1UWCA

Feruloyl esterase from aspergillus niger
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
261
structure length
261
Chain Sequence
ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPAEQGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERULOYL ESTERASE A
publication title Structure of a Feruloyl Esterase from Aspergillus Niger
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 104
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uwcA00
4QDUA 1FFEA 3AILA 4W1QA 2H1IA 2WFLA 3F98A 2EEPA 1CUSA 4BAUA 4ZRDA 1A7UA 2WG2A 4EA6A 2WJ4A 2HA2A 4B80A 5LKAA 5AM2A 1GPNA 4I3FA 5CMLA 1CUXA 4E46A 2DFPA 5FV4A 1AZWA 1MU0A 4U2BA 1MX1A 1EDEA 4OUKX 1ZOIA 5LZ2A 2XUDA 3IVMA 1HBJA 3F8SA 4G8CA 4OD0A 1CRLA 4LIPD 4U2DA 1YS1X 3STYA 2GBGA 1BS9A 4OCZA 1EK2A 4RE6A 5ALVA 2C5GA 1ODTC 3VISA 4FTWA 1VA5A 3WQHA 3H2IA 1N1MA 4KE7A 1MO2A 5HF5A 2C7BA 4RE5A 4G9GA 2OQIA 3NOXA 1M33A 3FLBA 4IHAA 3IBTA 4QA9A 4FLFA 1KU6A 4L72A 1LBTA 5JAHA 1LPBB 4M0MA 3WWOA 4C88A 3WYDA 3OPMA 4EZIA 3FCYA 4ZWNA 1CQZA 4KR0A 4WFJA 3BIXA 1L7RA 4J0CA 3HXKA 5A7HA 5AICA 1ZGCA 4WDRA 1Y7IA 5JD6A 1MT3A 3BE8A 3ZV7A 4J0KA 4QEKA 3N2ZB 2FJ0A 2Y2UA 2YASA 5LZ9A 5AM3A 4X90A 3K9BA 4Y7DA 5K3FA 3G0CA 1HDEA 3WI7A 1EHYA 1Q0ZA 3IUJA 1YAHA 3CCCA 2VEOA 3ANSA 1KU0A 5CT5A 2O2HA 2WKWA 4JUIA 2GBFA 2HRRA 5DTJA 4U2GA 1ACLA 3HLKA 2VT6A 2BUBA 4K2AA 3KSRA 2JGFA 4BP8A 4HXEB 2VTVA 5ALUA 4G8DA 2G63A 4KE8A 3FLEA 1GZ7A 5E4JA 2OCIA 3R0VA 5DYWA 5AK4A 1NX9A 3WK5A 4UHCA 1TQHA 3WK8A 3Q8WA 5FDFA 3VJLA 5HQ3A 2HADA 4BVKA 1XZGA 4ITVA 3WK4A 1CEXA 3O4JA 4UBIA 4G4GA 1UOPA 2OQVA 2BCEA 3SWWA 1SCKA 4W1PA 3NUZA 3BXPA 2XMGA 4BP9A 1WHSA 3T4UA 2HM7A 4KYVA 4IQ4A 5BV7A 2WG1A 5T4FA 4ARAA 3ICVA 3FVTA 5HKBA 3ESBA 4A23A 1EA5A 3S8YA 4WFKA 3R41A 2ZJFA 1ZICA 3AIMA 1YA8A 4LHEA 2X8BA 1R3DA 2HU7A 1IUOA 2Y2VA 4FLMA 2RGUA 3EQ8A 4UBLA 1K4YA 2WU3A 3CXUA 3ZI7A 3QPCA 3K2IA 3H2HA 3LIPA 2VAXA 3EBLA 1XZLA 4LYEA 4HRYA 5FOQA 2QT9A 1C7IA 1MAAA 2QZPA 1QIFA 1TRHA 3AINA 1IZ7A 1QIEA 1UT6A 3H04A 1UK7A 3SK0A 4IH4A 1XQVA 5EFZA 5LP1A 1BE0A 4CIAA 2GYUA 3MVEA 1UKCA 1T2NA 3DL7A 2WHPB 2DSNA 3DS8A 4WY5A 4EHBA 4N8DA 4AN1A 1EDDA 1ZIXA 3DLTA 3GROA 4UUQA 2C58A 2WFLB 2XUGA 3D5EA 4FKBA 1A88A 5FUMA 4GHWA 5I7UA 3ZLTA 2BUAA 5EHQA 1YAJA 2B20A 5AKJA 3FYUC 1R1DA 3I2GA 1QFMA 4M0FA 3LP5A 1J06A 1JU4A 1QIGA 2EDCA 5C8XA 4DTCA 3DYVA 1XLVA 5C8VA 5AK6A 2VJDA 1CUYA 2WILA 3WWCA 2DHCA 1ODCA 2QMQA 3MUOA 1LPMA 3X3HA 3FSGD 6YASA 5K3CA 4HRXA 2OG1A 2EDAA 2DQZA 3OOSA 5IVIA 5AI8A 4OYLA 4K6KA 4FMPA 2Z3ZA 2YH2A 1QIHA 5ALEA 4L0CA 5K5EA 5AK5A 3KXPA 2HDWA 4GLBA 2B4KA 1VZ2A 5KBYA 4AXBA 5AM1A 2ZYRA 2J3DA 4OU5A 4H7FA 3AZQA 3SX4A 2HFKA 2HA4A 1QIKA 5K3EA 4PQEA 2DHDA 5ALRA 3KD2A 1G42A 5HKAA 1QIJA 1JJBA 1W6RA 2ZYSA 3LLCA 2WUDA 1EK1A 4BE4A 2FX5A 1VA4A 3G8YA 2OPHA 4G8BA 4GEGA 1OXMA 5HZGA 3MGAA 1EI9A 1MAHA 4ZXFA 4YK7A 4P08A 3WL6A 3IDAA 2Z8XA 1VKHA 1K5PA 1Y7HA 1FFDA 4G4IA 1E8DA 5ALXA 4FBMA 3G9XA 5K3FB 1P0IA 3HI4A 4Q82A 1OCEA 5AIBA 4X71A 5E4YA 4BZWA 2PSJA 3PDCA 3BJRA 1O6FA 4OB7A 2VJAA 3O9MA 4XWGA 3D0KA 3C45A 5SYMA 4BBZA 1GPKA 4WCVA 5AKHA 5A2GA 3DNMA 2HA6A 3ESDA 3R3YA 3BJMA 3HSSA 4NZZA 3ILSA 3C5VA 3C5WP 3LS2A 1EINA 1CUFA 2JGLA 1VLQA 4PO3X 4UHFA 1ORWA 3I2HA 4H77A 5AKGA 1DU4A 3G9TA 5ALDA 2QVBA 3W04A 1C4XA 3BWXA 5CH8A 5AI6A 2PX6A 1G4HA 2Y1KA 2QUAA 2XUHA 1VE6A 1JT2A 2QM0A 5EHNA 1BROA 4GXNA 1SC9A 2ZSHA 4ARBA 2VATA 3H0CA 3V9AA 5CT4A 4CI9A 5AO9A 3BF7A 4WY8A 2AXEA 4C89A 3DYIA 3GBSA 3R3WA 4B9AA 4RPCA 2OCKA 4DSAA 1GKKA 4QDTA 1BEEA 2XE4A 4J0DA 5AKZA 4D9JA 4BE9A 5BOVA 1ZI8A 4FFWA 1UOOA 5LKRA 2XLBA 4UBOA 3D59A 1J1IA 5E4TA 3ESAA 2BGNA 2VSQA 4BC1A 2BFNA 4W1SA 1XRRA 1A8QA 4J0HA 2WIGA 2WFZA 4FFVA 4CIBA 3GZJA 5HQ3B 2XQKA 2VJBA 1R88A 1W1IA 4UHBA 4P93A 3EF3A 3HRHA 5ALKA 3G9ZA 4MWSA 1FSSA 4XVCA 3IUNA 1LZKA 1SCQA 4W63A 1ZJ4A 4TPKA 2HIHA 1UZAA 2GZSA 4TGLA 2XUQA 2V96A 2WJ3A 1MPXA 5AKXA 4LXGA 1G66A 5A7FA 3F97A 2I03A 4OYYA 3IIIA 1PJAA 2JEZA 5DNUA 3IUMA 2HA7A 3AZOA 4IO0A 5AHXA 2ZSIA 4JEIA 4UBKA 1CUAA 5CTAA 1DX6A 4EY6A 4XJVA 5CBKA 4B0OA 2ECFA 1E66A 3GUUA 1VE7A 5ALTA 1MNQA 5D6OA 4WFIA 4PV7A 4U2EA 3M82A 3O4GA 1XZCA 1GPLA 1AQLA 1VOTA 3GFFA 4MJ3A 4EY4A 3B12A 1CUJA 1VJ5A 2RAUA 4GBGA 1TAHA 2DQYA 1ISPA 1PFQA 4ETWA 5AM5A 5AOBA 5T4EA 1XQWA 1ZD5A 1E5TA 1THTA 2JGIA 1JMYA 3QYJA 3FLAA 4G1FA 1P0QA 5IVDA 1H2ZA 5ALJA 2CB9A 4M0EA 1HLGA 4AMZA 4BCCA 1RWQA 1EH5A 4X93A 4GI1A 5CT8A 4BDTA 1WOMA 3L1JA 1AURA 4EY8A 3R3UA 1SFRA 2D0DA 3D2AA 4J0JA 4EB0A 5DYTA 1QOZA 5JAPA 5KWJA 5JADA 2CUTA 5SYNA 4KAAA 4Y2RA 1A8SA 4O08A 1XRMA 4BCBA 4E11A 3C6ZA 2OAGA 2WHRA 2VT7A 3FWHA 3QMMA 4EY5A 3VVMA 2CBGA 3I6YA 3E0XA 5HF8A 4G9EA 4X7BA 2H7YA 2XQIA 1XLWA 5IVKA 1EX9A 4X6XA 1VXOA 3O4HA 2PUHA 1E8NA 2JIDA 1H2WA 4H7HA 4H7DA 4Q3OA 4MWTA 4DLNA 1YR2A 5K3DA 4MQLA 5ALYA 4OB8A 3F96A 1Z68A 1DT3A 2XUIA 3A2NA 3PUHA 1GXSA 5EI5A 2RONA 2WIKA 5ALZA 3PI6A 2GYWA 1AX9A 3KOOA 1CV2A 2CZQA 4AO8A 3WKEA 2WJ6A 2OCGA 2O7VA 5JAUA 5AKLA 1JMKC 4B84A 3WZMA 4AMYA 2D5LA 3A2LA 1WPRA 2ZJ7A 1XZMA 2QJWA 1DQYA 2JF0A 5A7GA 3RKSA 3I2FA 3DKRA 5DJ5A 3BL8A 1N5MA 1FFCA 4HVTA 3G02A 1XROA 4AO6A 1LBSA 2Y6VA 4QLOA 3CCBA 2BKLA 3V1NA 5A71A 1NU6A 4U2CA 1W4LA 3AIOA 4Y2VA 1YS2X 5LYYA 4AZ3A 3ANTA 2XT0A 5J3JA 3TRDA 2XMBA 3QZUA 4LKOA 4UHDA 5JAOA 2HHAA 4GWLA 1JU3A 5AI9A 2XUAA 1EXWA 2XUFA 1QIIA 1XZJA 1ZGBA 1QONA 1O6GA 3FAKA 1TCAA 4BAZA 4C4ZA 3PF9A 1QE3A 1XZEA 2GBCA 5T4HA 5ALHA 1X2BA 1YA4A 5C8ZA 4ZI5A 4FOLA 5AKEA 3FNBA 3WZLA 4BC0A 2AJ8A 1TKRA 1K6EA 4WDQA 5CURA 4MQMA 3H19A 2XQGA 4CCWA 4NMWA 3DEAA 2O2IA 2QKYA 1FFAA 4N5HX 4DMCA 4BATA 2WIJA 4OPMA 5JYCA 4KRYA 3IA2A 3A6ZA 3F9CA 4KE9A 2XQFA 3WJ2A 5JZBA 1DT5A 3DD5A 3C43A 1BCSA 1P0PA 2X76A 2VQ6A 1K63A 3W9UA 3FSGA 1XZDA 2VAVA 4H7JA 2XMQA 3N0TA 1UK9A 4EY7A 5HF6A 3CN9A 2HU5A 3PE6A 5ALSA 3AFIA 3R3VA 2XMDA 3ESCA 4AB1A 4AQDA 3IULA 4KJXA 2JGJA 3QMWA 3JW8A 5ISMA 1LPSA 3WWDA 2WSLA 3R3XA 5IVHA 2XUOA 4K6GA 4B85A 4J0IA 2CMFA 3WA6A 1QLWA 1ZJ5A 4GECA 4AO7A 4Q3KA 1E89A 5ALLA 5KWIA 3HZOA 3U1TA 2XQJA 4IH1A 2VA9A 3STTA 2QJRA 5D3ZA 2OCLA 2J4FA 1X70A 3BDVA 4L9AA 5AP9A 1ACJA 2RHWA 3RLIA 2PU7A 5A6VA 4KEAA 4DIUA 2J3QA 2PM8A 5IH7A 4C87A 3I6MA 1CUIA 3KDAA 3VJMA 1XLUA 2Z3WA 3G0GA 2RHTA 1RP1A 4KAFA 1XZFA 3G7NA 1QTIA 3C8DA 1AGYA 2CKMA 1BU8A 1MX5A 2QXUA 4PW0A 1XZBA 5ALFA 1LPNA 3PFBA 1MX9A 3W2TA 3M83A 4B82A 1TK3A 2BGRA 3ZWQA 2BUCA 3QITA 4PSCA 4QE3A 3Q0TA 2XMSA 2LIPA 2G4LA 2WLSA 1WHTA 5HF9A 5CXUA 3KWFA 5I9IA 2JBWA 3M3DA 5ALOA 3DJYA 3WLAA 5LZ8A 2I78A 1ODSA 3QVMA 2PKYX 3IB3A 2QS9A 3HC7A 2G5PA 5CH5A 2IX9A 4ZGBA 1YSCA 5ALGA 4ZV9A 3C70A 4CG2A 2C0PA 3RK4A 1WB5A 5C7YA 1R4ZA 1XRQA 4FLEA 4X00A 3GA7A 4NVRA 4YPVA 1BEZA 1QZ3A 3NGMA 1DWQA 3BF8A 3D7RA 5JASA 5C81A 4OSEA 5AKIA 3W9BA 1XRNA 3E1GA 4YASA 1F0NA 4BYMA 3TJMA 1KEZA 5AKYA 1HQDA 1AUOA 1EVQA 3C6YA 5ALPA 1LPOA 1QIDA 2J4CA 3OURA 4DMHA 2HA0A 2V97A 4RGYA 3L1HA 2Z8ZA 3M81A 2XUPA 1L7AA 1F8UA 5HCUA 2DCMA 1BRTA 3NWOA 1CPYA 2WHPA 3WA7A 2PSFA 2V9ZA 2XLCA 2ONCA 2QOEA 1JJFA 4JYPA 4UHEA 4A16A 1YCDA 1QJ4A 4E15A 3S2ZA 1U65A 5JATA 5ALWA 1Q83A 4GW3A 3DOHA 3HACA 3D4LA 3ZLVA 3A2MA 1ZIYA 3H2KA 1IUNA 2WUGA 1CUCA 4Y2XA 2OGZA 2WM2A 3O4IA 3ZLUA 3H1AA 4KACA 1GGVA 2PU5A 3V48A 4BTVA 1R50A 4Y2QA 5DNWA 4QDXA 5DLPA 2C5FA 1R9NA 3WKCA 2GYVA 2Q0XA 2I3ZA 4C4YA 4FNGA 1XKTA 1H23A 3LCRA 1QGED 3UMJA 2W6CX 5I8PA 3STXA 1B6GA 1EB8A 2X5XA 2WTMA 3STVA 1G5FA 2ZYHA 2ES4A 2H9YA 4CCYA 4UPDA 1CVLA 1K8QA 2GZRA 3OG9A 1UOQA 2YYSA 4J0GA 1QO7A 3I2KA 2B61A 2XMZA 1LPAB 5BWCA 1S8OA 4X97A 2PPLA 4Y2SA 1EB9A 3QPAA 1Q0RA 1UK6A 2PUJA 2OGTA 1QO9A 4CG3A 3HEAA 5KREA 3DL4A 5K3BA 3AIKA 1F6WA 4LYDA 5ALMA 1D07A 3SC2A 2WQZA 2AJBA 5EIEA 4NS4A 3RM3A 1Q84A 4F5ZA 1UWCA 4PF1A 4UBMA 1CUHA 1VZ3A 3H2JA 4F21A 4Q34A 4A5SA 5HK8A 4H35A 4G5XA 4H0CA 4N8SA 4BB0A 4I19A 2JGMA 4P92A 2UZ0A 3WK6A 1W75A 1Y37A 4LXHA 4QWWA 3ICWA 4FBLA 1CUBA 3G0DA 4I4CA 1L7QA 4QDZA 2ZYIA 5LZ5A 3AJAA 3O0DA 4H7EA 4BZZA 5ESRA 1LZLA 1XZKA 1YB7A 1LNSA 2NW6A 4X95A 4Z49A 2P8SA 2XDWA 1C7JA 5JARA 3QMVA 5EIAA 5H3HA 1MN6A 4DNPA 2R11A 4N8EA 4X91A 4HXFB 1AMNA 3QM1A 1YASA 2JGKA 4P9NA 3V1LA 4QNNA 3DQZA 3RARA 4XIIA 4BDSA 2WG0A 1HPLA 4DM7A 2I3DA 7YASA 3PUIA 4UFOA 2IIVA 4G4JA 3BDIA 3C87A 3B5EA 3I6ZA 5ALQA 5EHZA 2QTBA 4HAIA 5FKJA 3I2IA 4CFSA 3DOIA 2DR0A 1H22A 1WM1A 1BN6A 5JIBA 4DNOA 1DINA 4Y2TA 4K5QA 5HFNA 1HKHA 4DYHA 4Y2PA 1AC5A 1F0PA 1J2EA 4BRZA 4Y9SA 4YX9A 1XRPA 1P0MA 4X6YA 5IKXA 4C6HA 2ORYA 2ZVDA 3I28A 5AH0A 3T52A 5JANA 4AN0A 1HL7A 5FRDA 1NU8A 3IUQA 4V2IA 3O95A 2HRQA 5AI4A 1CUEA 1QIMA 3U0VA 2QR5A 4TVKA 3UUEA 3FYUB 2OLEA 2BJHA 3YASA 4HXGA 1R9MA 3MUNA 2XUKA 1XRLA 2K2QB 1ZI6A 4BCDA 2XI4A 1THGA 1DWOA 3BIWA 5E2IA 3R40A 3QPDA 3W05A 4AX4A 4J7AA 4Q05A 4Q1VA 1T4MA 1USWA 3VVLA 3HJUA 3TGLA 1XZAA 3DDUA 4INZA 3FOBA 3VXKA 4QZVA 3HYSA 1E8MA 3E4DA 5FP0A 2WTNA 4JNCA 2PVSA 4HS9A 1CIJA 5JD5A 1E3QA 1FFBA 4MEBA 2WFMA 3D2BA 2CJPA 2HA5A 2PSDA 5CT9A 3WWPA 2ACKA 5T4BA 2IITA 3WL5A 4DMKA 5CH3A 4B0PA 1CUDA 5AI5A 4DMFA 1GQRA 3ED1A 1OILA 2WU4A 4GDMA 4Y2JA 4CCYB 4Y2UA 4BVLA 4IH9A 4FHZA 2GBIA 3D3NA 1WB6A 5LLSA 3OM8A 5DNVA 2RI6A 3JYHA 4DGQA 3H1BA 4C01A 1B41A 4UHHA 3EQ9A 4OB6A 1CLEA 4BVJA 5DTIA 1XZIA 2XMCA 4XX1A 2JEYA 5FLKA 5D3KA 1IVYA 1WCYA 3WYNA 2E3JA 3I1IA 1UKAA 3OC0A 2WHQA 3B3QA 4UBNA 1MJ5A 5CT6A 4OU4A 5HK9A 4UFPA 1FJ2A 1CUWA 4HTAA 3PICA 5AOCA 5AI0A 3OTQA 5LIPA 4J3JA 3DKKA 1ZI9A 2C4HA 2ZJ6A 4BTLA 1XZHA 1AKNA 5DWDA 4UBJA 5FPPA 3QH4A 4X85A 1W76A 3WL8A 2Z5GA 5FPQA 3L1IA 1CUUA 2QXTA 3WKBA 5CRIA 1MTZA 2PL5A 3UUFA 4BRSA 2OGSA 3FBWA 4N5IX 2WIFA 5AKKA 4B7ZA 2R8BA 2W22A 1LLFA 1W52X 3WWEA 4Y2YA 4QDOA 2XUJA 5YASA 1DWPA 3FYUA 1ORVA 5CW2A 4X92A 3C6BA 3KWJA 3WK9A 4AZ0A 5JZ9A 3EIOA 1TCCA 4BAGA 2H7XA 1IMJA 4S0XA 3AZPA 1UFOA 1IUPA 1CUZA 1RYYA 4X3CA 4JYMA 4E14A 2O7RA 2XMRA 4B81A 3K6KA 2RIPA 1DTEA 2AJLI 4W1RA 1CQWA 1UK8A 2C0QA 3PFCA 3VKFA 1EVEA 3QBJA 5LZ4A 5LZ7A 3O9VA 3V1KA 4MEAA 4UFNA 4KAJA 1U2EA 4PSDA 4ROTA 1IZ8A 4W9RA 5ALIA 2O2GA 3WMRA 2QUBA 1PV1A 3WK7A 2VJCA 1XQYA 1GKLA 1JFRA 4RNCA 3R3ZA 2Y6UA 2HL6A 1ZD3A 4QWMA 1ZD4A 5AJHA 1EDBA 3STUA 3PF8A 3LIIA 5CXXA 4KRXA 4CG1A 4K6HA 5AK3A 2JGEA 4JH0A 4C4XA 3D2CA 1CFJA 4QLAA 2H7CA 3FYTA 3WKDA 5AM0A 3C8HA 4DNFA 3DCNA 1CUGA 5BWBA 5JALA 1CUVA 3WJ1A 3ZPXA 3AUKA 2AJDA 1WB4A 1WPXA 5ALNA 1ETHA 3E3AA 2WUFA 5EGNA 3VJKA 4LXIA 2PSHA 2OAEA 5FXMA 1N5RA 1U4NA 3WIOA 1X2EA 1BN7A 4B83A 2B9VA 1JI3A 3I1YA 1DX4A 3H18A 1XKLA 4FWBA 2AJCA 4DSZA 1XQXA 2QRUA 4PNZA 4Q3LA 3A70A 2WIDA 3WKAA 2V98A 3G0IA 1H2XA 3H17A 2CEKA 1DQZA 5AIAA 1GQSA 2HA3A 1A8UA 1TIBA 4F0JA 1CR6A 4ZV7A 5K3AA 3WIBA 5D7BA 4DNQA 4FDMA 1SOMA 5HFAA 4J03A 3EQ7A 4B9EA 1TCBA 5A62A 4X6UA 1MNAA 1JKMA 3IURA 3JWEA 3G0BA 3FCXA 3C6XA 3FVRA 5EIHA 4L3WA 4ZREA 3CN7A 4B6GA 3I2JA 1GT6A 1ZD2P 4WJLA 5EHXA 2VF2A 2PBLA 4EBBA 3VDXA 2WUEA 2ROQA 4X94A 4H7IA 1LPPA 2XB6A 4F60A 3TEJA 3V1MA 2YXPX 1JJIA 2DHEA 3HABA 1XFDA 2FUKA 1J07A 5F4ZA 1LGYA 1N8SA 4MYDA 4H18A 3F67A 5JD4A 2OXEA 3H2GA 1UXOA 1SCIA 2HFJA 5DYYA 1H2YA 1U8EA 3STWA 3G9UA 2BAGA 3GELA 5JZSA 1QFSA 5AM4A 3P2MA 2HU8A 4MXDA 3W06A 4PSUA 4H7KA 4HZGA 4EUSA 4FNMA 4KE6A 1QTRA 3WL7A 1UKBA 2PSEA 1BCRA 1VXRA 2ACEA 2G5TA 5AOAA 4U2FA 4MYSA 1YB6A 2FJPA 1I6WA
chains in the Genus database with same CATH superfamily
1QPBA 1BG6A 2QJFA 5JRDS 1PEYA 1PGNA 4W1QA 1NVWQ 2A9JA 2I22A 4KSYA 2B82A 1R15A 3LUDA 3O8BA 1BMFA 3BJZA 4WUVA 1TKAA 1D4AA 3I5AA 4IS2A 3F98A 3H9UA 3MUFA 3C15C 4GSKA 2QU8A 3AF2A 1VCMA 2GARA 1CUSA 3ESXA 4OIFA 4BAUA 3UJHA 4ZRDA 2MTBA 1LNQA 4JLBA 2BP7A 4N4AA 3SX2A 3NDRA 1GIAA 5LKAA 5DT9A 2ZTHA 5CB4F 1CJBA 4UOZA 2WOOA 4HDCA 4I3FA 5JO0A 1M1YB 2DFPA 3D4OA 4JXJA 2W90A 4W7HA 2YINC 3ZJVA 2W98A 2XD9A 1DJLA 5LD2B 4BZXA 4PEVA 3GT4A 5T8KC 3RYHA 1FRVA 1AZWA 3ZH9B 4L8FA 2H0QA 1TVEA 1T1RA 2V1XA 3TX2A 2CSUA 2GAAA 1DO0A 2I34A 3DXFA 4O2AF 3AC0A 4IQ0A 3RVJA 4FDVA 5J2UF 3N6VA 1AUQA 3CEAA 1WRBA 3L41A 4BFWA 1HFKA 1MX1A 1UQRA 621PA 1NSYA 2JCBA 3VVCA 4EUEA 3CXRA 1FE8A 2H3EA 1MB0A 4QOSA 3VO8A 3AUUA 4LXTA 1XI2A 1HE4A 1KI6B 2UZ1A 2Z4RA 3CWQA 2JKVA 5AHRA 3SYLA 2H4WA 1EXVA 2FEMA 2IPLA 2BTQA 2L2QA 8ABPA 3TBFA 3ZY6A 3AG5A 2W2PA 1KWKA 2P9TA 5JDIA 2IUEA 1P19A 1YVUA 2P30A 4G8CA 3H5AA 1UBRS 4EJSA 1VRVA 4AG6A 3UICA 5TT0A 1W4ZA 2JLCA 3BHJA 3KTOA 2AVDA 2PYZA 5MFZA 3A1FA 4U2DA 3NBMA 2PZJA 4PM4A 5EJIA 1BS9A 1Z4QA 1UDBA 4GPBA 4IDNA 3GQBA 1EK2A 5B2FA 4RE6A 3EISA 3TPZA 4PLPA 2ZWPA 1J0AA 2H5EA 3N8NA 1LCIA 3LQFA 1VDZA 2HREA 3V4FA 3VAAA 1ABBA 4UTZA 3PT5A 2FRDA 1SUDA 3D7SA 5TJHA 1HA3A 4N7MA 4BVEA 1VA5A 4ZIRA 4CKBA 4RZQA 3C0KA 3E5HA 3WQHA 3NDBB 1S01A 1VG0B 1T5SA 4GOXA 2EYQA 1N1MA 1TVCA 1MO2A 1TU3A 4EH1A 5BR7A 2IP4A 3D6HA 1RWVA 3LSYA 4IVPA 4TWIA 2GZAA 3ILHA 4QARA 3HFRA 3DHNA 3ZDCA 1QV6A 2EQ5A 2RGEA 4G9GA 5J4HA 2AOTB 3FLBA 3ET5A 1K7EB 3ENVA 1JQDA 1Z82A 3DP9A 4I50F 4WY2A 3ZS8A 1PJTA 3CLUD 4XAQA 1RFGE 5KOJB 1SULA 5JDIC 3KXKA 3U2QA 4Z7QB 3WTCA 2C5SA 1JHOA 4DJEC 4E5SA 4L72A 3PKJA 2YW9A 3DXXA 2H92A 2OL4A 4B6EA 5JAHA 5KDDA 1LPBB 2Q4DA 3K5PA 1R0WA 3OT4A 3GJ8A 4YV0A 2RBEA 4WWHA 1X42A 2P8JA 1L3IA 2PGAA 3NC0C 4C88A 1I2DA 2NZJA 4YB8A 3N07A 3FCYA 2CV2A 2NT3A 2OESA 3DBVO 2VQSA 3DQPA 1SBCA 4XDGA 3LFUA 5DCYA 4ZAZA 2NWQA 3RRJA 1U81A 3NUQA 2BJWA 1X7GA 2RGNA 1M8KA 3V2UA 4HL6A 4EF6A 3G5AA 4MV5A 4OBEA 4RS4A 5EY5B 1H2BA 1QQ5A 2NOAA 3B1XA 3LH5A 3JY6A 4NV3A 3GPLA 5AICA 1P2DA 1TCUA 3A1EA 3U7HB 4JOQA 3OICA 2C9OA 1ZGCA 3JQGB 4GYJA 1CJUC 3R7LA 1Y7IA 1N5LA 1MT3A 2DFLA 2YOGA 3PYXA 1KFKB 3ZJUA 4TTVA 1QDEA 5ES4B 3MTBA 3NCHA 4BOYA 4KR9A 4F6CA 4PCUA 1J9ZA 2IYSA 1RI5A 1P6UA 3MT0A 4YT4A 1QBKC 1UKZA 4U0KA 7ABPA 1JEYB 3MSCA 3O4VA 1GU1A 3DUFB 1AZTA 3P9XA 1Y4ZA 2GM9A 5EIWA 3S5UA 5D84A 4A6XA 1EM6A 2DULA 2Q5EA 2QRZA 3TLCA 4ER6A 4C7JA 4H2DA 4UNNA 4QUHA 5F77A 4QRDA 1OA0A 2D1RA 2HMVA 3V4ZA 4F4UA 3CCCA 1C9MA 1KO5A 3WXBA 4N47A 4QSHA 2WWYA 1SXPA 2VEOA 3SKYA 3ZNPA 4A7PA 1A9SA 2ID4A 1IAVA 4E03A 5IC6A 4MVJD 3EVDA 1QHEA 5G1NA 4Q9NA 1NW3A 1R3UA 2FZEA 4XOIA 5KI6A 2B83A 1JXOA 4JUIA 5GZ1A 1XTBA 2WJIA 5ESDA 1KMNA 2X0IA 2D1TA 1RMYA 1TMYA 5DTJA 3T54A 1DCTA 1Z37A 1UBSB 1FLDA 1UEIA 1DNPA 3HLKA 4EJMA 3AHCA 5GONF 5B55A 3GO4A 1HZJA 2JGFA 3Q5DA 4BP8A 1OMOA 2VTVA 4L4SA 3ANYB 2DH5A 4CLRA 3PKZA 2PZBA 1PT9A 5ALUA 4C1BA 4TZKA 1AKWA 1MORA 2YZ2A 3DD1A 1U0RA 4K86A 5TARA 3ZOKA 3P4XA 5K1ZA 4ER7A 1SCUB 5BYAA 2MYTA 1TUIA 1JG7A 3HXOA 2MIIA 5AK4A 3DZHA 1LFDB 1U4OA 1NG1A 4RK0A 2ZUTA 4UHCA 4XE5A 4DAEA 1ESNA 3DJFA 3GBPA 4L4YA 4FINA 3D4IA 4ME6A 1AHPA 1BW9A 5CCXA 4IILA 1GLGA 2OHIA 1CY1A 3E84A 3EGOA 3Q15C 4MW4A 2BFEB 3IA7A 4BVKA 4Q1BA 4CMJA 1HGXA 3TMAA 5JH7F 2H5LA 2VTKA 4KMSA 4OJMX 3O8OA 1QQ6A 2Z2JA 4H7PA 3NHZA 4RVSA 1QCZA 4ABYA 5KTSA 2Q8QA 3RYCB 4G4GA 1UOPA 3L8MA 2BCEA 3BGDA 4QUBA 4AJKA 2Q9BA 2PXHA 2MMCA 3RFCA 4W1PA 3E81A 1XKXA 9LDBA 4ZO9A 4CQLA 5HQTA 1VPWA 1EP3B 3VO1A 1RMQA 3I3SR 4JZYA 5TS3A 3RBZA 4C6TA 1U5BA 4ZT4A 3U44B 1ULHA 4BP9A 1Y4AE 5HOEA 1G55A 4QODA 3OTGA 2HM7A 3ZVLA 1W7AA 9MHTA 1SPBS 4X7PA 1NV9A 3HRKA 4U9UA 5AVZA 1V8BA 1II9A 1Z28A 4ND4A 5LBUA 2J0EA 3LXMA 4GIBA 4TTPA 4DDVA 4UQOA 1E0JA 3A10A 3ZDZB 2JD1A 4ZFNA 1QWOA 3JPWA 4WFKA 5C1IA 2ZJFA 5SZHB 2VYNA 2C78A 4LKRA 3LHFA 2FWIA 4OI2A 1YA8A 4LHEA 4RHTA 2X8BA 2O1EA 4CTNA 4PXAA 1P2SA 3GHHA 2PMCA 4J1TC 4UNPA 2Q5HA 3G8DA 4QJ5A 2YS6A 1GA4A 2VTEA 3DBRB 5JH7B 2GRUA 1WWKA 4FYIA 3NAMA 1K4YA 1Y6QA 2ORVA 2YC4C 2FLKA 5AW4A 1NY6A 4JVLA 4NLLA 1NWCA 4QUGA 3EDOA 5B7GA 4YAFA 3GCGA 1DFIA 2OCBA 2C5LA 2FUG1 1KYIA 4Q7KA 2GFQA 4IWNA 3RJZA 4B3XA 4URVR 4EUKA 4D42A 4CR6A 2LW7A 3A1DA 4MB2A 5FUYA 1P1RA 3EVZA 3LVRE 4LYEA 4QL3A 4YO7A 3A6JA 3W9YA 1EMDA 2AHOA 2I1QA 16PKA 2JFOA 4ENQA 2ZRDA 4OHPA 4GOJA 1QIFA 2XAUA 1UZNA 3CNNA 1WXHA 3CNEA 2JLAA 3B7WA 2RAVA 1W8IA 3IBFA 5EJ2A 1IJKA 5C31A 2OR3A 4DFDA 1QHIA 3HDTA 1QIEA 1Z6QA 3H04A 5D01A 3AW9A 3ZU5A 2IKSA 5AUOB 2O2YA 5FWXB 4AQ7A 4W7SA 2OV2A 4IH4A 5KOJA 1NF9A 5AVTA 1XQVA 5EFZA 5CBPB 1T4CA 4CIAA 1E3WB 3D0OA 1D2HA 1NXVA 2RGYA 3MVEA 3UCEA 4XRRA 3Q1LA 2DKNA 1JE0A 3DS8A 2JNWA 4E6EA 4DDWA 1RJGA 1APBA 4DKJA 3EMDA 2JB9A 2QB5A 3EULA 4OOEA 1CS0A 4GOMD 3E61A 4AN1A 1EDDA 2RGAA 3DLTA 4GX0A 3FWYA 4OI1A 1V7PC 1I94B 3MJTA 1O95A 3FPGA 1BNCA 1ECGA 2C58A 2W7TA 2ZXFA 3IT3A 3THRA 4BQQA 4IDCA 3D5EA 2G9RA 3AHHA 4ZD6A 1A5AB 3AKDA 4A9AA 1YIDA 2PT9A 2HO4A 1X86B 1A88A 1NUAA 3IIMA 4II3A 4GX5A 1YL7A 3LQ2A 4I5GA 1V43A 5JISA 1NAIA 4CXMA 3NTVA 3H1TA 4X62B 1OFVA 1E1QD 1OWLA 1HH4A 4CETA 4YUXA 3FBTA 4AJ9A 5EHQA 3ZJTA 1YAJA 3N8GA 3CEJA 5AKJA 3FYUC 1R1DA 4PLVA 1B0AA 1CE8A 1LVUA 2AYYA 2IOYA 3I2GA 3FWNA 3OPQA 2H6EA 3OCUA 4ZCQA 2IWRA 4Q4CA 3ELDA 3ZCQA 1ZA1A 4BN5A 1SBHA 2IYQA 2J5BA 2CW5A 5EE3A 3AR8A 4AJNA 4HP8A 1F1JA 4I5DA 1SC3A 4M53A 1KTVA 2VJDA 1PUJA 2PMWB 1CUYA 3SDSA 5F5LA 1AGNA 3ULKA 4LJAA 5FBVB 1ISRA 2HZBA 4D0SA 4GR5A 2QP9X 1JHPA 2PUFA 1CP2A 4B3MB 5F23A 1XU4A 1V8PA 1ODCA 1U8XX 2QMQA 3MUOA 3X3HA 3D6TB 4QIHA 1N2SA 1JHMA 3HKDA 4LPSA 4POAA 6YASA 2P9EA 3WAJA 3I1JA 1UBFA 1GQFA 2OG1A 1J7KA 4YAJA 1K6IA 2DQZA 3GUZA 3S7ZA 1LLQA 1W46A 2PEYA 3NETA 3GK3A 1JHUA 2MWMA 4IWYA 2AQHA 1UF9A 2G17A 2H54A 3LYHA 5C52B 1XAJA 2A3NA 2F64A 4YQYA 4E0BA 1PYGA 1R5NA 2C5AA 4H0NA 3D6MA 4MNTA 5DP1A 3W0LB 1N2XA 1M2FA 3ASUA 3W77A 3UZUA 4YJKA 4TLCA 1WDLA 1OOEA 3OWOA 4OF4A 3HB0A 2JFNA 4NHOA 4TLAA 3AOEC 3N39C 1T1GA 2DF8A 2YBEA 2QYHA 3BEDA 4IIJA 2HDWA 2B4KA 1HYHA 5KDLA 3C7DB 2G1UA 4ZGGA 2HF8A 3EVFA 2MR6A 2HWXA 2VDWB 1LLDA 2R86A 4JKIA 4YA6A 4YUWA 1GV0A 4CF7A 1ECFA 3C7KA 4TT3D 2QRGA 3NP7A 4MUIA 3V33A 2A57A 4J9UE 4FGSA 4NDAA 5GJCA 3Q6NA 3NNSA 4V3BA 5D2CA 3ESZA 3AYZB 4MVJA 1QIKA 1Q57A 1F2UA 2H31A 4AY6A 4KXMA 1JFTA 3AL2A 3CE9A 4IJVA 1TU0A 2PL1A 2PV7A 5K3EA 3F74A 4CBVA 1YKSA 1E5VA 3MGBA 4F2GA 2PFGA 1X7WA 5HCIA 5ALRA 3CHYA 1CB0A 4KXNA 4DS3A 1H0SA 1QIJA 2B2NA 2XTNA 4LXUA 3RVPA 3IQHX 3PNMA 5ES3A 1XDSA 1EK1A 4Z3KA 5HSGA 1JTFA 3KV3O 1DOZA 1Z5WA 1YIAA 3HUUA 1JWAB 2AMFA 3GPDG 2JFHA 4CG0A 2QNRA 2VJLA 4WLEA 2FX5A 5L53A 5CFQA 3GEDA 3E2PA 4M1ZA 2EBUA 1O4VA 1E9EA 1YJXA 2WUWE 1RIFA 3EGXA 5ERXA 4GEGA 2COEA 5EKTA 3SU8A 2J8ZA 3DHVA 3W1VA 3WYCA 3REFA 4ZQCB 3RBVA 5CA1A 3SJAA 4YK7A 3GLTA 4L51A 1YU9A 3IDAA 3MW8A 1YBAA 1KQNA 1WQ4A 4X65B 1DB3A 1LKZA 3AIIA 1Y63A 4CL8A 3OX3A 5EE9A 3AF4A 1VFPA 1VKHA 1K5PA 3QXXA 4FFOA 1Y7HA 1WDTA 2OWEA 3T9FA 3AWIA 1E8DA 3CYFA 4FBMA 5K3FB 1UKYA 2HK8A 4NYIQ 1XPUA 4D96A 1WDKA 1L7OA 4BL5A 1HNWB 1H1DA 2FVXA 2NXEA 3TD6A 1QX4A 4G26A 5DBOA 2C4MA 2IK8A 1S2LA 1OE0A 3ITEA 1WU7A 5LP6F 3G8CA 1CZRA 1JIXA 1MIOA 1OCEA 3UB2A 5KC8A 3ZUPA 5AIBA 4JK3A 4UNSA 4X71A 3T3PB 4IIJB 1UJ6A 5EMNA 2HO5A 3A1CA 4KX5A 2WWXA 1A9QA 4WBNB 5K8IA 1RQPA 1IMOA 1O6FA 2XPCA 3M89A 1O94A 4RK6A 1N6LA 3SQWA 4KL8S 2XA2A 4H31A 1S02A 3O9MA 1YK0A 1S6YA 2R60A 4IFBA 2HQRA 3C45A 4FGKA 4JMPA 3DVSX 1XDDA 2JI8A 4S12A 5SYMA 2IIPA 2EWVA 5AESA 4KQXA 1GPKA 1LVHA 2WJVA 2TMDA 4Q12A 1MEEA 4TS3A 3KJZA 1KJYA 2XXJA 4ZVLA 5BNIA 3VR2D 3DNMA 2Y8EA 3HDYA 3ESDA 4UDOA 1XMIA 3R3YA 1PR5A 3HSSA 4KREA 1YMQA 1QYDA 7REQA 3LQKA 3W7VA 3ETEA 2EWMA 4J16A 4MZDA 1O3YA 1LS1A 1M7BA 1VM6A 4CEIA 5DMXA 3ILSA 3C5VA 1UR5A 3AB8A 4KB5A 3S1AA 4BNJA 5GONA 3AEQB 1R00A 1VLQA 1YE5A 3L7OA 2R8RA 3ZKAA 4Z7NB 4HNRA 2G7ZA 2XJ4A 1NKSA 5CXSA 5AKGA 3B2NA 4B44A 3BMNA 1XTTA 4FR0A 4M1WA 1UBJS 3K9GA 5HGXA 5DHUA 5K8TA 3F47A 1C4XA 3BWXA 1KFJB 4GLLA 4PWZA 4DG8A 4B3RB 4GO1A 4WNAB 3G7UA 5CH8A 5AI6A 3T9CA 1V9LA 1IJFA 1T0JB 2NO5A 1G4HA 2VWHA 3HJBA 3O26A 4KWIA 2UYOA 2W9XA 2Y1KA 3DR5A 1WMBA 3MEQA 2LTAA 1O54A 2AZ4A 5IUKC 1OX5A 3R8CA 1T2CA 4AMUA 4R9SA 2IL1A 5GADl 2UUPA 3B1ZA 5DU2A 3V32A 4ZJYA 1GPMA 2ZSHA 2BR4A 4J0QA 2HXSA 4RHFA 1U5BB 2W8BA 3H4IA 4M9SA 4ARBA 2D1FA 2VATA 3SKVA 4P4GA 2ZRBA 5LQRA 1VGQA 1R9JA 2V9PA 4JC5A 1PFYA 4V0OA 2BKUA 3DZCA 1EEHA 3OZCA 4NJEA 4QDJA 1JLSA 4WY8A 2BH9A 1SQ6A 3S2FA 2VO1A 5DOZA 4C89A 4DQXA 2GDJA 1PJ3A 3GBSA 4WERA 3UTDA 4DZRA 1EX6A 3JQQA 4B9AA 1WUKS 3JZFA 4H6VA 1LTKA 1YRAA 4P86A 4RPCA 1KNQA 2X3FA 3M6FA 2O8VA 2JH3A 5A04A 2YYZA 6ADHA 1G8FA 4QDTA 3OP1A 1PSZA 3CY6A 2QMUA 3BQ9A 2XE4A 2AMJA 3PQDA 5EPUA 5FFMA 5H80A 2C42A 5IH3A 4C7MA 3QX9A 4MK4A 3QF4A 4ZAXA 1X80B 1DG3A 2FF5A 1F5NA 1TJPB 2QL6A 4HD8A 5I3ZA 1UAGA 4II2A 4H59A 2OT3B 1GT91 2QEQA 3FWZA 3CTMA 5LKRA 3NPAA 1OREA 3AEKA 4J6FA 3JZAA 3L4BC 4G8JA 4GP6A 3O84A 1N25A 3WLFA 3K4HA 3AVQA 4HGYA 3D59A 3DB1A 3TIXB 1F8GA 3SMVA 3ESAA 4H3SA 2BGNA 4U63A 3W7AA 4Q4HB 5DI3B 4CEHB 1JPJA 2ZBVA 2TMYA 4W1SA 1PYDA 1XRRA 2NTVA 2YWFA 1JG1A 1OT5A 2HUPA 3HYTA 4BKOA 5HA5A 4EG1A 2BZ1A 3IUPA 2D5CA 4B4WA 4FFVA 721PA 2NO0A 3RRZA 3L04A 4Z2YA 4OQDA 4YXWD 2XNJA 3IQIX 2XCTB 3KLOA 1DOAA 3HHPA 3QUAA 4C6RA 2BF7A 3LF2A 4DYVA 2XQKA 3PFGA 4EK9A 4QSMA 1V3TA 3KLBA 5JCJA 5CFRA 1W1IA 1MW9X 4JKYA 1QYCA 5HGJA 1W5EA 3U4GA 3ICPA 3HUDA 3IESA 4AWBA 3N3BC 3QKSB 2VQFB 1NMEA 4UZSA 2OHJA 2VHWA 5CA0A 3H2YA 2Q3MA 4NJEB 4EUHA 1M1NA 4YEDA 3UT6A 1TW2A 1I33A 3OE5A 1LZKA 3ZHZA 1DKRA 1SCQA 2OWDA 1W34A 1NIPA 1VYHA 4MKRA 3FPKA 4EQ6A 1ZJ4A 1FMTA 4D5GA 3C1UA 3OCXA 2HIHA 2IOFK 2VDPB 5CEFA 2YKGA 1RKXA 1U2GA 3Q7TA 4MO9A 4JJKA 1XUOA 4TRMA 1WZCA 2BEVB 3C7CB 3ND8A 4YCSA 3KR9A 4ZT5A 3TL6A 1IM2A 1M2HA 2X2PA 4FS8A 3AUJB 3O8QA 2ZTUA 4LYJA 1KJ9A 2UYYA 1XVAA 4DQVA 4PBTA 2W43A 1JEQA 4QTUB 4ZVMA 1DAHA 2D54A 4YR9A 4QD3A 3UMVA 1E1LA 4OLAA 4M22A 4XD2A 3ESYA 5CLJA 3K9QO 1GGJA 4NJMB 3REOA 3DLPX 5ED0A 4HDSB 4Q4HA 1ST2A 3IFSA 5DTMA 1A27A 2X4DA 4WXMA 1Z4JA 3VI4B 1ND5A 4PHFA 2JEZA 5DNUA 4M89A 2H1HA 3O94A 1FBNA 4G01B 1FYXA 4IOKA 4WLUA 2W2NA 2PVCA 4EPXA 4IO0A 1L6RA 4RGQA 5AHXA 3C85A 5DBHX 1SKAA 1AKTA 2ETXA 2WD7B 2ZSBA 3KQVA 4JEIA 2X8AA 2O2EA 1H3EA 2LUOA 3E5RA 2Y1XA 4AUMA 1Q77A 3V1YA 3IILA 1F0KA 1P5HA 1M10A 4TZ6A 2A6PA 3HU1A 3MCVA 4XJVA 4EY6A 2W00A 2YQ4A 1TC2A 4ZALA 4C2BA 4D82A 4DRYA 5IUJC 3WHIA 1OZFA 1HT3A 1E66A 1SHLA 3PPXA 1JPNA 3LQYA 2ZDHA 3OQIA 5GV7A 3RB8A 4CLRB 3LLVA 3CJRA 4H3HB 1F12A 1E3MA 4IHKA 3EUAA 2SBTA 3WHPA 4NZ9A 5LXTA 3ZIAA 4S35A 5JLAA 5F3RA 1VHLA 4L0MA 1WUYA 2IUFA 5ADHA 1ZCFA 3VC2A 1XCMA 3EQ6A 3JYPA 3ZGVA 8AT1A 1GTG1 2NZYA 2ZS9A 1R74A 2QGNA 4EYOA 3UNXA 4LVNA 4L4ZA 5EMJA 1NP7A 1J2RA 1XNJA 3O4GA 3AHGA 1XZCA 4COKA 4XQGA 2B6NA 1KEVA 1RDFA 3GARA 2B6HA 3TS1A 4JP1A 4K6OA 3ZNNA 1GSHA 3GFFA 2Y1FA 4FD2A 3KKPA 3F6BX 4JU8A 1I3MA 4MJ3A 4EY4A 4NJMA 3SHOA 1WF3A 3MLBA 1GZSA 1XGKA 2ORED 5LQAA 3RVOA 2BTQB 4NK5A 1B00A 1A9ZA 1DDOA 1OAKA 3B12A 1G5HA 3EIUA 3SIPA 1VJ5A 1AK9A 2RAUA 3DE7X 4KHPB 2GB4A 1SXGA 2DQYA 2G9UA 3I30X 2P1RA 2D62A 2PQ2A 1N6IA 1XIVA 2W8BB 4ETWA 1PFQA 3O2QB 3BUSA 4FSXA 4PLYA 3REQB 1G20A 4IG4A 4E1BA 2GO7A 2X0DA 4FMDF 2QQ0A 3EBOA 5K8LA 4ND6A 4TV8A 1THTA 1B8PA 2JGIA 3P5BA 1JMYA 2EP5A 1MABB 3OF5A 4JBNA 4ZKEA 5B64A 5LNK6 4DB2A 2R1ZA 3G2PA 5KC9A 3LPCA 4G1FA 1H2ZA 1Z34A 5ALJA 3DMDA 4LJ6A 2CB9A 1SBQA 4M0EA 3MBOA 4ZYYA 4RANA 3HBFA 3AF6A 5C34B 3UF0A 5C4MA 4F91B 4BPRA 2Z8YM 4PLZA 5EUBA 1CEEA 3PWZA 4RTQA 1OV4A 1XF1A 3LVFO 1LRKA 4OHRA 4P81A 4TYMA 5CVEA 3E05A 4TKLA 3NEPX 4AYWA 3LKZA 1LBIA 1P0CA 1Z6YA 3DBHA 1KMMA 1SK9A 5KIAA 2YW2A 3N5KA 3L1JA 4RWEA 4EY8A 2ATVA 2ZYDA 3ECSA 5SICE 4J0JA 1SFRA 1Z5NA 5BQOA 1ZM3A 2C98A 4OBBA 4EB0A 3BD9A 3R9IA 5KSYA 2YYYA 2AXPA 5DYTA 1KAEA 2PRIA 2YMMA 4MR8B 4BRWA 5FA8A 2Z6QA 1LS6A 1N8NA 5KWJA 4OGFA 4FHEA 1RJFA 4YECA 1C29B 4MICA 4C3VA 5JADA 1GQ2A 3UW1A 4ISBA 1NPDA 2QE7A 3KPWA 1VGVA 4Y0AA 5HYVA 3SOPA 3AUAA 3SJUA 1G3MA 3NWJA 4Y2RA 1LXCA 3U61B 1V37A 3HJRA 1GA6A 3W5AA 2B98A 2XZOA 3A11A 6NULA 3DEIA 4QOEA 4NEGA 4QTTB 1E1YA 5I47A 1FYVA 3C6ZA 1M34E 4FK8A 4CM6A 5JZMA 3IUBA 2VT7A 4MV4A 4C0LA 3QEOA 3SHQA 4V0KA 3WRYA 3FWHA 3O3MB 3RVQA 2P41A 4RMNA 3C5HA 1Q0TA 1D1QA 3I6YA 3IKJA 3E0XA 1T36A 1SKQA 1NE7A 1RJEA 2CHEA 2I7CA 2ICAA 3JQRA 4RVFA 1L8LA 3T3MB 3WFJA 4L3OA 1GZ6A 1R4MA 4G9EA 2IEYA 4CM3A 2BV3A 2XQIA 2XXBA 1XLWA 2JAQA 3RUDA 3QBDA 4D97A 3VKGA 4O2BA 2ZM6B 3MYYA 2O0KA 1VMEA 4FJ2A 4G1CA 4CQMD 3U3XA 3RRNA 5KSWB 2B8JA 1QHSA 2RHMA 1B43A 2J9FA 1GAEO 2FUEA 3IERA 2JARA 4M76B 3QFCA 5FPYA 3O7WA 1G8JA 2YUIA 4FD3A 4XGRA 4BYGA 1CE8B 2DJIA 1M8JA 2Z30A 4KZKA 3VPCA 2GYYA 4LOKA 3U4DA 3EGXB 3MJFA 1P77A 5E1OA 1QLJA 4XFDA 3KPVA 3R7AA 4C78A 3FTFA 2ZCVA 1NUHA 4ND8A 5JYEA 5ALYA 1C30B 2J67A 5B4UA 1TZBA 5K0JA 2FK8A 3LCMA 4PYNA 1Z68A 1W0KA 4IIGA 3VPDA 3A2NA 3I6IA 4I4TF 3PUHA 1BWRA 1GXSA 3LJKA 2FY8A 3PZBA 5BYKA 1IZ9A 2FP4A 4L8VA 4DT1B 3PI6A 1YBHA 1U1EA 3NBZC 5FO1A 4QHYA 2QUKA 5B3KA 2ZR0A 1X3SA 4JFRA 1YCHA 4ZTZB 1JLRA 5IK2A 3TB6A 2HLPA 4AO8A 2GNAA 2QX7A 2OCGA 2O7VA 1NVTA 3PLRA 2QM7A 4LQDA 4EG0A 5JAUA 2W4MA 1L4BA 1GG9A 1UBKS 2C4VA 3IUSA 2X0FA 3TR6A 2PX3A 3BBLA 1U9CA 2OYCA 5FH9A 2IS4A 2F3SA 1EGVB 5E7JA 1Z2CA 3L8GA 1UDRA 3KJNA 4U1RA 1YWGO 3WZMA 2JLBA 4IM7A 1GVNB 2ONZA 4ZOLA 1Y48E 2BBWA 2Q3EA 4AMYA 5C4IA 1P2FA 1NQTA 1A5SB 1XU9A 4PSAA 4BMDA 2JHAA 2XE8A 3COYA 4GX1A 3I9FA 5AVUA 5GJVC 2ZJ5A 3RYFB 2PBZA 4B2IA 5IFLA 4J1SA 1XZMA 4UM8B 3OPXA 1NC1A 2QJWA 2WMNB 1NOJA 2VNSA 1P4JA 5A7GA 3RSGA 3KKEA 4JLVA 1Y3BE 4MRSA 4J76A 4JC4A 3LUCA 5EPOA 3FNGA 3EFEA 4YLYA 2VJMB 4LTNA 2FU5C 4M2LA 1YR6A 4NH0A 4R1MA 5DJ5A 4HVTA 2FFHA 3TL2A 3VJRA 4AO6A 1XN1A 1XROA 4OAQA 3FGPA 2YXLA 4QLOA 3EIFA 2V54A 3SHFA 3DO8A 2PWPA 3GYBA 4BO9A 1RCUA 4U2CA 1W4LA 4L8LA 3F8TA 1NYLA 4E32A 3AIOA 3LF1A 3LT5A 4O8ZA 4Y2VA 3W5IA 2FF7A 3WGQA 3BA1A 1P4SA 1JDNA 1IEVA 2E87A 4WD3A 4BLTA 1KORA 1T9GS 1YS2X 4N39A 3RASA 1KI1A 1EUYA 1HLFA 1XALA 1D3AA 1TLLA 1V45E 4WA7A 3V2HA 2NYRA 3QEBZ 3R7WB 3NVMB 4UNQA 1NXWA 2FRXA 4C7OB 1K86A 3BK7A 3DDHA 2XMBA 3WDKA 3Q7RA 3QVUA 4LKOA 5IN5A 2GEUA 4IBOA 5JAOA 1JPUA 1KZ4A 4GWLA 3FFBA 4D8VA 1MO5A 5KNDH 1X8XA 2BF4A 2JRLA 2WF6A 2DLNA 2BFCB 1J97A 2QAGA 2FQWA 4RY0A 4TQ9A 3ROEA 1XZJA 1MRNA 3UHJA 2FA9A 4B4OA 4BLOA 3U16A 2VXYA 5EJGA 2NMVA 4JBHA 4Y8VA 4BGUA 1K97A 1PV2A 1QZUA 2ERXA 3H5NA 3WWZA 4D26A 1O6GA 4DEVA 5F7JA 1TCAA 4C4ZA 2IVFA 1DRWA 1QX3A 4E3WA 3E27A 3CG4A 1G291 2J59A 2GBCA 3M1LA 4EMBA 4CIWA 3PQ8A 1DKMA 4KQGA 4ZT3A 5T4HA 4PNHA 4BQOA 1CR1A 2J9YB 2P1DA 1PJCA 4TXJA 3VR6A 4TKVA 3KJXA 3ODGA 3IR7A 5F2EA 1K98A 1U2TA 3MSXA 3I6QA 1S3GA 2ODPA 5AKEA 3PRYA 3C1AA 3FPHA 5DHTA 1A9PA 3SVTA 2FWRA 3J7TA 3WZLA 1ONSA 1E3IA 1F1BA 2EP8A 3PUKA 4FSDA 4BEJA 5KQSA 5JV5A 3ZVMA 1EWYA 4PAMA 3ON5A 4R83A 4IOMA 1JB1A 4MQMA 5FTNA 1AQUA 4YJ3A 1KOGA 4GPZA 2ZI9A 1UC4B 2NYVA 4ZOAA 1YVPA 3LO8A 1L7EA 3G2QA 1RT9A 3TFOA 3GH1A 2I2AA 2QKYA 4EFKA 3CH6A 5FOUA 4JLJA 1T4CB 5EQJB 1JFSA 4CHTA 4MWGA 3J7AC 3ANXA 3LUJA 2COUA 2G40A 4YS6A 2X2EA 1N2CE 1VBKA 3CRZA 2MINA 2R84A 3SQLA 3VNRA 1VE9A 1B8OA 1GGHA 1I8TA 2CCGA 2IOQA 3F9CA 5JSZA 3DBLB 1AKYA 2PX8A 3A6HA 3HSKA 3WJ2A 4Q9JA 3T5AA 3A2KA 4R98A 3NTOA 3DD5A 1IQPA 1ULZA 2F9FA 5CLIA 2VQ3A 1BCSA 1JNYA 2ZAOA 3ENQA 2VQ6A 4Q9HA 2YHUA 1ODJA 2FPPA 3FSGA 1WCIB 5FAXA 4HNUA 4H7JA 2PT6A 1WW3A 2OHGA 1MO3A 2ID8A 4MRVA 3RW9A 2CCJA 4ZOQI 3DOUA 4TRNA 2FXVA 4P6VF 3AJDA 4BGEA 5H8WA 2XTZA 2VH2A 3W5DA 4OAOA 2WP0A 3LCJA 3EB9A 1V8ZA 4IDGA 1VCIA 2XMDA 3UW3A 4AB1A 4MI3A 2Y4OA 3AHDA 4O4IA 2R2AA 2QTHA 4DXAA 3GJ3A 5KWSA 5D5HA 1KEKA 3JW8A 3B8HA 5F9MA 2RKWA 1YQGA 1LPSA 2IC5A 3VOSA 5I5GA 1KO1A 5IZCC 3NUGA 4EA8A 3BXGA 3E5MA 1WBDA 4NU5A 4REQB 2QTWB 2W5UA 2ZZKA 3GEHA 3ZEAA 3LKBA 4B2LA 2V3VA 1E6EA 1S2MA 1BAPA 2DBVO 1OBHA 4EHKA 1IRIA 1Z2AA 4EHHA 1LQTA 1N7GA 1KAHA 4Z9AA 2PRJA 1QLWA 3KLPX 1LTQA 5MHTA 1ZJ5A 3A28A 1ODLA 1ZSVA 1W1WA 1JVSA 1CULC 2CBZA 4GECA 3QW4B 4JLWA 4O2RA 3GWGA 3VQTA 1XCJA 1P9WA 1OHHA 3ZDRA 4AO7A 1VG9B 4MV1A 1U5AA 1YUBA 1W25A 1FDVA 2WIAA 1RNLA 4WNAA 4CHGA 3GGSA 1VIYA 3GT7A 4HSGA 2F9LA 2QN8A 3K6SA 2XOKA 5BSUA 3N2GB 1HE1C 2HHLA 4RF4A 1JEOA 3SR3A 1KE1A 2AR0A 3STTA 3GDFA 4GU5A 3KL2A 4KV9A 1Z0IA 4A82A 3G2KA 2GCIA 3CZ9A 1EJ2A 3WNDA 1RIIA 1L4YA 1SU7A 4R1OA 2WI8A 5IYZF 2OBLA 5LXTF 2YVUA 1BQ3A 3DMHA 5AW3A 2RHWA 3RLIA 1T9BA 1F2VA 4KSCA 3LT4A 4AYTA 2FQXA 4DADA 3HJNA 2EJTA 2X0RA 3AI1A 3ST7A 1TD9A 3GZ4A 3UJPA 1U7PA 5F5NA 5LNK1 2B99A 2PM8A 1T3TA 1KXJA 1B8VA 2EERA 3OCCA 4HQ0A 4YMSA 4C87A 2AV6A 1YQXA 2H3HA 2A0YA 3KDAA 4P84A 3JX9A 4W4TA 1EP1B 3L3BA 3KDPA 5L8VA 3EA4A 3GA0A 1O8CA 3LRXA 2OYRA 1WCIA 1Z08A 2CXXA 2H1RA 1DJPA 5CX1A 1WCXA 2RHTA 3SPXA 5FUQA 1RP1A 5JS7A 2R7NA 3IUYA 4HOYA 4KAFA 4L6CA 1Z17A 4P2BA 3QYFA 5DIZA 3TZLA 5DISB 4HX5A 2CVZA 3G7NA 1PNVA 2HK9A 2QDXA 5TVGA 3C8DA 2P65A 5FBRB 2KJQA 2YRWA 1QKJA 2QXUA 3A9TA 4U7WA 4Z86A 4IEFB 3LM8A 3NBUA 1H66A 4M55A 4N7BA 2QT1A 4PW0A 2HPHA 4UQLA 5ALFA 1U9IA 3PFBA 3CIOA 2WF7A 4BWFB 1QP7A 4URXR 3K6JA 4RL6A 3KL4A 4WOCA 1TZ2A 3IEVA 2WQ7A 1NYTA 1EHIA 2H2DA 6Q21A 1CEQA 3ITDA 2A9PA 2NO1A 4HTFB 3DEKA 3Q0TA 4JC0A 1ULUA 2LIPA 4DR4B 1GPYA 2G4LA 4OQQA 4QGSA 2FEPA 4CTOA 1ICIA 2YV2A 5HM8A 5EYPA 2QY9A 1DPGA 2ISCA 2FPUA 4KNVA 3PA8A 4X8HA 1PUXA 2MSEB 3GNSA 4R8VA 2OA0A 3RSFA 1F4LA 3IMGA 4I6EA 1C7EA 2P4EA 4MQUA 5LZ8A 4BLQA 3JTMA 4BEBA 1ODSA 3LC2O 4BUCA 1LU9A 2K7ZA 4M98A 4MSUA 4P2GA 2G6BA 2QS9A 5F1PA 3KQTA 5IXJA 1KI2A 5EXTA 3Q40A 1XYVA 1N33B 3WSVA 1YQQA 3QA3E 1UXKA 3H42B 4TTQA 3EXFA 3DFUA 4RH1A 4QQ8A 4WINA 4R9RA 5BRNA 4JL8A 4JUCA 4KFSA 5ALGA 4NE9A 3UFXB 2PUTA 1ES9A 4ZQFA 4FHDA 1UEJA 1L4LA 3CEHA 3QVVA 4CEIB 2I7XA 4DJJA 4YYZA 5C7YA 4J3FA 5ER9A 5IF3A 2JLWA 1JSCA 4N82A 4E5UA 2JLZA 1XRQA 2G9QA 3MTQA 3GA7A 3DCIA 5AT1A 3LUHA 2OBXA 2VPZA 3PJDA 1Z4LA 3OM0A 4MP8A 5PNTA 1BEZA 2QD2A 4FZ3A 3NGMA 4RJLA 1RS0A 1R6DA 1RAAA 1M34B 2G8LA 4GSLA 1ZBDA 2XOXA 4Q03A 4RELA 4U0JA 4ZCLA 4IDAA 4P80A 4DXHA 4G5SA 4AYXA 3KQOA 4IEIA 3GJ4A 4WT7A 3CZCA 1F0NA 4MCAA 4BYMA 3TJMA 3K9LA 1SCDA 2Q6VA 3SICE 6REQA 3FOFC 2B1IA 5ALPA 2FG7C 4QYWA 4BQNA 1QAOA 3LNTA 3NC4A 1K6MA 2HHCA 3KLMX 3G82C 2XH8A 1XCGB 3AM5A 2QY6A 1F0YA 2WKQA 1A9XB 2Z8ZA 3O4RA 5ECDA 1H5NA 3V7UA 4ZEXA 4PX9A 1YJ8A 4G1MB 3T3DA 1IZZA 2BFMA 1XDUA 1L5WA 1W2HA 2DVMA 3E7FA 5CP8A 4DLKA 1MC1A 5HDQA 5CVDA 2WHPA 2XRMA 3QIAA 4F3YA 3ONWA 3CT6A 2JD0A 4G3XA 2V9ZA 2XLCA 3C2QA 4JVMA 5LP6B 2ONCA 1DRVA 1JJFA 1Z36A 2G1AA 2ZJ3A 5EIBD 1AA9A 3U4HA 4UHEA 4R0MA 2A84A 5KU7A 1RHUA 5FD8A 1QC5B 5KKAA 3ZWPA 3LHDA 2NQ2C 5CYGA 1UBOS 2HF2A 1CZUA 2WJGA 2PFKA 2Z4SA 4KRGA 3ROPA 3T3GA 1QJ4A 1NN5A 4BMYA 1H69A 5ABPA 3H5LA 3S2ZA 1XTPA 4C07A 1E7WA 5A4KA 1PD0A 2V4UA 4IGFA 5ALWA 5BT9A 3PC8A 2B25A 1JZTA 1Q83A 2P2LA 3GFVA 2IE0A 3MFQA 3S70A 2Q0SA 4YDHB 3V97A 1IIBA 1U0JA 2VWPA 1X1QA 3HACA 1CLUA 3B1VA 1PR1A 1VLLA 3N53A 2FJUA 3GLIB 2HOQA 1RHQA 2W11A 3I8SA 4EDHA 3LPLA 1SIWA 3GGOA 3A2MA 3E9YA 5KYUB 3EZFA 3IT0A 3ZWVA 2LGJA 3EZNA 4OQFA 3T9EA 1K08A 4JI1B 5GVSA 1DEOA 1NOIA 3BCRA 2K5UA 4YACA 4ZN6A 1MXHA 4Y7CA 2EKQA 1GSIA 3E23A 1R0XA 2J0SA 2OGZA 4R1NA 4YAKA 2ATCA 2YJ3A 2WM2A 4L95C 4L28A 3P9IA 1W30A 3U80A 1NVXQ 1H85A 2P2GA 1GGVA 2OFPA 3DZ8A 3HV0A 4MUAA 4BX0A 4U8HA 4ZO6A 3X1JA 2FW9A 3DHYA 1P8JA 4XGNA 2P62A 1U0OC 4XKJA 1XV5A 5E9WA 4Y2QA 1NM5C 1KHTA 2QLFA 2FPKA 1HC7A 1LDGA 1QFXA 3T7JA 1R9NA 1E0DA 1SXJD 2JATA 5AJXA 1YZGA 3FWPA 4KDEA 3ZOZA 1F7VA 3BBPA 4EKYA 1SVMA 1XA4A 3NHSA 3EHEA 3ZY4A 4ETIA 3EGIA 2QPAA 5LYJF 2I3ZA 1E64A 3EZ6A 4PZEA 1A7AA 2G09A 1U99A 3LCRA 3AU8A 1K1EA 4YJFA 3LPDA 1PW5A 1XP5A 4ZXPA 1C41A 3SQDA 3UMJA 4HV4A 5T6BA 2IEIA 1TFRA 3PCRB 1B6GA 4WXPA 2R66A 4PLCA 1KO8A 4F8JA 1P5RA 1WXIA 3FOCA 3MMSA 4LSMA 4MH0R 2QSUA 3V6LA 3ZYZA 4EVIA 3RCBA 1I3OA 1WW8A 1JFFB 2WTMA 4S3MA 1M8GA 5M7EA 1T24A 1UFQA 5A03A 4TMWA 5FA5A 1B6SA 1X87A 3SQXA 4RD2A 4IDDA 2XNSA 1OH7A 1DUIA 2C07A 3PD7A 3SR0A 4MVJI 2PWYA 4W8GA 1AZSC 3M9XA 4UPDA 3RTEA 4LCJA 1K8QA 1T8SA 3JYNA 2B37A 2GVNA 5BWOA 2YYSA 5KYVA 2IPNA 1FSGA 4D9GA 3SHWA 3B52X 3OZAA 3V4OA 1YV9A 3I2KA 3WRYC 2JG3A 3PDHA 4PO8A 5KTTA 1S8OA 3OBBA 4Q48A 4QBGB 4EQZA 5BMVA 1YGPA 1OWOA 2I2DA 3E7WA 4R1TA 2X0EA 3PQ2A 4RDCA 2RJ3A 2JJQA 4RFLA 4X97A 1G20E 3QELB 3TI7A 4AURA 3JQBA 5A4JA 1Q17A 4QOJA 4FEAA 3KXLA 4RV9A 4JXXA 3BRWD 3QPAA 5TJ9A 5F52A 5U4QA 3RS0A 3ORHA 2VT2A 3CZMA 2DR2A 2D3WA 3H97A 4KXLA 1YTUA 4DLLA 5LL6P 4MQEA 2NYUA 1UDCA 4NWIA 5AJTA 4ZYUA 1FXWA 1K75A 1BIFA 2YVQA 3CE6A 4PZ9A 2MCFA 5KSPA 3CW2A 3GW8A 3AESA 4MVJF 2PNFA 3WGZA 4V02A 3KOUA 2ZSAA 4GBMA 2P2YA 4KLRA 1D07A 4F4FA 4WVLA 4WKCA 1YOVA 1FTSA 5A5DA 3BMQA 3DZBA 1XELA 1Y3CE 2WQZA 4TT3A 5EIEA 2KYRA 1CIVA 2ZUWA 3HB5X 1G0OA 4OV6B 2VLBA 3AGPA 1JXAA 3GA5A 5DRYA 2XGMA 4W99A 5LFAA 2F43B 1HOXA 1C8KA 1F2TA 4QDKA 3GZNB 3W8NA 4D9BA 1KP2A 4PF1A 2RARA 2ZE6A 4RMIA 5C3MA 4XX0B 3ZHQA 2GEFA 4YMWA 1MBZA 4XWYA 3LDGA 3LZDA 4NS1A 2FKAA 3PQ4A 1WQ3A 3JAKA 4EF4A 4F21A 3U7EB 5K3OA 3P8ZA 2AMVA 3IRUA 4FJ1A 5FWXA 5BNZA 5BV8A 2H65A 3BMOB 4MWOA 1HX7A 1D8TA 4G5XA 4H0CA 4HMQA 3KZCA 3GJ6A 4MRPA 3FCCA 4I19A 2XSZD 4PYIA 4A8PA 4ZMSA 2CLHB 4DN6A 1P2BA 1ADFA 1GGMA 4MAFA 5KQPA 1TEZA 5LXTB 2E6KA 3U3RA 1GYRA 4AJEA 1PWZA 1SWVA 5FQOA 2P3LA 1I7QB 2NSDA 1VJDA 4K9DA 1IBSA 4FU0A 2NU9B 2Y9MB 4DLVA 1SVSA 3AJ8A 3OTWA 1GZ4A 1GD1O 1UMCB 2HQ1A 3RGWS 3ICWA 2OQ2A 5AJWA 2FWJA 1IG0A 4YMUA 3VR4D 4BVHA 4BJ3A 2PAFA 1Z0AA 1J99A 2QENA 4IZIA 1OLXB 1YONA 2A1IA 1A50B 2BY4A 1PZEA 4ZYLA 1RXEA 1B0ZA 1ZMRA 3T3EA 3OESA 3EXIB 3MGGA 1NM5A 3O0DA 3MWDB 2BEVA 4WL0A 5DBEX 5ESRA 1D8AA 1AKEA 3DDNA 1YB7A 3RJMA 1EWRA 2NW6A 2WU0A 4Z49A 5FPHA 4QXAA 1SUAA 1P7CA 1VQ1A 2XDWA 2ZYUX 3RUCA 3EN0A 3RG2A 3BK2A 2FDCA 2D59A 1JP7A 1QQ7A 3IIKA 4R01A 5BVHB 3HY4A 1A2QA 5JARA 5EIAA 5IM5A 5KOYA 2RGNC 5EWLB 1SCAA 2H1LA 2GSDA 1W8DA 1DEXA 4GLOA 3QE9Y 2HTEA 4KBYA 4ZZ0A 4KQ1A 3RKUA 1VE3A 1R5OA 5KVVA 1XVUA 4BNIA 4M38A 4TKUA 1J5EB 4E33A 3BICA 1KC1A 3KR0A 4PR3A 2HWUA 1O8BA 2ZWVA 4X91A 4CFZA 1AMNA 2PUAA 1SUFA 3QHAA 2GHRA 2YN0A 1W5FA 3GFRA 4QNNA 3OJFA 4GD3Q 2P40A 4LSWA 2UVPB 521PA 2ZQZA 4BDSA 2AG5A 3EGDB 2R87A 1NMZA 5LDDC 3BWEA 1HPLA 1GZUA 3OEED 2NVUA 1R6AA 1YTLA 5K20A 2QAGB 4PR0A 2PXXA 5JSQA 1T2FA 7YASA 3UHPA 2I6SA 5K0GA 3DE0X 1NURA 1RZVA 3LCCA 4CCAA 5D8DA 4Z4QA 1G3QA 2HSJA 3OOJA 5BY2A 2IIVA 5HS4A 4WOPA 3WBBA 2I2FA 3EEYA 3C87A 4BV8A 4YDRA 3QEJA 1PNTA 2QTBA 2WJJA 3QVGA 3URKA 5IYZB 5FKJA 2PZGA 4HEJA 4OFXA 3OQBA 3I2IA 2I4RA 1KSGA 1F9AA 3Q0IA 1KJIA 1H1LA 2P5UA 4FUTA 4PYRA 1KOFA 4TMFA 2DR0A 2QGZA 3NORA 2J5QA 5BNWA 1CT9A 5JIBA 3GN1A 3TDMA 1I4TD 1F8FA 3BULA 4Y2TA 4ONEA 5KO2A 3PD1A 1Y6RA 3GD7A 2OXRA 2BMDA 1QUFA 3QEMB 4HNHA 4K5QA 3NRCA 3PNOA 3I34X 1W4CA 1L4GA 1FTGA 2ORIA 3F5SA 3JVUA 3TFQA 1ZPDA 1J2EA 2I80A 1ULTA 2V7VA 3VPSA 1CZKA 1HETA 5DSZA 4KP7A 3P2KA 4ECAA 2EBFX 1XRPA 3O93A 4HMPA 2VPQA 5EWJA 5I7OA 4OJTA 3PJGA 4O5OA 3FW1A 1JHZA 2FWAA 3AONB 4N6NA 4LNAA 4HHEA 3HNOA 3QYPA 3FCAA 3MTDA 3UV3A 3HLYA 4TLEA 1ZLXA 3EIQA 3H1FA 4I5IA 4J2TA 4E94A 1Y1PA 4RAOA 4AN0A 2D8MA 1Z2NX 4YALA 2BN4A 4DA6A 3BXHA 4QTXA 2M1XA 3FUVA 3SP1A 1NU8A 3IUQA 1E2IA 3RIEA 2QTMA 3TBKA 3G68A 1BVUA 1NBME 3LGSA 3O95A 3ZW9A 5AXBA 2BW0A 4JQZA 4YBZA 4GL4A 4R6WA 3GH3A 4ENWA 5JT1A 1ONNA 1PQWA 5DEIA 3B48A 2Q3BA 1D4ZA 2VHXA 5JJ5A 1KSFX 2CD7A 3EXHB 1OH8A 4TKVB 4RIHA 1E6MA 1KQOA 1W5BA 1T3SA 5CYOA 5TEWA 4NENB 4AUEA 2GNPA 4ZJZA 3WLSA 3Q7PA 3FOEC 5KNCH 1OXBB 1YJ5A 2GKGA 1KDZA 3DT9A 2PGJA 3OZDA 1UADA 1NE2A 1SVOA 4KPUB 2CYBA 5I7WA 1XA3A 3N7TA 3M5CA 3GJYA 1J23A 3QVSA 5CJ2A 4I9NA 4ZKDA 3I0ZA 3LY8A 3DW3X 3GLFB 1VPTA 3V46A 1THGA 1DWOA 5C37A 5KNCA 1QHNA 2I54A 3DYBA 2E2WA 2PJZA 3QPDA 4INPA 4P32A 4R3NA 5FI1B 3W05A 3SZUA 1C2TA 4P0TA 2HSZA 3WMEA 5KQRA 1XEXB 1SU6A 1Y8QA 2JAPA 1T4MA 3A7EA 3K1AB 2XNHA 3NWPA 2BSXA 2VDLB 2F3QA 4B31A 1GUYA 4LWPA 1O2DA 3PSHA 5JJLA 5FUXA 3INGA 2R7MA 4AZWA 2QG6A 3QK7A 3VXKA 4TTTS 5IX8A 1ZUIA 3HYSA 3WMFA 1Z5ZA 3E4DA 5IBCA 5HR5A 1IOZA 1JJ7A 1Y8QB 2MYUA 4M0UA 4UE3S 4G23A 3SC6A 2WTNA 3W5SA 3WWYA 4UCQA 1M34A 2PRYA 1NN0A 4FEEA 1LBEA 5CNMA 3NVKI 1KY5A 4HS9A 2Y05A 3ZCPA 4F2PA 1RYFA 1KJWA 2CJPA 4QO7A 2PSDA 1B2LA 3KKNA 3PV0A 1AG9A 2RBKA 3IDFA 4EGAA 2PKQP 4ED9A 3DVRX 3VR5H 4YT2A 5A2QA 2YMPA 1XPRA 5JNSA 2ACKA 1N9ZA 3BYZA 1F7UA 3A6GA 4JC8A 1QG2A 2IITA 4MKHA 3WL5A 4R2KA 3WICA 3FSJX 3L82B 1QB7A 4LE0A 1CUDA 5T3YA 2QRPA 1YKFA 3MB8A 1I6KA 2AR9A 1G9TA 5MF6A 3I64A 2IEAA 4QQNA 3PI7A 1RWXA 2GDZA 4QRHA 1UM9A 3T7SA 3ZEIA 2A35A 2VDNB 3FTCA 3GLVA 3KXDA 4K87A 2CBXA 3UMSA 4YMTA 1SKMA 4HYTA 2C29D 4FHZA 1MO4A 1WA5A 2GBIA 1SD2A 2P78A 1H2RS 2WW8A 3BGIA 3IAM6 4MROA 1VLMA 5DTQA 3V8RA 3NEYA 1YFKA 3C14C 4J4BA 1WB6A 1KBZA 1RC0A 1Z2PX 2Y0PA 2RKOA 4ZCMA 2AK3A 5LLSA 3SLKA 2ZREA 3FHLA 3GLUA 4D4MA 3T12A 3V2GA 3LUFA 2AG1A 1UXIA 3CH4B 3LLSA 4O2AA 3H1BA 4YQZA 4EYQA 5JRZA 4K6MA 5JO9A 4MYHA 1FTQA 4KSBA 2GPSA 2F1JA 2Q4RA 3LBIA 2D3TA 3RAPR 3TKAA 4TM8A 1KQFA 5IJ9A 2D4AA 2ZRHA 3ZY2A 4N5DA 3AUXA 2VK2A 3ND5A 3TX6A 3W8RA 2CXQA 1CLEA 2W6ZA 3VSDA 3CR8A 1XZIA 1H42A 4ZCRA 3BCHA 1NW7A 1PWEA 1XYYA 3TNFA 1EU1A 1RYMA 4YRJA 1E60A 3BVPA 4AJ2A 3E7DA 4EECA 1UKAA 1CBUA 2H85A 1ZXXA 3SBXA 1L9KA 2BRUA 2C00A 3N86A 4YJGB 4AKHA 2Q50A 2VZEA 2WSMA 4EW6A 3COSA 1RPAA 1HDRA 3QFSA 1SG0A 4GUDA 4JJGA 5GM1A 5FFFA 4DV5B 1FNMA 4J0EA 1C8BA 1HMPA 4UFPA 3OHPA 1FJ2A 1KAMA 2Z08A 2A5FA 3A1SA 2CMKA 4RGVA 4HTAA 3R0JA 3PXUA 5L45A 3G88A 3B9QA 5KVCA 2ZRIA 1Y42X 2ZRFA 1RKQA 3VHXA 3IXLA 3G85A 4IIDA 3CW9A 4O33A 4PC6A 1AXGA 1DBRA 3PXXA 3Q7QA 1I4EB 3R76A 5LIPA 1D2EA 1THMA 2I65A 2RHHA 3CO5A 3AV3A 3FI0A 2DPMA 1JAXA 2R6CA 3LOPA 3QKUA 2ZJ6A 4RFSA 1RI1A 1T2EA 5AK0A 4DRZA 2ZJ2A 1B3BA 4FN4A 5K51A 1CG6A 3WADA 1N7IA 2OQRA 5HKKA 1VJ1A 3D8HA 4RWZA 3MRXA 1Q44A 2PT7A 3DOEA 2PH1A 4LECA 1FUKA 1NXPA 1JDUA 2XDQB 4UD6A 5FV7A 1Q3KA 1K5GA 2XYHA 4LQ4A 4G0PA 3QH4A 4I99A 1IVNA 1N2EA 1SIOA 2JFPA 4YREA 3U4CA 1QO0D 1KDYA 1JAIA 3BA6A 1GCGA 1UZLA 1CUUA 3WQQA 2CXSA 2HTFA 3MQ4A 2QXTA 5PGMA 2K7FA 2OFOA 3K6SB 5IJ0A 1Y5NA 3AKEA 5CRIA 5K0CA 2PL5A 2R7AA 3O3NB 4PIPA 1YK1A 3PUYA 2ZTLA 3PEUA 1Q7CA 2QD1A 3DE6X 2O5VA 2C4UA 4K88A 4UREA 2X5OA 3E6AA 1OBOA 1FXWF 3T7IA 3D8SA 4QHSA 2EG9A 3NIDB 1XSEA 3U0BA 3HJCA 4QQRA 1LBQA 1NBIA 5BWNA 1W52X 1RYNA 5IABA 1ZA2A 2VBCA 1FXUA 1R10A 3PNBA 2Z3VA 4W9NA 5DGIA 2FSUA 3RTCA 4B7XA 3OZWA 4BRUA 3KJHA 3C3YA 3OQPA 3STHA 1C9JA 3JQ9A 4D9KA 4X92A 3VO2A 4Q3DA 1CVIA 4X44A 1VJCA 1UIMA 4HPXB 1XCLA 1RKBA 1ZAYA 1LNZA 5H16A 4JFAA 4LMBA 3AR5A 3E58A 2M6LA 3V8QA 1KEEA 3GP8A 4RSRA 1MDBA 1NI4B 3LGXA 1IZ0A 2XIQA 3R44A 1L5RA 4NFLA 3WSWA 1KGDA 2YFHA 3H5IA 2ID7A 3OOYA 3K70B 4W9MC 2H7XA 2Z58A 1UT8A 1LK0A 3CEMA 4L5IA 3RK1A 1VJGA 3RTAA 3KKQA 5KTMA 4QUAA 4EFDA 1CCWA 1JIJA 4IQ8A 4MJLA 2H7VA 2UU9B 4LOHA 1VRWA 4CN9A 1XTRA 4XXHA 5CLHA 1ZOOA 3RBXA 3UIEA 2R96A 2ZZMA 1IUPA 2OCAA 1N5JA 3NAGA 1RYYA 4C08A 4RD6A 4RTPA 3EC1A 4X3CA 4JYMA 1BZYA 4E14A 4MULA 2P9CA 1ADJA 1C2YA 4QBFA 1TJNA 3M4ZA 2YICA 2G28A 1UJBA 1ZKDA 3A4VA 2V6FA 2HLDD 1IBKB 2GA8A 4PG8A 3V8NA 4RK5A 3NXSA 5BXQC 1GM5A 2G5CA 1S3SA 1CQWA 1DC8A 1KR2A 1R18A 1UK8A 1EVEA 2N3ZA 1VP3A 2WABA 2YFKA 3EIHA 3NM4A 3QBJA 4MW6A 4OY3A 5UKDA 3DUWA 3TQHA 5BSWA 1QGUB 2FMIA 3LT2A 3PUJA 1NQXA 5LZ7A 4XIGS 1G3IA 3O9VA 5EJAA 5TGDA 1RPNA 1B2RA 2G88A 4MEAA 3ZZ1A 3DE3X 5JH7A 2RCNA 4PSDA 3TFWA 5CLFA 3PEWA 3G23A 2QUBA 4WA8A 5G0WA 1X0XA 1H1LB 2WV9A 3LDAA 2PQMA 2PGLA 1ZUNA 1ZSNA 4LQLA 1GKLA 4RESA 3G79A 4RNCA 2Y6UA 4CQNA 4DABA 4D9CA 3ENNA 3F71A 1NQVA 2HL6A 4HDNA 5FUVA 1AOXA 3PHBE 1J0CA 1KAOA 1U7UA 2I62A 1VYTA 2YQZA 3AFGA 1PWXA 3B3FA 3V8BA 4NEHB 2PNJA 1XDGA 3D8NA 5FJJA 4JWTA 3NQ41 4C5CA 1GWNA 3N8DA 1IDOA 1POXA 3QQPA 4ADSG 3LL4A 4NCAA 3BGVA 4HLQB 4HLNA 5E8RA 3LIIA 5DHRA 3U13A 2EF0A 2ASVA 2FPSA 2RCYA 2F3RA 1NSTA 1L5LA 4ZTUB 1CRZA 4KHZA 1Z33A 4JJZA 3GXBA 1AU9A 2D74A 5CPFA 5AK3A 5KTPA 3RSQA 1UXGA 3OAAD 3TINA 4B3HA 1GNVA 4AY2A 4JH0A 4DW8A 3OQOA 2P77A 4YIKA 1G8KA 1LA2A 4RPHA 3E53A 4MW5A 2OP0A 5A5VA 3B8EA 3GLGB 3MHTA 5AQ1A 4JROA 5EWMA 3WKDA 1JL3A 3JRXA 4GE0A 5CR9A 5E6SA 3WLKX 1B14A 2VRNA 4ALMA 4CM9A 2PX2A 4KN9S 3DONA 3DCNA 1AGRA 3E3OA 5K4AA 2IBMA 1JSXA 4BNDA 1JQ3A 1JQJC 1TYAE 2HPVA 1RAFA 2ENWA 2HY7A 5EMHA 2IUUA 1Q0SA 2QTRA 1L4FA 2QRJA 3JAKB 5KYYB 1GV1A 1FW6A 4GWKA 2GEVA 1VI2A 3VJKA 3BL6A 3VYTB 1NQ5A 4UTOA 2H48A 3KK0A 3PHIA 1GPAA 3TSYA 1SKYB 3D1LA 1Q20A 4M7OA 3TTVA 2HX1A 3HCWA 5JU6A 1M2VA 2NAFA 2OAEA 4FNOA 5ADVA 4HLUA 3S8MA 1J1UA 2R6FA 3KV1A 4D9EA 2GZ1A 4QPJC 1YGYA 1TIKA 4KLAA 1AV6A 2B69A 1LDMA 3WJ7A 1FX1A 2IOFA 1PAUA 1WABA 1AS0A 1SOVA 3ZLVA 1D2NA 3AEUB 4LG1A 4X54A 1XTSA 4MPTA 3EF0A 3OAAA 1IY1A 2QUZA 4DSZA 3NV9A 4PAOA 1IHOA 3IP9A 3PQ5A 5IAOA 1AH2A 4UU7A 4PNZA 1ZESA 4Q3LA 2X0KA 4OJNA 1J42A 1H3FA 2DP4E 3TKLA 4BBAA 4D4HA 3HZHA 1ZWLA 2A58A 1K4MA 1Z73A 2VA8A 3NW9A 4ZO7A 4PQYA 3BMCB 3B9RA 3OMWA 1RP7A 1QYWA 3NHAA 4MQBA 4RU1A 4MUNA 3ACBA 4DV4B 2ZSDA 4RPLA 2ET6A 4OJKA 2NTEA 1FMLA 5TX7A 1MO6A 2CEKA 3T1NA 4GICA 1L5OA 4DEYA 4Z3OA 1Z4IA 1X7YA 4PZDA 1PZNA 1DQZA 4C06A 3SZGA 1S3FA 4FOOA 4AZ3B 2CLMB 3OFVA 2O6LA 5AIAA 1X1BA 4GF5A 5H02A 3E03A 4G1UC 121PA 4D6YA 1XLTC 5M34A 3EE6A 2CL7X 4LY6A 2GEBA 4Z9YA 3FRIA 2AIRA 2E49A 4F0JA 5B57C 3N9IA 3T4XA 3NAQA 4ZV7A 1DADA 1BDIA 1TKCA 2QMZA 5DX1A 4DNQA 5EKDA 1PFVA 5LLDA 4TYYA 4K03A 1XEWY 4GUAA 4YP9A 1T3HA 4EABA 1N0HA 3ETJA 1BU5A 1TCBA 1P60A 2LCIA 3C48A 3K70D 2Z6AA 1JKMA 4V0ME 3H11B 2VHEA 1T3LA 4D8TA 3F1KA 2ZPUA 1IHPA 3M9LA 2WF5A 5AD1A 1US8B 2HD4A 3RQSA 5H82A 4YAWA 4CPDA 3C8ZA 2YJ5A 4CTMA 3VX3A 2XEDA 4D8WA 2BGGA 2W2TA 5THXA 4OHVA 4R2IA 3CV3A 4KOEC 4A26A 5CB4B 4CQMB 3BWBA 4NNJA 4IJWA 1FX0A 3SF8B 4F4IA 1DEKA 3QVOA 1GT6A 4GI7A 4ZMBA 2EV9A 4RQUA 4AKSA 3QV1A 5EZYA 5A02A 5JWOA 1OBFO 1L1EA 1MB9A 4CODB 2DG2A 4YP7A 4BO0A 2VF2A 2QSZA 1ZITA 1I5OA 3IAS6 4LBYA 2PBLA 1A7JA 4EBBA 1E3JA 1Z8FA 4MTCA 2WUEA 1YIOA 1K5HA 3NIFB 5E9AA 4WNIA 5HFJA 1QV9A 4B17A 1GOTA 1U0LA 2XA1A 1E4OA 3CLRC 4RZ2A 4X94A 5CVVA 1QR6A 2X7HA 3NHMA 3MWYW 4H7IA 5FPTA 3HKBB 2YXPX 1JJIA 1IN7A 1Z5PA 2ZANA 3HABA 4ND7A 2I6GA 3EIXA 3Q6IA 4KYIB 2WR8A 1LLUA 3RYFA 1J07A 4H4EA 4OJQA 4PYLA 2VTBB 5F4ZA