYTA 4D6PA 4YMUA 1DADA 4LJ4A 4HB0A 4TYYA 2SHKA 2ZRHA 1W46A 3KFVA 4FCVA 4QJ3A 2ZRBA 2YC2C 4PQFA 3KQUA 2ZR7A 3WP0A 1E3MA 2FOLA 2QAGC 4NCHA 4B48A 1W0JD 3RS0A 4Q4HA 2PX3A 3PR1A 1XEWX 2GTPA 2QU8A 1XPOA 2WSSA 3B1YA 2ZI4A 3ZDQA 1RIFA 3RHFA 1ZIOA 4LHWA 1U9IA 1RVDA 5L3QA 4FMBB 1ZD9A 5FL7D 4HLUC 1TU3A 1QVRA 2QG6A 5B2ZA 3Q72A 1QVAA 1QG2A 1S4QA 1UADA 4LYAA 2D7CA 5JEEA 2GCOB 3T12A 3QI2A 1NIPA 2F3RA 2BKUA 3BH6A 3TLXA 3IDQA 4TYQA 3NHAA 2IBMA 4FMCF 1P62B 1S96A 4WZ6A 2HF8A 1E2PA 3TRFA 4ZDKA 1VCIA 3U4QB 4YMSA 2HV8A 1Q22A 1YU9A 1Q0UA 2QN6A 1IXZA 3MUFA 2V3CC 1BYUA 4LDJA 4C0QC 5KOYA 4G0NA 1MO4A 1VECA 2R44A 5A4JA 5H68A 1XCMA 3P26A 3RC8A 1G9XA 1MABB 4B3DA 5A0FA 3N2EA 5FOUA 2BEJA 2QROA 3AGQA 5SZKB 1BOFA 1ZNZA 2WZQA 1ZVQA 2E1RA 3FWYA 1S9HA 2RGGA 5CYPA 1G19A 3KUCA 5J5CA 1TADA 4B76A 4JBYA 1TUEA 5FOVA 3ZH9B 1NKTA 1XTJA 1OJLA 4JJKA 2YKGA 5C1BA 3QQ5A 1N6KA 4M9ZA 5JJLA 1G5RA 1W4CA 1E2JA 1A2KC 2J7PA 4ERNA 1N6OA 4EQ6B 4C0BA 2F1IA 2ZE8A 1KK2A 1G3MA 1P5ZB 2V8OA 3IIKA 1DO2A 1AZSC 3PG5A 4JLJA 4BZXA 4U7DA 3TMKA 4Y0VA 1E0SA 3B7GA 3Q85A 1U99A 1Z07A 4LPSA 4MQBA 1W47A 4DRZA 4CGZA 2E87A 5F9HA 4GRAA 1ZD8A 2EFCB 1F2TB 2DFTA 4I1OA 4P32A 1BYIA 1QHHA 2YWHA 2ZANA 5E95A 4H1UA 4AYWA 1N6NA 3OEHD 1G8GA 1V5WA 1TL7C 4Q03A 5EP1A 3K70C 3NC0C 4PXAA 4D80A 3FKSD 2DWPA 1GNQA 1ZM4A 4E22A 4PO9A 3KQLA 2WJHA 2DBYA 2ODNA 3VR2A 1HQCA 1ZU4A 1TU4A 3RANA 1T0JB 1DE0A 1P2VA 1KO5A 4Z1MD 1T3HA 2QQEA 1E2GA 2WVJA 2BJWA 2ZJOA 3ZLJA 3QSYA 4KI0A 2BKEA 1KSHA 3SHFA 2A5JA 3VQTA 2P6UA 3T15A 4V02A 2B92A 2IT1A 2JLWA 3ZS8A 1I4DD 3UMRA 3AH8A 3KKOA 2BEKA 4ZPXA 2JGNA 2DPXA 1D5CA 2OESA 1M74A 3EIHA 2ATXA 1YRAA 4HZUB 2XB2A 4RKEA 2RGBA 4L4UA 3QF4B 2B7CA 4A0GA 3LDAA 1BH2A 4Q1DA 2CDNA 3CPHA 3FYHA 3AVWA 4KSCA 2ZSFA 1TUIA 2O0JA 2OBNA 3RWMB 4JIMA 4M1SA 3HYRA 3VNUA 3WYAA 1HT1E 1K5GA 2X19A 3B85A 5FTNA 4CEIA 3AVQA 1YE8A 2UVQA 1Q20A 2WWIA 4EQ6A 5KPDA 2ZJ8A 2PZFA 4P4SB 3KJIA 3NH9A 1W36C 3A1SA 2NO7A 2CK3D 3N2IA 3K0AB 4P4TA 2ZETA 3FVQA 3AV0B 3MRSA 2AK2A 2RGXA 2R6DA 2X2FA 3REGA 2IS2A 3TSZA 2YJTD 2QUZA 2I1VB 2Q3HA 1E32A 4YONB 1A5TA 1KNXA 1KI6A 2TMKA 2ECKA 2J5XA 2V9PA 4J0QA 3B1ZA 5FPHA 2ODEA 2BVNA 1T5IA 4QL3A 1TEVA 2QBYA 2AFIE 2ZVPX 2DYKA 2IYLD 3QUSA 4WVFA 4CEHA 3O8CA 1NL3A 3BS4A 2WAXA 1OLOA 1R5NA 2ZYWX 4RCZA 4B73A 1V43A 1JQJC 1AZTA 3GFPA 3K9LA 1Z29A 1VDZA 4JT2A 4KYUA 4QJ4A 1FZQA 3DMNA 1AS2A 2ZU6A 2REOA 2BBSA 2FFQA 1GZSA 1WCV1 1EFUA 3M6AA 2ZM5A 1N6HA 3NWJA 2VYFA 4IEIA 4JJZA 2ZRDA 3AGPA 3TVDA 4WIAA 4Q4JA 4DIEA 3CF2A 4AI6A 1FL9A 5DI9A 1OF1A 3VTKA 3GJ7A 3KDSE 4TMWA 3AM1A 3KUDA 4GSYA 4AWXA 1UKVY 2WPDD 1MH1A 3BXZA 3CNNA 3M0EA 3E70C 1GM5A 2VSOA 4U00A 5KO2A 1KJZA 2GEDA 3KZ1E 4AG6A 4DEYA 4DB2A 1WRBA 4LV5B 4HLUA 2B21A 2V54A 4MGKR 1G16A 3B9QA 3GEIA 1KTVA 1F2UA 2FEOA 4MYHA 1SXJB 1VCNA 1XMIA 2F9LA 4Q1EA 3T5DA 5CJ2A 1ZM2A 3OE7A 3QKRA 2VP6A 2WV9A 4LCBA 4M9XA 1DAHA 2DR3A 3RS2A 1OFUX 4CEJA 4MITA 1JNYA 3QEOA 2WSSD 1U0JA 1IXRC 2CHGA 2WJGA 1C4OA 3CF6R 3E1SA 5KDDA 1CF4A 4WAUA 1TX4B 1R2QA 1N3BA 1N6IA 4OQXA 1T5LA 5JFGA 3PUWA 2NTYC 2NG1A 4RZUA 3LXXA 3TUIC 3B1VA 2OUKA 2BM1A 4ZCMA 5LPNA 1KDRA 4WA7A 3QKTA 4AY2A 1TQ2A 1QHNA 3NDPA 1S9DA 2D4HA 3EWAA 3VHLB 2IYWA 5CM8B 4Q4HB 4URYR 3C41J 4BRUA 1RZ3A 2BMJA 3THXB 4POAA 2F43B 4IOLA 4LI0A 1QHSA 4N0EA 3RS4A 4NCJA 3MCAA 3GD7A 4Q19A 2ZQ5A 3QVVA 3EARA 4LHZA 2Q6TA 2ZJAA 5EE1A 4AKHA 3QEJA 4U5XA 4R71A 5F2EA 5FUXA 3EPHA 1FX0B 4LK2A 4RKFA 3SQXA 2F1RA 4KO8A 1E79D 4A92A 5FBVB 2O8DA 4NYMQ 4WXPA 4P3YA 3ZIAD 5JSZA 3KL4A 2D7DA 1IJEA 3KKQA 2J0SA 2H16A 4I99A 4CT5A 3C5HA 1WBDA 1E4VA 4YLGA 3DVLA 4JL8A 2V55B 2XX3A 4KJZA 3ZD6A 3NG1A 1Q1QA 2ZVQX 3BC1A 2R62A 3F8TA 1XJQA 1NVWQ 1OXSC 3QKSA 4QHTA 2GBLA 4Q5IA 1WA5A 3O8BA 4JLDA 3T34A 1IJFA 2HCBA 1UKZA 3OIVA 5JI3E 3UMFA 2J1LA 2VPPA 4LJ5A 1LV7A 2MSDB 4IDPA 4XVQA 3N5CA 721PA 1YZNA 5J4KA 1LS6A 4G5SA 1GWNA 2GF9A 2G3YA 4L15A 1MRSA 1HUQA 2J59A 4BFXA 1VCMA 4OHVA 2W0MA 4LHXA 3L8YA 5G3YA 4P31A 2FSIA 1T3LA 4Q4AA 1KK1A 1E98A 1N6LA 1DO0A 3OIYA 4JYBA 1SXJA 4FCTA 1W44A 1RJ9A 4UJ5A 5CB8A 2KI5A 1JPNA 1NN0A 4ESVA 1X8JA 1R0ZA 1RRPA 4JKIA 1E1QA 4MKHA 4ON9A 4JVSB 3T61A 2MMCA 2HUPA 2WWGA 1P4SA 4DVGA 1L7VC 4DDUA 3THWB 4C2UA 4CEJB 2ZUCA 3FTQA 1IXSB 4XIGS 2O0HA 3TE6A 4C0JA 4DSTA 2IYXA 4EJSA 5F9FA 5DNYB 4IOJA 4QFMA 3RRMA 4EAQA 4G5QA 4XWAA 4FIDA 2QAGA 4GZMA 2P0EA 3WMGA 1TQDA 3RS7A 1K5DA 4C3ZA 4H1VA 5AUOB 3V9PA 2OFOA 4IDOA 1G18A 1FW6A 3A36A 1M34E 1Z6GA 3QPUA 4XVUA 2O5VA 2QE7A 1CU1A 1I2DA 1QF9A 3GLHA 4BLTA 5KNBA 3DL0A 5K8UA 1XEXA 1J99A 1N5IA 1WP9A 2CK3A 1E2KA 5TV2A 2BOVA 3EXAA 1NMYA 1UEIA 1NVVR 4B3BA 3HU3A 2VEDA 4B71A 3EZ2A 1XTRA 4ASUA 2CHQA 4JLMA 1Y3AA 5FTJA 1J90A 1Z2CA 4M4SA 4FINA 3FHCB 4JLVA 3EPJA 3GJXC 3VX4A 5H70A 4TZ0A 5EP4A 4JLNA 3IUYA 2OZEA 3T1QA 4MRPA 2J87A 2V6JA 3SC3A 1KZGB 3BD9A 5EXSA 3GLIA 3QF4A 2C99A 2EYQA 2LWIA 3GP8A 2P5SA 3LQQA 2GJSA 3M4YA 4RFVA 4XJXA 3BE4A 4BECA 3GJ5A 1EFCA 2GETA 3EZ9A 4FMDF 3CR7A 3AQ4A 5EE9A 5FR2A 5IK2A 3I1FA 3CNLA 1B0UA 4QBFA 4TYNA 1K6MA 2HLDD 3AP1A 1Z5ZA 2ZR9A 4LBYA 5AWFC 4EFNA 3EPLA 3OZXA 1E9SA 2RGAA 2PZEA 4KVGA 1MRNA 5KYKA 3WBKA 2N42A 5KPJA 1XMSA 5E7JA 3GLIE 3AVXA 1IY0A 2CHVA 4NE2A 4RD4A 2ANBA 2Z4RA 5JLJA 4OI4A 5FOXA 1Z28A 2OCPA 1KJWA 5TXGA 4EUNA 2W00A 2QQ0A 4RZ3A 3CKLA 1ZAKA 4OK5A 3W5JA 3AUXA 1P9RA 2G6BA 1HURA 2P6NA 4TLCA 4B2LA 3GPLA 3IPXA 1W1WA 4X8OA 4E09A 3LV8A 3IQXA 1IN8A 3EA0A 5LD2C 1G1MA 4TYWA 2KE5A 2ZRJA 3DO6A 3BBPA 3NVAA 3I32A 2W2XA 2O8FB 2GRJA 2REXB 2DWQA 4URZR 2AN9A 5FUWA 3NC1C 3QPWA 4X8MA 4LY6A 3PUYA 4O2LA 4YXWA 2AK3A 4E07A 5SZJA 2W6JA 4RD2A 2VO1A 1W48A 2V7QD 1N6RA 2V1XA 3KJGA 5EE5B 3NKVA 3QBTA 1RRGA 4LUCA 1LTQA 4O0MA 4AD8A 3VNVA 2R2AA 3NEYA 4A0HA 1BMFA 4IVQA 4D0NA 1DVRA 1VTKA 4NONA 2YYZA 2EFHB 1YVDA 2QP9X 4UKDA 4NL4H 2WKQA 4LC0A 3I4LA 1NIJA 3ZZTA 2XGJA 2XNDA 4OHWA 1SHKA 2H57A 4C30A 1A1VA 4D0GA 5J4LA 1OV4A 2IUTA 4Z8XA 1E9EA 1HY3A 1W4RA 3DKVA 4CYMA 5DN6D 4D2IA 4M9QA 2GA8A 2WTUA 4RD1A 2R8RA 4ITRC 3B2EA 1GDDA 1FP7A 4ILEA 4A82A 3OE7D 4PQRA 5EUMA 2YOGA 4P33A 4IEEA 3MWYW 5C18A 1KDPA 3C8UA 4QOSA 5CB6A 2GILA 4Q7JB 3Q7QA 4QGGA 221PA 1NG9A 3LY5A 3VX3A 3WNBA 5IF9A 2G1JA 2GJ9A 1NNEA 3B1WA 2WWWA 1PLLA 4V0MA 3DOFA 2RGCA 2IA5A 4MDFA 3EAQA 4Q9KA 3EIEA 1UFQA 1SGWA 4UXJA 4B75A 1OHHD 3G0HA 2ZUDA 4PHFA 4ABYA 5D3MB 2K5UA 4U02A 2GK7A 1BKDR 4XTCS 2JASA 2FV8A 4N0DA 3ADBA 1IN5A 2W58A 2G0TA 2C96A 2RGNA 2WICA 3PVSA 4XWOA 1K8RA 1VG8A 2VHUA 2ZITA 3PEWA 1P2TA 2WOJA 4NH0A 1ZC4A 2OXCA 1KK3A 1NY5A 1QHIA 1COWD 1Z6YA 2W0SA 3K53A 4XH9B 2Q9CA 3R8CA 2ZSBA 2RGDA 3RVBA 4PZZA 2JLQA 2QRNA 2FMXA 2W2TA 2YVUA 2GAAA 4OQMA 5CLQA 4MGZR 1UKEA 3PITA 1EX6A 1TF7A 3CZQA 4R7ZA 3PXGA 2ZYVX 2FJUA 1NRJB 4M8NE 2ZR0A 2JLUA 3S1AB 1DBSA 4D82A 4UNRA 2HXYA 2VIIA 1EX7A 4XD7D 2FX3A 2GBLC 1DOAA 2QRZA 4K46A 3TNFA 4US0R 2HCJB 5GJCA 1AS0A 2D62A 5JWRA 3THOA 4XSHA 2OEPA 1YR6A 3I5YA 1L2TA 2JJ1A 3F3YA 3C14C 4JT4A 2VBCA 1JR3E 3QENA 3GEHA 2OFXA 3EZ6A 3KTAA 3FGNA 2V1UA 2JLVA 2WAYA 4B2PA 2NZ8A 2F55A 4A2WA 2ZRLA 4BFWA 4PTLA 2OFWA 2O8CA 4GP7A 4HLQB 1JQLB 1G20E 1DG1G 3TGPA 2C8VA 1NN1A 2GESA 2J3EA 3MWJA 5L8VA 3K0EA 2IYZA 1OIWA 1YRBA 2AKYA 4KCGA 1LF5A 4M1OA 2ZI5A 2R6AA 2ZRFA 1KKLA 5LB2A 5AJWA 3SEAA 3H2YA 4BLQA 1ZCAA 1WBBA 1T3SA 2C9CA 2PLFA 4HDCA 3RYTC 1G7RA 2XTZA 1JXMA 3BERA 3UKDA 4GZLA 1AJEA 1CEEA 3LRPA 2PCLA 3MWLA 4LJ7A 3SZRA 1C1YA 4F92B 1CBUA 4ZKEA 1GL6A 2ZE5A 1AM4D 2A3RA 2P6RA 2C9YA 2ORWA 5JRJA 3ADDA 4TN1A 5B64A 2R65A 4Q1BA 1IY2A 3SBEA 2OG2A 3SJAA 5EQTA 5KTYA 3WHKA 3FMOB 3ZYCA 1VPLA 1E1RD 4JLPA 2FG5A 3AF3A 2CJWB 4MA4A 2PJZA 1MO3A 5BYKA 3VKHA 4YC7A 1FNMA 1OHHA 3AVPA 4R9UC 4BZQA 5ELXA 2WWHA 4MRNA 3QVUA 2QAGB 3BFVA 5FL7A 1YZKA 2FSHA 1XF9A 4N3NA 1OT3A 5CDFE 2BMEA 2QA5A 3MSXA 4TQUS 1AQYA 3TAUA 3RDPA 1Z83A 1N5LA 1TNDA 1XZPA 5HZHA 4MKFA 4HAUA 3CH5A 3UMSA 4BLOA 1KNQA 1RE0A 3TW8B 2WJJA 4GL2A 1IBRA 4JLBA 3UPUA 5FBWB 4DT1A 1HQYE 5DI3B 2WKRA 1JBKA 4GPTA 1KI8A 3AKEA 2QM7A 4JSYA 1M1YE 4UNPA 2RHMA 2A5YB 1OFTA 1VYVA 3A1UA 4DLYA 2MSCB 4TMXA 1KO4A 3A1TA 4LPKA 5TARA 4IXNA 3ZVRA 4IOMA 4YDSA 1E2DA 2MSEB 2GZAA 1J70A 1KI7A 4HAYA 2HDNB 2IUSA 1AGPA 2I3BA 3KXKA 3OEED 4CZ2A 4DLRA 4PHGA 4KSBA 5IK2D 1OYYA 3BK7A 2OLKA 2PX0A 3AF2A 3GLGB 3B13B 2Q3FA 1IONA 1Q57A 1S3GA 2IF0A 3HPRA 1OH5A 1NN3A 4PQYA 3HP1A 3K09C 4PAQA 3PJRA 4Q9LA 5LDDC 2XAUA 3EX7C 4UXIA 5IT5A 5FUYA 3SR0A 2GEVA 3U44B 1A2BA 2BMFA 2JCSA 1UBGA 4I1VA 3LX8A 5CM9C 3CNOA 4Q00A 3QKRB 3VR6A 3SN6A 3TVTA 4IVRA 3MD0A 2IXEA 2ZJBA 2C2HA 2BBOA 1KMHA 1BO6A 1GTVA 5KSZA 4PPNA 4E5UA 4B3GA 5JHHB 4OHZA 3LVQE 1PLJA 2O8EA 1VYUA 1HA3A 1W0KA 1D9XA 1VHTA 2B7BA 1MABA 5AJVB 5M04A 1CJTC 2HJVA 3IEUA 4JSTA 3RAPR 3VHXA 5JS7A 3U5ZB 4HAZA 3H84A 4BQSA 4RZXA 2AWOA 1OH7A 4IDNA 4TLBA 5DHFA 3PV0A 1JR3A 2L0XA 1T6NA 2QPAA 4RFSB 4B47A 1FFHA 1QG4A 4KU4A 4NCIA 3W90A 5L3SB 5FPTA 2ZRKA 1ZUHA 3LO5A 4Z51A 4NHOA 1UJ2A 1TMKA 3SFVA 1Q3HA 4DXAA 5KU1A 2JJ2A 3TKLA 5FR1A 4DIDA 2G77B 3VU9A 2CMKA 1VG1A 2JDIA 1XD8A 2XSZA 5C2JB 2H92A 4LBVA 4DLZA 3O8RA 1JAIA 1W49A 1T8UA 1XXHB 2H7VA 4QJ5A 5FTKA 2ODBA 4A8JC 3A58B 3ZQJA 2Z4SA 3RSOA 4DCVA 3W8RA 1J7KA 2B8TA 2ZJZA 3HR8A 4KODA 1E96A 1HT2E 4AK9A 4EJSC 1II8B 4ARZB 4RSGA 2IXGA 821PA 2N1BA 2FE4A 5GJVC 5HZKA 3LH5A 2ZRCA 1E9FA 5HCNA 2V7QA 2FA9A 4BWYA 1FPMA 5EE3A 4TZ6A 1G7CA 5SZIA 2OM2A 3QXXA 1ZP6A 1OW3B 4Q1AA 1Z0IA 3VKGA 2OHFA 1P2SA 1Z6AA 4CIDA 4ZDIA 2GWHA 3UWOA 2XSZD 1TAGA 3P20A 4RY2A 4PO8A 3GLFB 4G01B 2VP4A 4WXRA 3K70D 3EZFA 4JL5A 4EIWA 3AVUA 3LWNA 3SOPA 4MYUA 2ZJ5A 1X1SA 1XEFA 2N46A 2QMEA 4LYJA 1FUKA 3QOFA 4D81A 3GJ6A 4D4JA 4DC9A 5F3WB 3PEVA 1JJVA 3A6PC 3Q7PA 1H65A 4MUBA 2ODWA 1MKYA 5TVKA 3FFAA 1OXVA 2GZDA 1G8PA 1WXQA 3B60A 4W9MC 4Q7KA 3LA6A 2GXSA 3L43A 2IYVA 1G3RA 3AKYA 1Z6XA 3A4NA 4CDGA 4B3FX 5FBLB 4NPHA 3CBQA 1F60A 4R2HA 1KY3A 4JVLA 2YV5A 1XPUA 2O8EB 4Q48A 5IRCD 1JB1A 2I4IA 2IXFA 1FP6A 1ZBDA 1FTNA 4GMXA 1E0KA 3MLEA 4NTZA 3C5CA 3WNCA 1S8FA 5B58C 1XTKA 3D7MA 1OKKA 4A4DA 2FSGA 5G3ZA 3TK1A 5F98A 4US1R 4D4LA 1LNZA 1M7BA 1KI6B 4B32A 1OH8A 2AXPA 4W7SA 2H17A 3OAAD 2KB0A 2JJ8A 4HZIA 5CK5A 1E2HA 5GVSA 2GDJA 4HUTA 1XJ0A 3AUYA 1DAMA 4AURA 3GFOA 2FWRA 2WMNB 3Q8XB 4HDQB 2A30A 3JZMA 3ZVMA 3SYLA 3SYKA 4Q66C 3J81k 5B57C 1PUIA 2BMDA 3X1YA 2QMUA 5L3QB 2C98A 5KSPA 4TQ9A 3TIFA 1DAFA 4B33A 2R6GA 2IS4A 3GLIB 5EZ6B 1Q1BA 1OYWA 1G291 3AVTA 2J0UA 2QL6A 5AJXA 5BXQC 2VF8A 1KK0A 1Z0AA 5AK0A 1KI3A 2PT7A 3LW7A 1OB2A 1GKIA 2VQSA 1S1CA 2PH1A 5DSZA 2QT1A 5TDHA 2X8AA 3LD9A 4NBSA 2P65A 4EPRA 3SI7A 2GEUA 4A0FA 3IGFA 3DKPA 5EZ5A 1HE8B 1A7JA 1I4LD 2W6IA 4IHQA 3LX5A 4HZUA 2FU5C 1RRCA 2FSFA 3U44A 2KJQA 2Z43A 3SJCA 5JMTA 4JBXA 3ASYA 4IXMA 3B9PA 1AN0A 1MO5A 4NYIQ 2CCJA 3BFXA 1FTSA 4NCKA 3U2QA 3CB4A 4MUAA 4PSKA 4OKSA 3BB4A 2Q9AA 3U7GA 2NPFA 4GOJA 1E0JA 1FMJA 2HXSA 2ZS8A 3CLVA 4FXPA 4HAXA 4IDHA 4HYYA 3ICQB 2WIAA 1LVGA 2HEIA 2A5FA 2AFHE 2VHQA 2DFNA 3AP3A 1KDOA 2ZSEA 1XD2A 1HYQA 4QGHA 5L3RA 3GLGE 3AEZA 3FPAA 1R10A 4DSUA 3QF7A 4G5GA 3HPQA 3QKUA 1IQPA 1ZYUA 2NO9A 2WIBA 4JVNA 4HAVA 4JYCA 1LB1B 4LBWA 4TMZA 1G6HA 3V4RA 4FMDB 3CPEA 1JECA 2P3SA 1D2NA 4PSVA 4UQOA 3SHWA 3LAWA 5CJPA 2GXUA 4FD2A 4QM6A 2QT0A 3I72A 1EFRD 2JATA 4YDHB 2J9RA 4F7WA 2CCKA 2CEAA 3K9NA 3P4YA 5H1YA 1IN4A 2D2EA 1ESNA 4QHYA 4JS0A 2IWHA 4DLUA 5CIQA 5FUVA 3SDZA 1G8YA 5EP3A 1R0XA 1H8EA 2RGNC 4MDEA 3SNHA 1IY1A 3U60B 3SQWA 1XXHA 2UZ3A 1KOFA 3QKSB 1Z08A 2CNWA 4OK6A 3EPKA 3GCGA 2XJ9A 2ZIAA 4ARZA 3D31A 3X1ZA 2OE2A 1I2MA 4LYHA 1Q21A 3U3RA 3FE2A 4M0LA 4YXWD 1R7RA 4LJ9A 5HCIA 2PMDA 1UF9A 3DM5A 4ACBA 3GJ3A 2XZLA 5J40A 4OJKA 4HLDA 5KDLA 2CLSA 2G88A 4M22A 3R7WA 1F3OA 1AGRA 2ZRIA 1VCOA 4LJYA 2PT5A 3EC2A 1A4RA 1ESMA 3MJHA 4LHYA 4G5RA 2VSXA 4QBIA 4LX0A 4DLXA 4XVRA 2A7QA 4TT3D 1G21E 4C4PA 1NI3A 3ETLA 1RJ9B 1W4BA 1X1RA 1GVNB 4TLAA 2XB4A 3I8SA 3I3SR 1P60A 4BUJA 5HPYB 2IW3A 5FPSA 4GOXA 1UBEA 4MYTA 1IHUA 2JIZA 5EXPA 4DUGD 2ERXA 1NF3A 5JHGB 2FH5B 2FFAA 5BQ5A 4Z54A 2KBFA 4XWKA 1SVMA 4C7OB 3CO5A 2JLRA 3BORA 2QEQA 2OCBA 4V0ME 1Q44A 1DPFA 4EJSB 1R0WA 3LXRA 2IEZA 2P67A 3WHLA 3ECCA 4XTRA 4A8JB 2QGZA 2WJVA 2GVZC 4MKIA 1R8QA 1MOZA 4NU0A 4WBSA 2ZS9A 4BFVA 2VHTA 5FTLA 4CEHB 2AL7A 3FB4A 4WOPA 3PCRB 2ZU0C 4DJTA 1QBKC 1XU4A 2WWYA 2ZJYA 3TSWA 3KFXA 3UIEA 5BN4A 3I61A 1JI0A 1U81A 4DB4A 1S0UA 1SKQA 2RAPA 4DZZA 5EP2A 2QGNA 5AUPB 3QPVA 1F5NA 4OQNA 2OO7A 4ESHA 5FI0B 5KUTA 2J7KA 3U3JA 4IW3B 4XOIA 2XTNA 2EFGA 2IYRA 1EWQA 3PUVA 1Y63A 4G5OA 3NDBB 1B23P 1M6NA 1E2EA 1Z6TA 1E2FA 3V4FA 2YWGA 4B6FA 4OHYA 4KVAA 5TMPA 1X86B 3CX8A 3UXMA 1CULC 1E2NA 2XOKD 3IQWA 5G53C 2IK8A 1E2QA 3UG6A 4B44A 4B2IA 5LD2B 4B6EA 1VG0B 2GJAA 3K9HA 1CJUC 1M7GA 2AD1A 2J45A 4Q7MB 1KSGA 3W6OA 2YOHA 1P9WA 3FOZA 5HE9A 1WF3A 4QRHA 3T35A 4B74A 4WW0A 1GL9B 3OAAA 3KXLA 2XOKA 4JKYA 3U7EB 4A6XA 1TQ4A 1T0HB 1XTIA 3Q5EA 1R4AA 2QM8A 3LQRA 1CP2A 1Q3TA 4KITB 4NYJR 4OI1A 4QBGB 1XB2A 3BH7A 2NZJA 1E69A 2ZEJA 1YZTA 2QTHA 3K0CC 2QP4A 5EUQB 2OILA 4KFRA 2ZREA 4KFUA 4A8JA 5B30A 1XEWY 2W6ID 1XDBA 1II0A 4JLAA 3RRZA 1G4AE 4FMCB 4II7A 1E94E 1UBFA 2ZRPA 3NH6A 2OCAA 4L9WA 4PPGA 3TW4A 1P2UA 3HU2A 5K8LA 1AKEA 4LC1A 1N25A 5LB4A 4HUQB 3Q5DA 4JLOA 5AJZA 4GMDA 5K8IA 1IOZA 1ZJ6A 2AWNA 5FOSA 4PC3A 1OIXA 4PR0A 2GJKA 1O87A 1W2HA 4C2TA 5CITA 1PZNA 2J46A 3EWSA 3QG1A 3I62A 1U98A 1YKSA 3LBIA 5TB5A 4V0KA 3L0OA 1Z3IX 3IO3A 2OXRA 2O8DB 3OEEA 4FWTA 3ADCA 1QDEA 1YR8A 1GSIA 1YR7A 3AF4A 3T1TA 1D2MA 3RABA 4JBWA 4QGFA 1SHZA 2IYUA 1GNPA 1COWA 2VHJA 2VP2A 4AKEA 1O3YA 3BOSA 4X8LA 2CNWD 2V4ZA 1G41A 4I1SA 4RCYA 3BIFA 4R98A 2X1VA 5FBQB 1J8YF 1NVUQ 2OV2A 4L8GA 3CWZA 3P32A 3CRRA 4PC2A 3AP2A 3IIJA 2IS1A 3TQCA 5DH9A 1IN7A 2G0NA 4ACAA 2RCNA 4URVR 3IPYA 4BFTA 1RPZA 2X77A 4DCNA 4YMTA 4TTQA 3ADKA 4F93B 2GJ8A 5JI2E 2JJ1D 1ZW6A 1EFRA 1F6BA 2F6RA 2XTMA 2ZAMA 3ONWA 3QJYA 4D0LB 3W34A 3QXCA 1UPTA 1JJ7A 1KI1A 1W2GA 4OHXA 4PZYA 1GUAA 4Q9JA 5ANRB 5FBRB 1R6BX 1VYTA 2JJ2D 5DE3A 2C77A 2EW1A 1N0UA 3FHOA 1HE1C 2OCYC 4Q4AB 2PL3A 1ODFA 2ZYUX 3L0PA 2GXAA 4MGYR 5FH9A 4LRWA 4DDVA 2NO6A 2BIFA 2F1HA 2DWOA 4LWZA 3H86A 4M1YA 2ZI9A 1G17A 4LV8B 5HKKA 1HH4A 2JDID 4LJAA 3X1WA 4LOAA 1XMVA 5DYGA 5E7MA 3LLMA 2D74A 3QXSA 4DCSA 4TSFD 3UANA 1ZUIA 2FPLA 2I1QA 4MRRA 2KBEA 4DBLC 3P27A 2GNOA 3D8BA 1C9KA 3NBZC 1LW7A 1UDXA 1EESA 1KSFX 2IYYA 1W4AA 4TSFA 8OHMA 2ASEA 3OIWA 4F4JA 5CYOA 1JEEA 1H8ED 1TF2A 2JAQA 1IN6A 2Z0MA 2O8FA 2CVFA 1OKKD 4KFTA 4M1MA 3CX6A 1UDWA 4LJ6A 2XXAA 5SZHB 1JAHA 2WWFA 1E9DA 2AX4A 3T06B 3AVOA 4DDTA 1GNRA 1SULA 1FUUA 3B8HA 3WRYC 1DTSA 2XNSA 1SKYB 2R6CA 2O0KA 3PEUA 4KXFB 3L8ZA 1Z8FA 3ZGXA 2CL6X 4OYHA 3VR5A 1D6JA 2F9MA 5JCZA 4DLVA 1YJ5A 3FHTA 2NO0A 1KY2A 2V6IA 3ASZA 4A6PA 5DGXA 2IYSA 1ONBA 1XXHE 1MT0A 3NTUA 2F43A 1P9NA 3QNUA 3R7WB 4DHEA 4KLZA 4ASUD 4Q47A 2B8WA 1TPZA 1XX6A 4M53A 5DN6A 1N2CE 1T8TA 1VKJA 4IRUB 3WYGA 3H4MA 2ZXUA 3SBDA 3TUZC 3ZJYA 4M21A 1PV4A 1G5PA 3DM9B 3NBFA 1ZM9A 4M9SA 1W36D 2PJRA 3NEJA 4GP6A 4TTRA 2EU8A 2QSZA 3OF5A 1D2EA 2GCPA 4HAWA 5AJYA 3X1DA 1M8PA 2QPOA 3U7FB 4MRVA 5EXXA 3KB1A 3QBVA 2A5DA 3IBGA 1KMHB 4MKGA 2RHDA 1Q1ZA 1PJRA 3ZVLA 5JRZA 1R5BA 3ZIAA 3IKJA 1Z63A 4KFSA 1RW4A 4M1KA 1XZQA 1SXJC 4US2R 4RZ2A 1U0HC 2NIPA 1OXUA 3TJZA 1P61B 3T1VA 2VH5R 2ZRAA 3KQKA 2CCGA 1NMXA 4Q18A 2VTKA 1I4TD 1ZNYA 4EPYA 1GKYA 4TWZA 5JS8A 1ZC3A 2BV3A 1NLZA 2WJIA 5CDFA 1P7CA 4DSNA 2G83A 4PC6A 3K70B 1IAQA 1G5TA 1XD2B 3P4XA 2PMKA 2XJ4A 2GAOA 3HYTA 1YQTA 3I8XA 4ZO4A 3ICEA 2QE7D 4HUQA 5FOWA 4C0SA 4AC9A 3DOEA 5BYJA 2IHYA 5AUNB 1U90A 4QNRA 3FMPB 4CF7A 4DLTA 5BN3A 3KKPA 1E4YA 4EPTA 4NMMA 2CBZA 4BFZA 1HTWA 1UBCA 2VL7A 3MAAC 4KHZA 4IKEA 4PHHA 5JECA 3ZQ6A 4M2LA 3KXIA 4NDZA 4QBHA 2UZIR 4Q9HA 1QHHB 2ZAOA 2QTVB 1BMFD 1F48A 1ZM3A 3EA5A 1NN5A 5JSZB 421PA 1CR0A 1XP8A 1ZD1A 4IFEA 3KB2A 1H8HA 1NSFA 2FZ4A 4MRSA 1II8A 4JMPA 2F1JA 1FOEB 3CUEF 4RJLA 4IDQA 3MG9A 2PZGA 3KQNA 5DHAA 4FW9A 2H5EA 1SVLA 1XMJA 2FNAA 4EFLA 1D9ZA 2VA8A 2ZUBA 4PAMA 3RS5A 3AKCA 3KKNA 4UNSA 1YR9A 3KJHA 4YQFA 1AKYA 4Q4JB 2BC9A 1CR1A 3TSOA 2QMOA 1E2LA 2NOAA 4A36A 4BEJA 2LKCA 2OSBA 2ONKA 4XD7A 3C15C 3U3MA 1E9CA 2ANCA 3B78A 3ND9A 3GLFA 1W5TA 4A9AA 1G7SA 2EQBA 2W2VA 2RGEA 1T9HA 3IO5A 2JLYA 1GITA 4NKRA 3DMDA 3RSLA 1UKYA 1U8AA 2XZOA 5DLQC 2J7PD 4BZPA 1G8FA 2O8BA 3O47A 4CRWB 4TLDA 2LCFA 4V0LA 1NLFA 3D6TB 5GVRA 1CJKC 2VSFA 1WB9A 1CJMA 2DY1A 2IUUA 3VKWA 1GFIA 3PEYA 3UWKA 1DS6A 3CW2A 1ETUA 4ZV4A 3LVRE 1E99A 1Z0KA 2BBWA 4HI0E 4LYFA 4BFSA 2GCNA 5GADl 4ZCIA 3C16C 1P3JA 3K0FA 3F5FA 1G4UR 1QZXA 3Q3JB 3DZDA 4MGIR 3VFDA 1JPJA 2QPTA 3GLHB 1DAKA 1P72A 1XFAA 3R9IA 3CIOA 2G1KA 4OQFA 3TR5A 1OE0A 4PSAA 2JLSA 1KMQA 4KLNA 5HTKA 1KIMA 3V00A 521PA 4H9GA 2Q3MA 1Z2AA 4PANA 3CRW1 4BLRA 3B1XA 3I92A 3W6NA 2OAQ1 1CRPA 2W83A 4M1WA 4GBMA 4P4UA 4TMVA 3GQBA 4TT3A 3KJEA 1S1MA 1NLYA 2FFHA 4RD6A 4EPXA 4DDWA 2MMGA 2C03A 2X2EA 1NJGA 2GZHA 1CRQA 1TQ6A 3NXSA 2XZPA 4QKQA 4I1UA 2QI9C 3B5JA 3THYA 3QIAA 3NBXX 3I73A 1QHXA 2GXQA 1ZUNB 2J0UB 2WKPA 3OFNA 3CH4B 3LFUA 2GVDC 3C4JA 4AYTA 4K8OA 3MJRA 4UNNA 4WZAE 1GAJA 1CTQA 1XPRA 4JZKA 2NO1A 3OEHA 4JL6A 1XRJA 1MO6A 2ZRNA 1KZ7B 3K1JA 1E9RA 1LF0A 4HDOB 3L0SA 4KAXA 4EPVA 3VR1A 1YZGA 2BM0A 1YZUA 3FMIA 3JVUA 4P0TA 4AG5A 3EIQA 3D3QA 4DEXA 4B34A 4C0KA 1WDTA 3BAFA 3HDTA 3WXMA 1XD9A 5FTMA 2YWEA 4NYMR 2W6JD 1EXMA 3AF0A 1ZRHA 1II9A 1WE2A 6Q21A 3AVVA 3LLUA 4PPQA 3I5XA 1A82A 1ZCBA 4CEIB 1UEJA 3EG5A 4Q02A 2IHBA 3TUJC 4QXAA 1GP2A 2YWFA 2DB3A 5JJKA 2NPIA 4TL7A 5E4FA 5FOTA 1G7TA 4BRWA 5CK4A 4BLPA 1HV8A 2H8KA 1NY6A 1KO8A 2BCJQ 3EW9A 2ATVA 3THXA 3CF0A 3B82A 3LNCA 4NCNA 3BH0A 4QGAA 5L3VA 2GHIA 3PFIA 4HEJA 2EYUA 1GRRA 3A4MA 2ZI7A 4OJQA 5FFMA 4ZIRA 4BASA 4B3XA 1W7AA 4IOKA 2QORA 2HJGA 2CE2X 5J4HA 2JLXA 4L16A 1D8TA 3TR0A 4BEBA 5A5GA 5KSOA 1U2RA 1E0AA 2C9OA 3GLFE 1S2MA 1P75A 1EK0A 4HB2A 3U6KA 2AKAB 1CKEA 4PO1A 5JWOA 2ZTSA 3QE0A 4CW7A 5H8WA 4LZZA 3CWQA 3N70A 2R9VA 4LGMA 3RNLA 2ZRMA 2ZYTX 4LHVA 4TQAA 4BFUA 4I81A 3CRVA 3RRYA 3K09A 2EWVA 1G8HA 2HT1A 5BWMA 5DYIA 2FGKA 1X8KA 1Q1EA 3GLHE 1X6VA 2AHOA 3DEFA 121PA 3QXHA 4URXR 1TF5A 4O3MA 4RD0A 1DAIA 3SE0A 1HEIA 3W6PA 3CPJB 5TY0A 1SZPA 5J4VA 2YINC 3PUXA 5EXTA 3U4QA 1AIPA 1KAGA 4C0LA 1SQ5A 2CLCX 2OLJA 3C7KA 3PUZA 3WNDA 1DAGA 4PFSA 3HU1A 2VRWA 2D3WA 4LV6A 4E03A 1DG3A 3DPUA 1SVWA 3CZPA 2JLZA 1G3IA 4PHTA 2D06A 3BFKA 3L82B 4UNQA 1J8MF 2VP5A 1GKUB 3GJ8A 1P6XA 1L8QA 3TQFA 1Z06A 5AUQA 1N6PA 3M1IA 1U8ZA 3OIUA 2H18A 3JZAA 2CLDX 2HF9A 2RB4A 1ZINA 4DLWA 3L2OB 2WOOA 4TL6A 2OT3B 2C5LA 4OL0A 1AA9A 2XEXA 3A1WA 4MYCA 2F3TA 3DZ8A 1E1QD 2GF0A 2VF7A 1GILA 4O2RA 4TMTA 4PAOA 4I4LA 5J47A 3RC3A 3ZD7A 4F4CA 1EG7A 1YZQA 2IF2A 2E9SA 4BLSA 5LBIA 1ZM7A 1E2MA 3VR4A 1X8LA 4ZIRB 1CIPA 1EWRA 1LY1A 2BCGY 3E2IA 4PPFA 1XBTA 4Z1MA 1KAOA 1VHLA 2FZLA 5G41A 3QXJA 621PA 1G3UA 1NBMD 2QP3A 2DCUA 2ERYA 2QZ4A 4FN5A 4D26A 5KNDA 2DFKB 3R20A 4CVNA 2EFEB 2NQ2C 1RYHA 4QM7A 5KSYA 1L4UA 1R8SA 3K0CA 3K0SA 1NBMA 2QENA 5G40A 5C46F 1KI4A 1VIYA 2UKDA 1GOTA 2CL7X 4DCUA 4PZLA 4NP6A 4Q9IA 1L4YA 1DELA 4QC2A 4OI0A 1F2UB 1FQKA 1KI2A 4ZDWA 1N0VC 3U3KA 4OI2A 2FDCA 3U61B 2XITA 2ZE7A 4DCTA 4Z8YA 3DDCA 1FMLA 5HR5A 1SVKA 2ZI3A 3FKSA 5D3MA 2QY9A 1XCGB 3W3AA 3LBNA 5FPYA 5JCPA 4RVCA 1PVOA 3QY0A 1CR4A 1Z22A 3GFTA 4V0NA 4DLSA 1MR3F 3A1VA 1PLKA 3TAHA 2IX3A 3UK6A 1LFDB 2Q0HA 3HR7A 1MV5A 3BJIC 3NBYC 4JLKA 4F91B 1KKMA 4NZYA 2VP0A 1G64A 3K9GA 2PLRA 4G3XA 4Y0AA 4DT1B 4F4IA 4YMWA 1G3QA 4BPBA 1OH6A 4L9SA 4TLEA 4ZI3A 1JXOA 5FL3A 1KO7A 1Z0DA 4V03A 1ZIPA 1YHNA 4D25A 5JBQA 3AB3A 1GL7A 4AIIA 2R6FA 5L3SA 4GNKA 1ELOA 2A2ZA 4V0OA 4X8HA 5IDVA 3RS3A 1SVIA 5JEDA 1TTTA 3UG7A 3WP1B 3CONA 3KQHA 1G6OA 3BB3A 4CT4B 3OHMA 5DIFA 2WBLC 1AS3A 4EFMA 4W5HA 3U6BA 1FNNA 4URWR 5JWHA 1RRFA 1LS1A 2KWIA 2EVWX 5KHOC 5HE8A 1NVXQ 4C0HA 1WQ1R 3VU9B 1US8B 4W5JA 2YC4C 4RD3A 2HYIC 1JALA 3IBYA 3R8FA 5DO9A 4FCWA 5D3QA 3PIRA 1R5OA 1PUJA 5EE0A 2YZ2A 1GIAA 2CVHA 2ORVA 3CM0A 3ZZ0A 2QAJA 4ZDJA 5KDOA 1GRNA 1VIAA 4GT1A 1ZNWA 2AXNA 2VP9A 3W9YA 3SYNA 4R2IA 1JR3D 1Z47A 3U3OA 3R9WA 2FPKA 2QNRA 5C4MA 2Z5FA 2NMVA 2P2LA 3NHBA 3SU8A 3WMFA 4UXHA 1QRAA 2ZROA 3CRMA 3MWKA 4LJ8A 1EFTA 2ZPTX 5C4GB 1E9AA 1OPXA 5DISB 4NYIR 1NMZA 3O8DA 1Q12A 4DKXA 4WZBE 2FGJA 4EPWA 4UJ3A 5HKKD 4NYJQ 3FFBA 2GCOA 4IJMA 4BFYA 1XTQA 3EASA 3G5UA 2CE7A 3H1TA 3WMEA 1NG1A 2IEYA 2ZRGA 4KBFA 1XTSA 4P4SA 1J2JA 2NGRA 5P21A 2JIZD 3WYFA 2QMHA 3KKMA 4HB3A 3JVVA 3SJBA 1ANKA 3DHWC 1SXJD 1NP6A 2DFLA 4BE7B 3T1OA 3AF1A 3S1AA 1XCPA 4AKIA 4Q4LA 3AKDA 1BS1A 3A4LA 3KX2A 1E9BA 1RKBA 2JEOA 2WWXA 2P5TB 2CXXA 4BGDA 1DARA 2AR7A 2BWJA 2F7SA 3H0KA 1KJYA 4TTPA 1NJFA 1US8A 2IL1A 4XSGA 4A1FA 3EC1A 4KV9A 2G9NA 1OFHA 4EDHA 5JZVA 4C0AC 3VR3A 4GFDA 2Z83A 2YHSA 3SFZA 4B3CA 1XJCA 1U9IC 3FKQA 5BN5A 5E3HA 3G82C 4AKGA 3ZS9A 1VMAA 3BWDD 3KTAB 3ND8A 1OXXK 4O25A 5BW8A 2GK6A 2ZSDA 1M2OB 2PCJA 2YNMA 3A8TA 2WJYA 5CLLA 1CXZA 1N5KA 1U94A 3W5IA 2EWWA 3SS8A 3BGWA 2LKDA 2Q21A 3LBHA 1SVSA 3LW8A 2C95A 4QG7A 1VG9B 5UKDA 4A2PA 4KBGA 2HYDA 3WBJA 3BRWD 2CL0X 4FWIB 2PEZA 1ZNXA 4GDFA 3BB1A 2FEMA 2FFBA 1KHTA 3PQCA 4TMKA 3AVYA 1OXTA 1E1RA 2OBMA 2Y8EA 4URUR 3X2SA 1IM2A 1FX0A 3MGCA 1ZU5A 1KYIA 2IYQA 1U0LA 4M1TA 5E7IA 1BIFA 2WSMA 1AK2A 1S3SA 4IVPA 4Q7LA 1Z0JA 3P1JA 4L5BA 2CJWA 3HWSA 3QG5A 4G1UC 1CLUA 3T5GA 3Q9LA 2O8BB 4HB4A 2FN4A 3IIMA 1QHYA 1Z0FA 1KDTA 2HT6A 1XWIA 1E79A 2J0VA 2B6HA 1DEKA
chains in the Genus database with same CATH superfamily
1IFXA 3JRNA 4DBZA 3K0FB 3L6BA 3HTXA 4PIVA 5HUQA 5CIWA 3MBIA 1ENZA 1L5MA 4ZOEA 3TD6A 3IOCA 3ZWCA 4X92A 3HLKA 4WGFA 3N8KA 2H1LA 2XMSA 4U4AA 3TPZA 3QPCA 3GEEA 3R6LA 1W5SA 2A88A 1Y42X 4IDAA 1JR2A 3LP6A 3E1GA 3NTRA 4A0RA 4ZQBA 3KTFA 4ER3A 4FB4A 4LSGA 4ZI2A 1W94A 1NXVA 2A9KA 3L0IB 3CX7A 4RFSA 1YK1A 4OJNA 5DGIA 3SAJA 2RGUA 1WS6A 4EP1A 1CZHA 1U3UA 2GZRA 2CXHA 3PENA 1OU4A 1C8LA 1U8YA 2J6BA 3V7YA 3DJYA 3M33A 4FKMA 3WY9A 2XXAB 1D6SA 3NOOA 4LDZA 3F6BX 2ZWVA 5ALYA 2PUBA 1P74A 2FPXA 3OI7A 2G70A 5LFAA 1YA4A 2H1HA 1KE1A 4DLBA 1E2IA 3I2IA 1UMBB 2XHZA 1X1EA 4JR1A 2JFUA 3ROQA 2XMDA 4MRMA 2FWIA 1QG0A 2RBEA 2J41A 1PNRA 5LLTA 1OB5A 5JPCA 2KSQA 1UJMA 2F3QA 1S8OA 1W87A 2BBTA 4EG7A 2H1CA 1T29A 1PZHA 4OM8A 2J0QA 3QFHA 1NKSA 1BU5A 2ZWIA 3FNEA 1EGAA 2WF9A 3LLVA 1OU0A 4EKDA 5BV7A 4UTNA 1Q15A 1SXJE 4RULA 2PLNA 2RHCA 4XX0B 4UHCA 3REFA 1UP6A 2JA1A 3RK1A 2O8CB 3LOUA 2FP4B 5K0BA 2BGLA 2C78A 4BVLA 2JGAA 4GAEA 3GJ4A 2ZI6A 4MR9A 2ZJ2A 4HN4B 1SCDA 5LMCA 1A77A 2RHBA 1JQDA 2FF7A 1X3SA 3LHDA 4CV3A 3EQ6A 5B6JA 4LZJA 3H9BA 4CM7A 1U8CB 3AJDA 1N5DA 1TEXA 3FCEA 2BTQA 2Z6VA 5ALOA 4CLHA 4ZCLA 1B74A 3QFSA 4QNMA 4LXYA 2FQ1A 4ZKDA 3QE3A 2OSVA 3ELUA 3ZDDA 1CQZA 4UTVA 4ZYXA 4L07A 5KVQA 4LNAA 1UAAA 1R0LA 4OFBA 2QSYA 4KYIB 3PWZA 4NBLA 3SQOA 4CLOA 3EXFB 4DUGA 5I7FA 1C7IA 3C5EA 4PC7A 4HDNB 4EATA 1LSJA 4F38A 3F6SA 4H1TA 3KUXA 4MV3A 4MARA 3ZE0B 2QRVA 4EI8A 5IMSA 5GJWC 3HJNA 1NT4A 4HDRA 4IXDA 3V97A 2HQSA 4NEGA 4YP5A 1JJFA 2DH6A 1K7EB 2JLBA 3IILA 4OQLA 1L5GB 2EQAA 3DMPA 4WZAB 4DSOA 1XL1A 4BX8A 4GI7A 2WHXA 5GAJA 5DTIA 5L3ZA 2UDPA 3E27A 5DRYA 3UATA 1NVVQ 1YMQA 3EF3A 2VJNA 1GU1A 2W6OA 1JMVA 4L02A 5K51A 2K2WA 2DUWA 1PK9A 1SIUA 4DWJA 2B69A 5CB0A 2BJHA 1FDOA 1IQUA 2Z2KA 5AHKA 5JO9A 1OSNA 4DA4A 5AW1A 2PQ6A 2VHCA 4YRZA 5TIIA 3PXBA 1O0BA 4D02A 3MJVA 4D3SA 3ZHSA 2BH2A 5ARBA 5IBRA 1KBOA 5AR1A 1TJPB 4JEHA 2AH5A 3DLHA 1W4LA 3HKBA 4I0WB 5ITZA 2QBYB 3EEIA 3FBTA 4KMMA 4HB0A 4EJ6A 4TYYA 5DNDA 1F4VA 5HRAA 2EZ8A 4XDYA 3KFVA 1W46A 3T99A 4QJ3A 3Q4GA 3PRYA 1EUZA 2ZDQA 2ZR7A 1PQ4A 1XO1A 3GEGA 3SZOA 1E3MA 4Z0PA 4B48A 1W0JD 4WNAA 4OGKA 1IRIA 4POOA 3RASA 2QU8A 2B1GA 1KPIA 2GQ0A 3TZEA 1C29B 1JJBA 3SF8B 3UK0A 3ZDQA 2YW9A 5HEKA 5C8YB 3FHLA 3TTSA 3VC2A 2PA3A 1NUTA 1RIFA 1ZIOA 2QUIA 4KXLA 3WWEA 3ONFA 4CU2A 5L3QA 5T64A 4O5AA 4FMBB 2EJUA 2R1ZA 3K5WA 4RPIA 2X5KO 1OX6A 5HA5A 5FL7D 2RGYA 1DMRA 1X1QA 3C74A 1CD5A 5REQA 2DBVO 1XYVA 1MC1A 4IHJF 3CN7A 4HP8A 4AKSA 3GT4A 4DZRA 5EMKA 2VVTA 2GCOB 3T12A 2X2OA 3G9TA 1NIPA 3PNKA 1SUCA 3KBOA 1ZOLA 4MGEA 4GG1A 4NXNB 4IDEA 1JTFA 3SK0A 3LVBA 3ZZ1A 1LFAA 5MFPA 4BB5A 4B6QA 1V7ZA 1VCIA 1Z17A 3I2JA 3U4QB 3HB7A 1Q22A 2DSTA 5KYUA 4C04A 4M9CA 1ZO8A 4W1QA 1BYUA 1OGJA 4LDJA 2A0YA 1E5DA 4C0QC 5JNSA 2XMBA 1GEGA 5KOYA 2R44A 1T0IA 2HSJA 2O4CA 3WZ2A 1PWYE 3OX3A 2C20A 1FLAA 3P26A 2E6UX 5G0SA 2IZ7A 1DQPA 1BRTA 2WYOA 3UH1A 5IG2A 2W2MA 2HL6A 3AGQA 4Z9FA 2CLFB 3F96A 3G9UA 3D81A 4ZQFA 1GUZA 1OI3A 3ZQUA 3KUCA 3SY8A 2XCOA 3G6KA 3A3KA 3OOSA 3D2LA 2RBKA 2R8XA 1TADA 1B0AA 2CVOA 1MB0A 3R7FA 1I1HA 1TUEA 3MHPA 4R1MA 2YTZA 1JKXA 2NU6A 3MSCA 1X7ZB 1OJLA 1NR7A 1N6KA 2IJGX 4X24A 3D0KA 3FNIA 4YXFA 3G8DA 2F1IA 3JVDA 2W2OA 3K4PA 4DSAA 5KOHA 1GPYA 3KD2A 4GS5A 4JLJA 5JC1A 1KIAA 4UM9D 4Y0VA 1Z07A 2QVYX 1TYDE 3HVJA 1GZ6A 3V8RA 1AQ6A 2FWPA 3HV0A 2W8ZA 1F2TB 1BC5A 3DDUA 4A91A 1WTCA 1ISPA 4I1OA 3KR0A 3AEUB 4N6OA 4C22A 4GXQA 5LVAA 2JG3A 3ZDFA 4YK7A 5LUAA 1QP7A 2WUWE 4H1UA 1N6NA 4MUYA 1G8GA 3OURA 5AI9A 4E11A 4EHKA 4M55A 1JHXA 3ESQA 1YJBA 2PRIA 4UQPA 4WE3A 4AP6A 1ZM4A 2ID8A 4PO9A 4C7XA 4XD2A 3H11A 5JISA 2O7VA 1FQOA 4MV0A 4LGVA 3VR2A 1HQCA 3ZDRA 1UCFA 4C4SA 4EG5A 2W43A 4IWXA 3UJ3X 2I91A 1MB9A 1T0JB 2JRCA 1DE0A 1XWWA 1FFXB 4OHBA 3RANA 1T3HA 2ZSUA 3IP6A 1E2GA 1SIWA 2WVJA 1SURA 4HR7A 5KCZA 3GGJA 5JQGF 3QSYA 1C80A 4DYHA 3HP7A 1Z0UA 2P6UA 3T15A 2AI2A 4V02A 3D8TA 5KKNB 1TLTA 1NNLA 2XF8A 3PNQA 4N0PA 3H1BA 2BEUA 1I4DD 1HG1A 3PFCA 5LC1A 3ZWMA 4KWCA 4BY9E 3KKOA 3L1VA 1ONNA 3EGDB 2JGNA 2H1WA 4BJ6A 1TK9A 3DL2A 3KPYA 1GGHA 1DXYA 1ADJA 2WTXA 3KVVA 3P9XA 1DLIA 2MINA 2HJRA 3OP1A 1YS1X 4PR3A 3HM9A 3LDAA 3OQJA 3CPHA 3FYHA 3UXHA 3LBFA 4RADA 3P0JA 4KAFA 3RWMB 1QIEA 1CE8A 2FMKA 5FLEX 4Y1RB 3ZTTA 4WUVA 5GIOE 3HYRA 3UUWA 1WW3A 1UPAA 3VPGA 1JQ5A 1K5GA 1PJ3A 2X19A 4ZK2A 4CEIA 3AVQA 1SCQA 1YE8A 4HWTA 3A27A 4Y2QA 3KJIA 2WIDA 1S6YA 4GEKA 2A9OA 5FO1A 2ZT6A 1W36C 2XNJA 3FPHA 1I2ZA 1JV2B 2FTKE 2C54A 1FNCA 3A1SA 4FLEA 4N5NA 5T8KC 2QAIA 1LC3A 4BB0A 3PGJA 1IU9A 2EEZA 4GE3A 3HUFA 2ZETA 3I64A 2YJ3A 3ODGA 2RG7A 3K32A 1QK4A 3DDZX 5JCOC 1U2ZA 1D4AA 1Z73A 2P78A 1ADFA 3H9EO 4X90A 1R4NB 2WEKA 2JS7A 2X2FA 3F1LA 3IR6A 3REGA 3NRBA 2DKFA 4IYJA 4AMUA 1UKCA 2QUZA 4BQEA 4ENSA 1E32A 3RUFA 4M0FA 2ZSJA 5KOIA 1AKUA 4J0QA 3UXYA 3B1ZA 4HVAA 4DMMA 1HKUA 2RBGA 1T5IA 5EJ2A 4E5PA 4QL3A 3HKBB 3G2HA 4H3HB 1LPNA 2AFIE 2QBYA 2ZVPX 4IDCA 5GV8A 1W9MA 1ONPA 4QWMA 1XG5A 4WVFA 4CEHA 3PGXA 1SB8A 3PVCA 1MX9A 1O4VA 1XOIA 1MPTA 1HYHA 1TQ8A 1B43A 1R5NA 2ZYWX 3GFPA 1AZTA 3H4VA 4JT2A 5ENDA 1VDZA 4HPJB 3BBLA 1FZQA 3DMNA 1K3TA 2EP5A 2ZU6A 2REOA 4NEHB 4R8SA 2FFQA 4V1CI 5I7EA 1GZSA 3KJNA 2FW9A 4KPYA 4XEHA 2DUUA 2AI1A 5CDYA 1Y7TA 2V7TA 3HB1A 1N6HA 1I6MA 3CMMA 3G85A 3IQEA 1EFPB 2VYFA 3UCEA 2V59A 5LOVF 1LRLA 1QRTA 3DMYA 1VJGA 2AOXA 4ZJUA 2O7QA 4V39A 2M6KA 4GI1A 3KSBC 3TLMA 2ECQA 3PJEA 4GSYA 4RVNA 4AWXA 4M49A 2JFFA 2JHFA 3AEQA 3BXZA 2VF4X 4J9UE 3CUTA 3DEHA 1PJ4A 1EFAA 4G5HA 2NUPA 2HRCA 3E8SA 2B21A 1AUVA 3HHEA 4MGKR 5KMGA 2ACWA 1VM6A 1I32A 2N3ZA 3B9QA 4G26A 3IBSA 1L7EA 1R6VA 4DR3B 1SXJB 4Q1EA 1XMIA 2F9LA 4UASA 3T5DA 5HW0A 1RXIA 10MHA 3OE7A 2BGJA 1BD4A 3ZI0A 1I0ZA 3RVLA 4LCBA 3ZWPA 5J2UF 4MPDA 3HKEA 4FYPA 4MQ4A 2C61A 4MITA 1J5XA 2P3LA 3M5DA 3PPIA 4KJXA 2AN5A 4NEQA 3QEOA 5EWMB 2WSSD 2VAWA 1IZ7A 2XTJA 3EJ6A 1VMDA 4UAGA 2OORA 4XWTA 3E1SA 3IDAA 4G8JA 5HIIA 5KDDA 1Y0BA 1NONA 3U5TA 3HUUA 4F86A 1BE0A 1F6DA 1M1ZA 1R2QA 2Q5HA 3IRVA 5GONA 4OQXA 5E9QA 5EUBA 4WFKA 2IRWA 3LF2A 4BGVA 5A4DA 1CX9B 4RZUA 1T9BA 1U3VA 2YUTA 1T6BY 2ZIXA 3GRAA 4QBTA 3WV4A 2OUKA 5JZ9A 1EZZA 4ZCMA 1TM5E 3B48A 4KRXA 1TQ2A 2ZJ6A 3L6OO 3NDPA 4HRXA 3ZHBA 1T0BA 3D1JA 4KKVA 1KYWA 2IYWA 1JG1A 3I52A 5CM8B 3VPHA 4Q4HB 2XUHA 3C41J 1RZ3A 3GCXA 5F35A 2Y2VA 4S1TA 3SBOA 3K6JA 4A27A 2QNBA 2E82A 1EDZA 2A9PA 2GLXA 4G0PA 4ZARA 1MGPA 4EA9A 4Y2TA 3LFHA 4L50A 4O0LA 4L28A 4GD3Q 3VYVA 2Q9UA 4JOSA 2RC6A 2X9NA 1M6HA 3P7MA 3IB6A 4E3WA 2Q6TA 2PGLA 5DEIA 1RI2A 2ZJAA 2P4SA 3IV6A 4OLHA 4U7JA 4XCQA 2HLHA 1MQ8B 3EPHA 4Q3EA 4GQIA 3TZ6A 2F1RA 2O48X 3F5MA 1J9GA 1RE1A 2RAVA 3RFXA 5FBVB 2O8DA 2NZVG 1PSDA 1Q3KA 2D7DA 2BUCA 4M8LA 4ZVSA 1IJEA 4CM5A 2J0SA 3JV7A 1HSZA 5ALKA 1XNHA 3AR3A 3I37X 4JL8A 5JUWA 1XZBA 2EDAA 2H11A 3LE8A 4Y6GB 1G2PA 3IMGA 4KJZA 3VRHA 4D42A 3ZD6A 2NZUG 1UM9B 3BC1A 3NG1A 1XJQA 3QKSA 4FYXA 1OYVA 1SQFA 3TMYA 4J0EA 4XM2A 2J3QA 4HWGA 5EIFA 4Q5IA 4E5MA 1XNRB 3O8BA 2D2VA 2G28A 1EHCA 5ADVA 5GQSA 4IX1A 3IAUA 1MA3A 3UMFA 4F11A 2I8AA 4RHEA 5FHRA 3TZHA 3WJAA 1HC7A 1NLUA 4N54A 2H1FA 4XVQA 2R68A 4E1BA 5J4KA 4BMOB 3FDXA 4L15A 4MQEB 1N1EA 2I7CA 4BFXA 4MLPA 5BV8A 5EIHA 1R6TA 2VNIA 5KWEA 1V8OA 2X5XA 1JLSA 5WRFA 4Q4AA 3L7BA 1VKNA 2Q07A 2WI8A 1KK1A 3PGA1 4GECA 4Q16A 1TO6A 4L0DA 2PX4A 3OIYA 4Z2AA 4FCTA 5CHEA 1WPXA 4UJ5A 1JPNA 1VSBA 2ZQYA 1OWPA 4DY6A 2PD6A 5LQKA 1RRPA 4IWYA 4JKIA 4MKHA 4ON9A 1G8MA 5K3AA 3RIEA 4KMRA 2WWGA 3OA0A 4YCCA 1KFKB 1TLFA 4DDUA 4Z7JA 4JEUA 1SCIA 2GPAA 3HO8A 3ZCQA 3R2JA 4EARA 4Y2SA 4DIOA 1PSZA 5K0CA 2F9FA 3TB6A 1YWGO 2O0HA 1ZI9A 5H80A 4PLCA 4DYVA 2PPLA 1NBIA 4EJSA 5L40A 3K8OE 5EEHA 4R6XA 3ONNA 3F67A 3N7AA 5IT9A 1TQDA 2EFJA 2XMCA 4RBNA 3AUTA 4V2IA 1YOBA 4Y9TA 4HJXA 2PD3A 1MW8X 1R6UA 2P68A 4OCZA 3P96A 3BJEA 5KTOA 2JZNA 1VSUA 2DE0X 2MR5A 3A36A 4F3KA 3GWZA 2O5VA 3HDYA 4ZO8A 4BNWA 3RE1A 2QE7A 3UICA 3GLHA 1GZ3A 5IW8A 3FJ1A 3JPWA 3R0XA 3R3VA 4L1KA 4Y2RA 1DEOA 1XEXA 5E0OA 1J99A 4AP9A 1WP9A 3ND5A 4E4RA 1Y48E 2XGOA 4JJ4A 4XDGA 3DC2A 1NMYA 2RJ3A 4D6XA 1OWOA 2GK3A 2VEDA 5JYCA 3CF4G 2BTQB 2IODA 1YGYA 1B8PA 1N2ZA 3RKUA 2EHJA 5FTJA 1J90A 5ALMA 1OWMA 4L5IA 4WK0B 4M4SA 5BRNA 3T7EA 3VNSA 3W05A 4FINA 4F21A 4F3NA 5ICGA 5F12A 3CH6A 1C3XA 5T3YA 1WMDA 4P3NA 4QLAA 3NORA 4JLNA 5JXIA 3X1MA 4HNRA 2OZEA 3QK7A 4MRPA 1MC5A 1O96B 2BEWA 4NNPA 1KZGB 2D5IA 5EXSA 2C4WA 5BYBA 3SC3A 5LZ2A 3INYA 3ADOA 5FI3A 5LQJA 5CNKA 1IZ0A 2LDBA 3HZOA 3F47A 1JQAA 3LP5A 3LQQA 4R83A 2Y67A 3PDUA 2AFHA 3BM5A 4BECA 4NY1A 2A4KA 3EZ9A 1T34A 3G9ZA 5EE9A 3SXUA 1NVKA 2J3JA 3KU1A 4RE6A 3CNLA 1FYEA 4TYNA 2WABA 5EIWA 2VJCA 1V41E 5AWFC 4YRRA 3EPLA 3OZXA 1E9SA 3V2HA 4OH7A 3N7TA 4N5DA 1BQ3A 2ILTA 2FUNB 3CUVA 4JC5A 1NVEA 1LWOA 3WBKA 5I8PA 3CX3A 3U4MA 2BE7A 2VYVA 5E7JA 3AVXA 3DE7X 4DZTA 3GXOA 4PVCA 4UE6A 4FILA 1ACMA 3MCZA 4AMGA 3WGUA 2XCTB 4ITVA 4RD4A 1VL2A 1TW2A 5CA0B 1JILA 5JLJA 1IMJA 2CGEA 1O5IA 2OCPA 2IZ0A 4PY2A 3ZHOA 4EUNA 4CMEC 5BNTA 4OK5A 3W5JA 4DQ0A 2BGWA 1O95A 3CEMA 1JQ3A 1FDIA 1P9RA 3DWEX 4GBED 4LE1A 1HURA 4H6PA 1LQUA 2W2QA 3GPLA 1V1MA 4X8OA 5ITZB 4GC5A 5BSTA 3W4JA 4D9MA 3WHIA 3LHSA 3TW8A 1IN8A 3CNQS 4X3CA 4QEZA 1EE2A 1X1BA 2W2XA 2O8FB 1YE5A 2NSYA 1K6JA 3WIUA 2DWQA 1FMFA 3QEKA 3T41A 2OTCA 3ZE9A 3QPWA 4RGYA 4ND8B 1PDOA 5E3JA 3QX3A 3FRIA 3H2JA 4O2LA 1PHRA 3KS9A 2Y0EA 3ZHXA 5K3BA 5C8YA 1M67A 2W6JA 3DO8A 4RD2A 1SBIA 1W48A 4F1KA 4Z4FA 3DS8A 1K4KA 3KJGA 4I5IA 1U0OC 4G56A 4ZI7B 5EE5B 3NKVA 1SKMA 1GL3A 2IXDA 4O0MA 1A7KA 1MCZA 1I0IA 1KJNA 1SMKA 4MQFB 4ZT2A 4DM7A 3CG0A 2D8AA 4M98A 4A0HA 3EF0A 4B84A 4QATA 1VTKA 2AYZA 3K1YA 1C2YA 3C98A 1JYFA 3OJLA 1E1CB 4YJDA 4KLCA 3LG2A 2C5HA 3I4LA 1NIJA 4LXHA 2Z2YA 2B3DA 4KN9S 4ZVUA 3ZZTA 3RU9A 4X7BA 2RFLA 2XNDA 4OHWA 3K5IA 2ZB8A 4BQRA 1E9EA 1LQTA 1G42A 1MEOA 2XE8A 3C8HA 2DQ4A 3O84A 3R5XA 4M9QA 1PGQA 4UHBA 3BWXA 4NOMA 2R8RA 1N4AA 2DHDA 1FP7A 3ROZA 3L8HA 2TRSB 1SA0A 4PQRA 2YOGA 2HEGA 4M36A 5BQFA 5C18A 3C3JA 3C8UA 4QOSA 5CB6A 1NYLA 3Q7QA 4G4SO 1FLDA 1OX4A 1USGA 2JBAB 3LO8A 3LY5A 1FXWA 1CIVA 2QQ5A 1ZOSA 1GADO 1WXGA 3DHEA 4AQ7A 1JPUA 2IA5A 2RGCA 4TTSA 4YROA 3F5SA 2AE1A 3EAQA 1NATA 3EIEA 1SGWA 3FZQA 3N0VA 2ZUDA 3RTBA 4I8IA 4O4JF 2K5UA 2IEDA 3BWEA 5CX1B 2GK7A 2HFJA 5HILA 4P86A 4II2A 4Z1OA 1RFGE 5G0TA 4ZVQA 2DJIA 4N0DA 4DLKA 3UWSA 2DFVA 1T24A 1TJ3A 2C96A 2WICA 3PVSA 1YBVA 3BD8A 5TJHA 2D2IA 3TZQA 4C4YA 2ZZMA 1DIHA 2ALJA 2VHUA 3EG9B 3V1LA 3MB5A 2HBRA 2VDLB 2ZITA 3PEWA 1P2TA 1Y8CA 2NM0A 3F5DA 5JS2A 4JA0A 4GM4A 4E1VA 1P4GA 5FOQA 1AG9A 1YI0A 2UZ1A 3Q2OA 2AC4A 1I7NA 1KK3A 2P3QA 3TSAA 5LJLA 2W0SA 1DX9A 5DCYA 3F8WA 4N82A 5BNFA 3TI7A 4PZZA 1EKXA 2FMXA 4CPDA 1A9OA 1Q17A 2YVUA 4JI8B 1ZBQA 3TFWA 3P2YA 4XQCA 3KSAC 4R7ZA 3GA5A 2I4TA 5JY6A 4U8HA 2PE5A 1J23A 1MAAA 1YV9A 3G3EA 1VJ5A 3GN1A 3ESBA 2HSDA 2H5JA 1NT2A 2X9LA 2CEKA 1DJLA 2HXYA 3FN4A 3M6UA 3NT5A 4UNRA 1R4MB 2NZWA 4XD7D 2GBLC 5K5EA 1DOAA 3GOHA 4YJFB 3WK5A 4FWBA 4US0R 2D5BA 1AS0A 1P4RA 2D62A 3GR6A 4XSHA 4FMPA 3PKJA 1JEQB 3F3YA 3H05A 1X9HA 3C14C 4UCXA 3THRA 5I6DA 3BMCB 3KTDA 3QENA 2VHZA 4EH1A 2Q8PA 2HO4A 4IHAA 4KH1A 1B14A 2JLVA 3KZCA 5CHYA 1NHWA 2WAYA 1OLSB 2NP7A 1NBAA 3QFTA 4B2PA 1EZ4A 2QX8A 2F55A 2BI4A 2BRUA 3HU5A 1K7SN 2OFWA 4I50A 1JSZA 3D6HA 3C7CB 4HLQB 4Q24A 4UZEA 5IMBA 3WO0A 3ZCPA 1RI4A 3H0EA 4B31A 3TGPA 1NN1A 1S8NA 4FE3A 3MWJA 4RTOA 3V6MA 3K0EA 1JJIA 4PSUA 5EJGA 3OIFA 3H9UA 2WB2A 4M1OA 1N0HA 3K5PA 2AZ4A 2J9FB 2ZI5A 2Q4RA 4BNXA 4W63A 4B3MB 1JZTA 3ET5A 5K09A 2HJWA 3MUNA 4EMUA 4F4FA 1WCXA 3CRZA 1NGSA 4EABA 2AW3A 1LNQA 1T3SA 3ENZA 3RYTC 3L0DA 5CXUA 1SEVA 2IEGA 2OHOA 3BA6A 5A5FA 3LYAA 1AJEA 4AY4A 1Z7WA 4TM7A 3T7SA 1PW5A 3W4IA 2P9YA 4YX9A 3TLKA 4LJ7A 3SZRA 2GI4A 4F92B 1L4BA 2HZBA 5DW0A 4IIGA 3CLRC 2A3RA 2HCFA 3GXBA 2C9YA 3OM9A 3QSGA 4IM7A 4JY7A 2P6RA 2VDUE 3K35A 4TN1A 3TJRA 2Z3VA 2RAFA 2WVHA 5G0VA 3SBEA 4PRLA 3HRHA 1NR1A 1CEYA 2OG2A 3KXPA 3SJAA 1T8RA 5EQTA 3O8NA 5DCLA 2SKEA 5COQA 3FMOB 1O03A 1T6XA 4MA4A 1ACLA 3ENWA 4LRQA 5EG5A 4ZU6X 3GVPA 4BZQA 1QRSA 3RHSA 2QE6A 4KR7A 2C3PA 3QVUA 5FL7A 1L7PA 2DUMA 5EHNA 4AZVA 1XF9A 5U9CA 1DAOA 3K94A 1OT3A 5CDFE 4QVKA 2HLNA 3BE5A 1EH5A 2ISCA 4KE7A 3LYUA 2Y0PA 2AIRA 1SVUA 1YUBA 2J3DA 3RDPA 3TAUA 5I7WA 1OAOA 1Z83A 1N5LA 2GD2A 4O4JA 5HZHA 3GLVA 4B81A 5JXWA 4PS1A 4CODB 1KNQA 3TW8B 3I5AA 5DXJA 2ODAA 1XDGA 2CJFA 4TKUA 3DWIA 4QGSA 1IBRA 4JLBA 3UPUA 1W88B 3V34A 3WRWA 2XRZA 5A9RA 5DI3B 3L7KA 2WKRA 1JBKA 1AN9A 3H5NA 1U3FA 4A5OA 1KI8A 4YQYA 1CR6A 4N3CA 1O6ZA 1WMBA 1N2OA 4QXOA 3FOAA 2AQ8A 3GC6A 6ADHA 1OFTA 4DLYA 5JD6A 2FHPA 4E94A 3ESYA 1KQFA 1SU7A 3OC0A 3UWDA 3HCDA 3A1TA 2J31A 1D4FA 2R4TA 3MINA 4ZU1X 3RTGA 1IZ8A 2C9ZA 1NI4B 3K30A 1APBA 4YDSA 2MYNA 1QTIA 4PYMA 5E38A 5GMOA 5JMWA 1FBNA 2QNIA 2HDNB 3QYAA 2IUSA 2YJ6A 1U5BA 3KXKA 2AHRA 4DLRA 2PXXA 3RROA 1ADCA 1SAYA 2HUNA 3TTXA 1Y1LA 3KLBA 4JC8A 3KT3A 3GF4A 1OYYA 2G9UA 3KV3O 4E2XA 4YCBA 4JT8A 2CLLB 2VAMA 1RJFA 2PX0A 2XKJE 1TE2A 4OHOA 4ZEXA 2YFQA 4HEHA 4KQKA 3EYAA 1E9VA 4CQLA 1R0RE 3H2IA 5CBPB 1IONA 3HPRA 2H7CA 2IF0A 3NB0A 3VKVA 4NCAA 3ZU3A 2CT8A 2G9ZA 3HP1A 3K09C 1PR1A 2JFVA 3O8LA 3ZWBA 2AUMA 1KDVA 5JMOA 4DQDA 5LDDC 2XAUA 4LW8A 3RVKA 2ZTVA 3DTYA 3WK7A 4UXIA 4WJLA 4HPWA 1KH3A 1V6AA 3K6RA 5IULC 2JCSA 4BU1A 2JKZA 3LX8A 4WN9B 5CM9C 3MD0A 4QU5A 5BV1A 3HN6A 5B1HA 3DVAA 1FDSA 2BM8A 2QN1A 4NPCA 2D5LA 3KAJA 4Z5XA 1OZ0A 5IBQA 4MLCA 5TF0A 4W5TA 3WHPA 3JQBA 5F2OA 1VYHA 2WFLA 4TTVA 1PLJA 1IPHA 2XRMA 2O8EA 1HA3A 2B7BA 3WKCA 2C0PA 2CMHA 3E7FA 3AZOA 3ZWYA 2HJVA 3LT0A 3OJFA 3FPSA 4JP8A 3RAPR 3VHXA 1N3IA 6LDHA 4ZYTA 3L5KA 4J2OA 2HQRA 3ZQJA 3ZHYA 4HAZA 4AY5A 4BQSA 4JI6B 4MVJF 5BOVA 3I28A 3UT5B 1C0IA 3IMEA 3KD3A 4HRAA 4PQEA 4IDNA 1EP3B 1BEEA 1MW9X 3PV0A 4UUNA 2L0XA 5DHFA 3H7AA 5IWAB 4QOEA 4DR4B 3VOAA 3MIIA 4DDMA 2ZRKA 3HZHA 4BMYA 2B94A 2FRXA 4Z51A 2XWQA 2EG9A 3EAFA 3OJ0A 5D5PA 1IWBB 2P2ZA 1SU6A 1KP2A 4DXAA 3GEBA 5KU1A 1IQRA 2HMWA 4DWWA 4NR0A 1WD5A 3LHFA 1CUDA 2WIJA 3RYIB 5E2IA 2OQIA 4EMSA 1POWA 4PLWA 4Z3DA 1M8JA 2F4NA 4QOJA 5FR1A 4MW0A 1WAMA 3MOGA 4DIDA 5GZ3A 2G77B 4NHEA 3FYUA 5F4ZA 1ZHHA 2QZJA 1VG1A 1XD8A 2XSZA 1U7DA 1SUDA 1CC1S 2LNDA 4HTFB 3NUZA 1E4OA 2A1IA 3O8RA 1DTWB 4RJ2A 1T8UA 1XXHB 1U3WA 1XZHA 2PWYA 3BXXA 3TNYA 2PS0A 2Z4SA 3HE3A 3K9WA 3QE2A 2AMYA 3RSOA 3W8RA 5KTPA 5FLXA 3JWHA 2UUAB 1J7KA 1R8YA 5ALPA 3AL3A 2OKGA 2GHTA 5JO0A 1II8B 4DV6B 1WY7A 2DBQA 1VGRA 2IXGA 4RKRA 5T41A 2EZ4A 821PA 3FRJA 5GJVC 1EJ2A 4DIBA 5EN4A 3PEEA 4N8DA 3AXSA 5KS2A 1QLJA 2XUZA 2VBGA 1G7CA 2Z5LA 3IT0A 1U31A 1GQSA 3QXXA 1ZP6A 2I2WA 4N3BA 2YQ4A 4Q4CA 3RKSA 3FCYA 4OL9A 3A28A 4Q1AA 1NVAA 1Z0IA 3WL8A 2OHFA 1WVMA 4CIDA 1HK7A 3COSA 3V46A 4ZDIA 1USIA 2WT8A 4FOTA 1Z68A 3LUAA 4LQLA 1MB3A 2ONYA 2VHEA 4P7JA 1FTGA 1TRHA 2RONA 4G01B 2ZTMA 5HYVA 2GN1A 4AB1A 1M6YA 5ELMA 1K4YA 5ISMA 1X1SA 4DRXB 2WAMA 4LYJA 1LCIA 1J9EA 3ZXIA 1E3DA 3GJ6A 5L6LB 5CP8A 3CJTA 4NAUA 4FONA 4NBWA 1LLDA 1ZH8A 4FR5A 3ZQ4A 3FHJA 2O5EA 2EBUA 1H65A 4CM8A 3UJAA 4MUBA 5K4HA 3ISJA 3EXHA 1LLQA 1G2OA 1BQ4A 1Z62A 2R25B 3FFAA 5TVKA 1OXVA 4RTSA 1WXQA 2DMRA 4Q7KA 2W2NA 2JFXA 1SHLA 3VJKA 5BXYA 3RLIA 3AKYA 3E22B 2FR1A 4N48A 1VJRA 3OE4A 3FH0A 1KY3A 4R2HA 4YJ2A 2I6TA 5C8ZA 4Y30A 5HIKA 1JB1A 3IS3A 1I3MA 2O2HA 1RYBA 3ETGA 1U2TA 1M83A 1N9ZA 4EO7A 1ZN9A 4GMXA 2CF6A 3WNCA 3C5CA 2BR4A 1S8FA 1E2BA 4UU1A 3Q1LA 2XB8A 4D5EA 4X44A 5IAGA 3D7MA 2X1HA 3MTDA 3MCWA 3QUAA 4GLBA 4RGQA 2XMZA 2FOXA 4O4HF 1WSBA 5EZYB 2WG1A 4A4DA 5G3ZA 3TK1A 1NMSA 3VHQA 2II6A 1MAVA 3N2GB 4G84A 4B32A 3BRWA 2AZXA 3AOGA 2Z4TA 3IQFA 4M0UA 5DK4A 3ZV3A 1OH8A 2VHYA 4HZIA 5CK5A 3HJBA 3ZBTA 3S40A 1M0TA 4QTZA 1AH2A 1ZKMA 1DAMA 2IITA 3L6CA 5BUCA 1X7GA 2JI8A 4Z7NB 5KOHB 3JZMA 3SYLA 1Q0ZA 4JFAA 3OY7A 2VNSA 4V3BA 2I8CA 2XNCA 3T3EA 4L3WA 3ELWA 3G8CA 5B57C 1PUIA 5JTTA 1YI8A 1CY2A 3NVKI 1MQSA 1KYVA 3LZCA 5E6SB 2BFPA 2MSNA 2RK6A 1XGKA 3DDHA 5D1NA 1XKXA 3NNNA 5JVDB 3A9UA 5F1OA 2C98A 3TIFA 2JANA 5EJ8A 2IS4A 1BVYF 2R6GA 4G4IA 4MINA 2NO4A 3FNBA 3H1AA 2HF7A 4GWKA 2RGWA 1C1XB 1OYWA 2FLVA 1SBHA 1OI7A 2NUTB 2VDJA 4BC0A 3HVRA 4JUAA 1EA7A 1G291 3FPEA 2J0UA 1U80A 2YV2A 5AJXA 2VF8A 4EW3A 2BHSA 4Y6SA 5AK0A 2AQKA 5HNKA 3TQIA 1FFDA 4D44A 1VXOA 4KVFA 1GKIA 2HDOA 2P0AA 4LXGA 2AEFA 3O0DA 3LTNC 2OXIA 2CLIB 3NBAA 1L5SA 2O2YA 1H6DA 4DA6A 2GEUA 1SOUA 1WVGA 2SECE 3FOEC 4G67A 1RQRA 4EB6A 1HE8B 1CV2A 1A7JA 1I4LD 3H2ZA 1D2RA 4RK5A 1X7YB 3LX5A 3ER6A 4YBRA 2POCA 4HZUA 5JV5A 5IAKA 5MF6A 5CNMA 4YP7A 3MN1A 2E4UA 3UJ6A 2QL5A 2DXIA 3OCVA 4C88A 2Z43A 2H29A 3TBFA 4JBXA 2WFMA 3AFGA 2VI5A 4CQJA 1YBAA 4P38A 2BL4A 3B9PA 3N0XA 4ENVA 4D74A 3BFXA 1AC5A 3P2IA 4MKRA 2MSKA 1J0AA 3P45A 1O95D 5AQ1A 4MS1B 5EJ6A 4PSKA 4ZEMA 4CF3A 4OKSA 1JH9A 3U7GA 3D8UA 3IHTA 3Q7RA 3VDMA 1JLLA 3INRA 1PW7A 4GOJA 2ZS8A 2JI6A 1PU2A 3B3FA 4HY3A 4XB1A 5CDTA 4LNUB 3B2NA 1LVGA 5J43A 1VE3A 5HQ3B 1CFZA 2AFHE 2I2AA 2JI7A 3GFQA 3IV9A 2JD2A 1HQKA 3H3FA 2AF3C 1Y8RB 3FPAA 3CVUA 5JAPA 3KEGA 5ERYA 4DSUA 5KQMA 3QF7A 4G5GA 2VRCA 3QKUA 4WDRA 3LLSA 4JD5A 2WIBA 4EGAA 5A4FS 2YHIA 1VBNA 3ZGOA 2O2EA 1OY1A 3SVLA 4CV0A 2XE7A 4TMZA 1KPGA 3UBTA 5I5GA 1GZ5A 2VPIA 4FMDB 5EJ7A 3CPEA 1D0SA 1D2GA 1HGXA 4G24A 3ZBUA 2CV2A 4DAEA 3UAWA 4FD2A 1ORHA 3LRTA 3PQEA 3GLKA 3TLCA 1Q16A 3GK3A 3M5PA 4URFA 3VR6H 3D54D 2Q2QA 4QRDA 3U4DA 4W6QA 3WTBA 1WXFA 1P7WA 5CEJA 3R5TA 2JJMA 2XYHA 4XB6B 4J7CA 3Q10A 1SD2A 3TMAA 1IN4A 1NNSA 2FUEA 2VJDA 3C3AA 3FPFA 4GPBA 4LVOA 4CMKA 4F3RA 5AVVA 4JS0A 1ISSA 2IWHA 1X74A 4EO4A 3NW9A 2OAGA 3N5KA 1R0XA 2RGNC 4MDEA 3SNHA 4EW2A 2VJOA 5H5JA 1XXHA 4GGMX 2DT8A 1C9EA 3GCGA 5AXDA 1PK7A 1MFPA 2XJ9A 3OO1A 4ND6A 3TIGA 2PO5A 3BUSA 3NWBA 3NM4A 3QUBA 2BGTA 4HX2A 2FEAA 1I2MA 4XWYA 5ALUA 4DABA 1DCTA 1GGFA 1E63A 3HXPA 2PPVA 1HDYA 2W9XA 4YJ2F 2Q5QA 3DZGA 5HCIA 3GN2A 3R76A 4MW6A 5DOVA 2XZLA 4X84A 1PGJA 1V7CA 3ITKA 4OJKA 5KDLA 2CLSA 2G88A 4L75A 4QBKA 5CJJA 5DHUA 2VPQA 4LJLA 1AGRA 4LZNA 3ME5A 4CLOB 4RZQA 3JQAD 3NIGB 3VBEA 4IX9A 2Z6UA 1AZLA 4HDNA 1A4RA 5BW4A 2ID7A 4QUBA 3NPMA 4QBIA 4LX0A 1MAHA 5EFZA 1L1RA 3G0BA 4C4PA 1NI3A 3ETLA 1RJ9B 4EY5A 5CLGA 3GH3A 4LDPA 4HDSA 4KQCA 4ZAXA 4HS9A 3T9BA 3VR5D 4GSKA 3TTUA 2XB4A 3EWIA 2UXBB 4PQGA 3I8SA 5KSWB 1A7UA 1EQ2A 5HPYB 4FYJA 4BKUA