1V43A

Crystal structure of atpase subunit of abc sugar transporter
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
367
structure length
353
Chain Sequence
VIKMVEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQHMTVYENIAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILEVSVGDGYLEGRGFRIELPQMDLLKDYVGKTVLFGIRPEHMTVEGVHMKRTARLIGKVDFVEALGTDTILHVKFGDELVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sugar-binding transport ATP-binding protein
publication title Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
total genus 96
structure length 353
sequence length 367
ec nomenclature
pdb deposition date 2003-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1v43A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1v43A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1v43A01
4LYFA 4V0KA 1EWIA 3EG5A 4OHVA 2B21A 4TSFA 3CB4A 1W0KD 3DDCA 4JG2A 1H8EA 5DO9A 1SVOA 1EFUA 2K33A 2GAAA 5AUPB 3FHTA 2R93H 3EZ2A 3GD7A 3BWDD 4R71A 3MXNB 5M5YH 1U9IA 1RYFA 4LBVA 3RC3A 4P33A 3MJHA 1KZGB 1Z5ZA 3KB2A 2CCJA 2JLVA 1IXRC 1OV4A 5KSPA 1FL0A 1C7YA 3FKSD 5AK0A 2JLYA 2YU9H 3QNUA 4M8NE 1KMQA 3HFZB 1L7VC 4K8OA 5EUMA 1IBRA 1PMRA 1C9KA 2KSQA 3MAAC 2HIVA 4RD6A 3NVAA 1KI9A 4Q21A 4GN5A 3TAUA 1B9NA 4BFSA 4BZPA 4ESHA 5BN4A 1VMAA 2ZSBA 4KITB 1W49A 5IK2A 3REFA 2IYTA 4LF8Q 1PHJA 2VSOA 1GL9B 1JR3E 3KQUA 4LF5L 3KUDA 1D6JA 1KDRA 3FMFA 3QXHA 1F2UB 3FTQA 3AVTA 4DDVA 2RGBA 1XMOQ 3F5FA 3PUYA 3EASA 3RRMA 1ZYUA 2EFHB 3RS7A 4URVR 4TMWA 1E9RA 3CRMA 1W7AA 4GN3B 1CKMA 2E5LL 2QF7A 4YHHQ 4U02A 3DMDA 4LZZA 1PH9A 221PA 3CRQA 4DV3Q 3QXJA 1Z6TA 3KB1A 4MH0R 3AF0A 3DVLA 2QENA 5J3BA 4HEJA 2EFEB 2D62A 1HNZQ 1IW7C 1WI5A 1I4LD 4Q48A 5HE8A 5HCNA 4QJ3A 3NTUA 4OI2A 3J81k 3OE7D 1E2WA 2OXRA 3QI2A 1H8HA 1A82A 1UF9A 1OB5A 3RZOH 2ORIA 2UUCL 5B64A 3D7MA 3RVBA 1TAGA 3E9HA 4A6PA 3M4YA 4Q7KA 2CL0X 3T34A 4OGQC 3WRXC 2W58A 4WAUA 1UADA 4D26A 4HIKA 1JJVA 1Q3TA 4IOLA 5FOTA 5A35A 3GLIE 4JI3Q 1HH2P 2QAGC 4P74A 2OESA 3UG7A 3CMEA 3ZDQA 2LKDA 5TY0A 1Y8PB 4RFSA 2W0MA 3OEHD 3SJBA 2ZJRA 1XJQA 4OKSA 2FEMA 1HTPA 1NI3A 1TXYA 4MUBA 3BJUA 1E1QA 1W5SA 4UPAA 3I4MG 2J41A 5KPJA 2QU8A 4HDCA 2QEXA 1VCIA 4JKIA 4WBSA 4K81B 2ZYVX 1SVMA 3NG1A 5BXQC 5J4VA 2O52A 2PCFB 1NVUQ 2FPLA 2LSSA 1E96A 2CKZB 1E0KA 3LBNA 1K8AC 4NH0A 5EE1A 2CK3A 2O0HA 2WKQA 2ASBA 2J7PA 5C44H 1ZYRC 2AKAB 4E5UA 2JE6I 4TL8A 5CDFA 1QVFA 3BB1A 4C4PA 5GJBA 3SDZA 4GNXC 3VR2A 2E1RA 4JBXA 4ALPA 2NQ2C 1OJLA 2OBNA 4RCZA 1NN1A 4GLVB 4EQ5A 1FX0A 5FTLA 2D0OA 2R7ZG 2YWEA 3L43A 4H1VA 421PA 2VTKA 2IS4A 1KL9A 5KPDA 4C0BA 2A68C 3RHFA 1E7ZA 3LXRA 1ZP6A 4CW7A 3PR1A 5EP4A 1PH5A 1Q90A 3P26A 4AQYL 3CD6A 3EZ9A 4QXAA 1VQMA 4XVRA 3MWKA 1WF3A 1E2GA 1Z0DA 3CRW1 3QG5A 3S16H 4A3FH 1QHHB 4C0QC 2XJ4A 1HTWA 4QHSA 1E94E 4NTZA 2CJWB 1W1WA 3FVQA 3PCOB 1R5NA 1R2QA 3FKQA 1FP7A 1KK0A 2ZS9A 1XMIA 4M22A 4RFSB 1UEIA 3AFPA 4QBFA 3ZZ0A 2XGJA 2WZQA 1CTQA 3NEYA 4A3LG 4LFBL 2RB4A 3AKEA 4GNXB 4QL3A 2BV3A 2UXCQ 4BBRH 3DLLA 5CK4A 1R5OA 1IN7A 3GO5A 1HR0W 2A8VA 4ON9A 4W5HA 3I3SR 3A4LA 3OIYA 4IDPA 1MKYA 4ZDWA 4L5RC 3I4MH 3JZAA 1IBKL 4B47A 1KO1A 2XTNA 3NH6A 4LUZA 2W2XA 2OFWA 3CUEF 4KLKA 1E2HA 4M1YA 1QVCA 4B32A 2K32A 1XEFA 3BRWD 1XXHA 1NP6A 1KSGA 2A1AA 1Q22A 3TEHB 2E9SA 1SXJD 2HHHQ 5BYKA 2NPIA 1DCZA 4XVQA 1HNXL 4EIWA 4D4KA 4NE2A 5CB8A 3B85A 4NXNL 4OO1H 2OCBA 4ARZA 4DV6Q 4DKAC 4XWKA 3CCLA 5JS8A 2X2FA 4JLMA 1K9MC 4DUZL 3SHFA 2BJWA 3B6YA 1NVXQ 2FPMA 1ZM3A 1Z0AA 5JEAJ 4YY3Q 4QKQA 3H4MA 4JV5L 5M04A 4AYWA 4FN5A 1XP8A 2Q2HA 1XNQL 1NSTA 4QBGB 4R7ZA 3EIVA 4PZ6A 1B0UA 1U81A 1WB9A 1G8FA 4OBEA 5K36G 4JOIA 1ELOA 1G18A 3IKJA 3WY9A 1QHGA 2CJWA 2F3TA 2ZS7A 3CR7A 3QE0A 3RAPR 4CVNA 2QA4A 2R2AA 4LC0A 4PFSA 3SE0A 5BYJA 2A69C 5JSZA 4YWLA 3CCEA 1R8SA 2XAUA 4D80A 2IF2A 4RCYA 3I5YA 1N0WA 4UNRA 1DBSA 4X8HA 2K5VA 2FFQA 4I1OA 521PA 2QPTA 3AP2A 4GKJQ 2QL6A 3MGCA 4URZR 3QIAA 1E0SA 2BCJQ 2Q3FA 2ZI3A 3I8XA 2Z4SA 3KXLA 4H1UA 4PHGA 5FR1A 4E09A 4LY6A 4LCBA 3QJYA 1T3HA 3RS5A 4C0SA 2JLQA 3HU3A 3WP0A 2RGNC 1CFMA 3Q3JB 4PO1A 2A78A 3R20A 2PT5A 4WOPA 3ASZA 2O5IC 3UDIA 2CCGA 3G5UA 4LUCA 3VHXA 1W3SA 3W5OA 4EFLA 1AS3A 1UBEA 3DKVA 2V4DA 3TQYA 5IWAL 3I56A 4TQUS 2NO0A 1QHXA 1XMVA 3AFQA 4X66Q 2ZPTX 4YONB 1LM0A 4JLNA 1YHBA 4DLSA 1LABA 4CEHB 4DV1Q 4DR4L 4YCVA 4LBZA 1AK2A 2OXCA 1F3OA 1DAFA 1PH7A 1LYLA 1RZ3A 1UDWA 5K8LA 2DFTA 1G7SA 5CM8B 2VP9A 4JI4Q 2V1UA 3FGNA 4URWR 4EPTA 1CEEA 4DB2A 1GNQA 4LFAL 2FN4A 4M0LA 4U00A 1SLJA 1S2MA 3P4YA 1VG8A 4K0KQ 4Q00A 1UJ2A 3AVQA 2YKGA 4H0LC 2GVZC 5EXXA 3K0FA 4QJ5A 5G53C 3GPLA 5JSZB 2CHQA 1P62B 3CNOA 3A1WA 2OILA 3U50C 2XNDD 3CBQA 3T1HQ 3BE4A 4LPKA 3KXKA 1DAHA 3RN5A 1OIWA 2ZRKA 1JB1A 1P72A 3TK1A 2AKYA 3LWNA 4MRRA 2UUBQ 2VNUD 1VF5C 1W0JA 4RSGA 2FSIA 4UXHA 3T1OA 4HYYA 2IYQA 3VU9B 5TMPA 4JOIC 4KFRA 2RMKA 2IA5A 4K0KL 2FXQA 1E1RA 3KFXA 1OT3A 2O8DA 1W36B 3EPJA 1T3LA 1RRCA 1Q1BA 1HQCA 2ZM5A 4US0R 4DV0Q 4DR5L 3S2DH 2RF4A 1M74A 1NJFA 3AF3A 3UG6A 4ZDIA 3U7FB 1Q1ZA 4IOAA 3D3QA 1N33L 4XIGS 4WJ4A 2YWHA 4WXRA 3S1AB 2NN6I 1U90A 4BQSA 1E9DA 4KODA 2BE5D 1C0AA 1T4GA 1Z29A 4DLVA 2ERXA 2VA8A 3I4NG 2AR7A 2QEQA 4R4TA 1Z83A 3A1TA 1QHYA 5HR5A 4ACAA 3H1TA 1OXXK 4TVAB 1OE0A 1P3JA 2F1RA 4PSVA 1SHKA 1E1OA 2E2JH 1ZUHA 4I7ZC 1KQSA 1EUJA 1U2RA 2W00A 4D4LA 4D25A 3J7ZC 3FHWA 2YINC 2PZEA 2W6JD 4TYWA 1KYIA 4AY2A 3W6NA 3NBXX 3K0FB 4HUQB 4BFZA 2AD5A 2C03A 1M90C 1E9SA 1E2QA 1G8YA 1SR3A 1US8B 1IHUA 1NY6A 1SXJC 1X8KA 2OEPA 3TAHA 1Z07A 4AURA 4DLTA 2O8FA 2MQHA 5E7NA 1I50H 4JVNA 5JHHB 4KHZA 4GOJA 1AGRA 2BH2A 2HYDA 3CCVA 3BH0A 1F2TA 4UP9A 1RJ9A 2I5MX 1GHKA 1YRBA 2WHXA 3VU9A 3PEWA 3AQ4A 3AQQA 4LGMA 3BFVA 4DV7Q 5JEEA 2J7KA 4DV2L 1N5KA 2RAPA 4IXNA 4Q02A 1CJTC 1VQEA 1UAAA 1Y1VH 3L0OA 1N6LA 2ZRHA 3G6EA 2D4HA 3CH5A 1KO4A 1N3BA 4L5QA 1EFCA 3GEHA 2JA1A 4P4SB 2VHQA 4R2IA 1AQYA 1QZXA 4ZDKA 4OYHA 1VG9B 4Q4HA 3I61A 3M4QA 2FA9A 4M9XA 1T0JB 5J47A 4EUNA 2MMGA 2WFWA 1EFRA 4M1OA 1WFQA 3QSYA 4DV6L 2A6EC 5J4YA 1N2CE 4C2MH 2PZFA 2YWGA 1YJNA 1SRUA 1N5JA 1IXSB 1S72A 4GT1A 2IHYA 4PHFA 4BEJA 4HIMA 3ICEA 4JSYA 4HLDA 1FW6A 1GG2A 4AI6A 1QF9A 1PVOA 2WWXA 1L1OA 1QDEA 1XDBA 4RVCA 4LWCA 2P6UA 4OHZA 4PPFA 1GUGA 3UDGA 1PFSA 1Z47A 1V5WA 2ZSFA 1SKQA 1X55A 3A8KE 2PBRA 3DL0A 1M6NA 2R6DA 1EESA 2DWOA 2QE7A 1AA9A 1NG9A 3R8FA 1EXMA 4B3TL 1T6NA 2X77A 2GVAA 4AYTA 3UANA 4Z8YA 2O0JA 2NG1A 3GLIA 4TMTA 2OAQ1 2QTVB 3MFYA 1H8HD 4NMMA 4LV6A 1E9AA 3TH5A 2VQEL 3FDIA 3H86A 4IDQA 4LOAA 4MYCA 1TTTA 1Y1VG 4G5RA 4BLOA 5C0XH 3HU1A 4HLQB 1D2EA 2XTZA 2GVDC 2EFCB 1OIXA 4DLUA 1GUOA 5C0XJ 1D2MA 1LUZA 3SU8A 2GHIA 3F1ZA 3Q9LA 3ZQJA 3KFUA 3S17H 2P0EA 4C0LA 1ZD8A 1SULA 2B63H 1FNMA 1XNJA 2P2LA 3J7A5 4HLCA 4J15A 3VR4A 3CLVA 4P4SA 3CX6A 3MUFA 1BO6A 3WYAA 3HOZG 2VPPA 4L5SA 4B73A 4H44C 4A3LH 2D74A 3PEUA 3RYTC 1QVAA 5C0XI 2F4VL 1EQQA 2FSHA 5AJYA 1XEXA 2WPDD 3ASYA 3A6PC 2ZUDA 2IYRA 1VQDA 1JJCB 3WRYC 2D5DA 4A3DG 3B60A 3H0KA 1S40A 4PPGA 4DKXA 1QBKC 3EAQA 4WZAE 3EWSA 3QG1A 4JVMA 5J5CA 1X1SA 1DARA 3STBD 2Z6KC 1S3GA 5JI3E 1H65A 4CDGA 4J0QA 3GJ8A 1IBML 1D5CA 4QOSA 3WWVA 3CRLC 4LJ7A 5FOXA 1LY1A 3MWJA 3GLIB 4IJLA 2MSEB 2ZI6A 3SEAA 1VQ6A 1AS0A 3BU2A 4YMUA 3CPWA 1DTSA 3EN2A 4HZUA 2V54A 1OXVA 1U8YA 3B9PA 4G5OA 1W36D 3WBKA 1JR3D 1ZIOA 3GMTA 1NMGA 1CP2A 1QHSA 3QXXA 4G0NA 2JA5G 2R8RA 2KI5A 3KYHC 3T12A 2GJ9A 2B7BA 2FFAA 3H2YA 3KL4A 2VP4A 3NENA 4YLGA 1HZ9A 2RGEA 1VIAA 2CEAA 5DHFA 3WYFA 3J80i 1J7KA 1DAMA 4NPSA 2WICA 4DCVA 3M7NA 4F4IA 3M9BA 4M1TA 5IP7H 3QPWA 2WAQE 1U8ZA 1N5LA 2FG5A 2D7CA 1SVSA 2A19A 4A3DH 2LKCA 3A58B 3I4LA 1SVLA 1XEXB 3QY0A 4P72A 4R98A 4R9UC 4RZ3A 4V03A 1FR3A 1N0UA 4JLBA 2OCYC 5DIFA 4ZCLA 3WP1B 2O8BB 4OL0A 5IP9G 3J80c 2R92H 5TARA 1QZGA 1D2NA 5HZHA 4LJ6A 3EA0A 3OTOL 1A1VA 1PYSB 3PG5A 4PC6A 3X1DA 2FDCA 3B1VA 3DM9B 1XD2A 1ZD9A 2REBA 1UKEA 3KTAA 2WAQG 4FWTA 4WZ6A 1IW7D 3TRFA 2HXYA 3IEUA 5GAEC 1ZC4A 3OOCA 1Q1EA 4NXMQ 1NMYA 1BMFD 1P60A 3GJXC 2JA6G 4JBMA 1OF1A 1TUIA 3ADKA 4MGIR 4ZCMA 3EBEA 3R9XA 4QL5A 2IEZA 3CPJB 2GXAA 4KXFB 4LJZC 1JALA 3EXAA 1HCZA 5FOSA 3CPEA 3BFKA 4URUR 3SS8A 4W7SA 1YHQA 4C2UA 2MSDB 2GJAA 2QE7D 2LXJA 3AKDA 1JE5A 4KSCA 4B3SL 3OPOA 4EJSB 4Y0VA 2VEDA 3E9IA 4IDOA 1A63A 2FJUA 4O2DA 3O8RA 4L9WA 2BBOA 4G01B 5FUXA 5FLXc 4YHHL 4G5GA 3ND9A 3VKWA 1FMJA 3BG3A 4PANA 3GTPH 1E2ZA 1GNRA 5DGXA 4CYMA 4DDUA 1JPJA 2KHIA 2IXGA 2ZRNA 2Y8EA 3C5CA 2BBTA 1IBLQ 4WZBE 5DN6D 2IYZA 2R6FA 1UBGA 2CQOA 5AJZA 1UEJA 4A3EH 4MZ9A 2V6JA 4L5BA 2PZGA 4DCUA 1YEZA 1XMSA 5JCPA 1CRPA 1XTIA 5AWFC 2OTJA 1EG7A 2TMKA 2XEXA 3U7HB 1VQBA 3SOPA 1VQ7A 4V0LA 1Z6XA 4LRWA 4DZZA 4U5XA 3QXSA 1AZTA 1DD2A 1IN4A 3U2QA 3GLGA 5CLQA 3K70D 5F9HA 121PA 3THXB 3SHWA 3ULJA 4KN7C 3VR5A 2Z83A 3E5HA 2GZAA 1SZPA 5L3RA 1J5EL 1JXOA 4KCGA 1WCMG 2BWJA 2ZYTX 3CAMA 1FPMA 2HCJB 1KI8A 2W6ID 1SMYC 3ECCA 3FHCB 4UXJA 3SQXA 5AJ3L 4I81A 2WJYA 3B5JA 4IFBA 4C0HA 2HUPA 1S3SA 3P4XA 3MMPA 2P67A 1OXTA 2ZJBA 3TNFA 4TQAA 4DLZA 1KO5A 2XGTA 4A82A 2NVXH 5GJCA 2AD1A 3N6RA 3Q85A 1E2MA 2CE7A 1R9TH 3IO5A 4GNKA 3TS0A 1Y8OB 2NN6H 1RKBA 3NDBB 3U4VA 4BBRG 3FP9A 1YITA 3HU2A 2B8WA 2QM7A 5B2ZA 2YOHA 2BBWA 3CCJA 4LFCQ 3GDEA 4DR4Q 3ZIAA 3A5UA 2A6HC 4GOKA 4NCJA 2EIFA 2KA7A 1IJEA 2ZJPA 1YJ9A 1OXUA 2CDNA 3DZDA 4FCTA 4PHTA 3KF6A 2AN9A 4CT4B 3TQCA 2GF0A 2A5FA 1PH4A 4KKTA 3J81i 1XTSA 4Y52H 4TLCA 2UXDQ 2YTVA 4DSNA 4PC1A 3BC1A 2PLFA 5CYPA 3CNNA 1NE3A 1HE1C 1CKEA 1JXMA 1U99A 3PUZA 2XSZA 2ZVPX 4AK9A 3F2DA 3ADDA 3PVSA 4RD0A 2LXKA 4LFCL 4DIDA 3KQLA 2O8CB 1V43A 1AE3A 1FJGL 1A2KC 3C15C 1HPCA 2GETA 4Q9KA 4JJKA 2GBLC 1XNRQ 4N3NA 1MO3A 1KI3A 1JJGA 4MGYR 1K8GA 5FTNA 1C4OA 2YNMA 4HAXA 5LMUL 4BXXH 1PLLA 2IUUA 4NYJQ 5EP2A 3RZDH 3DHWC 2ZI4A 4QRHA 2KE5A 1MO4A 3VX4A 1PA6A 4BBSH 1KNQA 2EYUA 3P27A 3F2CA 1G4AE 2BEJA 2KBEA 1X8JA 2ODNA 1Y69U 1MRSA 2QT0A 2DN8A 2VL7A 3QF4B 4M4SA 1J5EQ 4QG7A 1LVGA 1AM4D 2C78A 4KI0A 2Q9BA 4A3EG 3QENA 1G6PA 4GP7A 1OSNA 2J0UA 1NKTA 3ZJYC 1X3SA 3KJGA 3D6TB 1NVWQ 4HAZA 3ONWA 2CLDX 2FSGA 2CNWD 2R7FA 2A30A 4QHTA 2W6JA 2BHRA 3AP1A 2P6NA 4C3HH 4JYAL 2JJ2A 1VQOA 5FBWB 3ZS8A 3GLFE 4UXIA 4B71A 1Y1WG 2YOGA 4QBIA 2AK3A 4HR7B 1GVNB 3RRYA 4PV1C 4B75A 1N25A 2J46A 1TNDA 2IYWA 2Q8IB 4JI2Q 2OQ0A 4DR7L 4LHXA 1TU3A 4Z1MA 4D0LB 4TYQA 2O8CA 4LK1C 4NYIR 1UPTA 3O8DA 4DK6C 2JK8A 1IBKQ 4OI1A 3T1TA 3MSXA 2ZRAA 4GKKL 2GAOA 1I4DD 1CRQA 1T3SA 4G3XA 4DR1L 3BOSA 3IGFA 4B3DA 4DV4Q 5C0XG 2D0PA 4BLSA 4HDQB 2BMEA 3CWZA 4FCVA 2Z0SA 4OQLA 1KI7A 1XCPA 4MRSA 2KCMA 5ELOA 2UUCQ 2V4ZA 4RD2A 2H57A 2GJKA 4L4UA 1RRGA 4Q1CA 5FBLB 4B3GA 2YJTD 3K0AB 1ZNYA 4GSYA 4WVFA 5GVRA 1E79D 1Z2AA 2IYVA 2E8GA 3K0SA 2GEVA 3QF4A 2WMOB 1W2BA 2ZRGA 4NP6A 1VS0A 1TQ2A 2JJ2D 1DS6A 3T61A 4IDHA 5M3MG 4OONA 4QBHA 3T56B 2QT1A 2WWGA 3QKUA 1F6BA 3U4QB 4A36A 2BKEA 2C2HA 2J0UB 2ZXUA 2QRZA 1JPNA 5F2EA 1K8OA 1Z28A 4JBKA 1FX0B 2BEKA 4IFDI 3ADCA 2O5JC 3E1SA 5FOWA 4X8MA 5M3FH 3IEVA 4GBMA 3K09A 4OQNA 2I4IA 1VKJA 2OCEA 4PXAA 1XPUA 4P71A 1JQLB 4PMWA 2QAJA 2RKOA 1HNWL 1JQJC 5FOVA 2FX3A 4DR3Q 2HJGA 5H1YA 4FXPA 3W34A 4XH9B 2V1CC 5IT5A 1E4YA 2ZS8A 2ZJZA 4OJQA 5GROA 4JJZA 5C4XH 1E69A 3TLXA 2O5VA 1VDZA 4QY7A 3S2HH 1TU4A 1XXHE 3LGJA 2JA8G 1HQYE 2X1VA 1MIUA 2AK2A 1R6BX 1TF5A 4LDJA 3RSOA 2IK8A 2EW1A 2JJQA 5EP1A 5FPTA 4M1SA 4X8OA 2XSZD 3V4FA 2IF0A 3ULPA 1DXMA 1I4TD 4GNXA 2IYYA 2MMCA 3B1WA 5LMUQ 3IUYA 4GOPA 3KLRA 5FOUA 1KHIA 2WJIA 1AKYA 5JWRA 1QHIA 4BRUA 1T91A 4TWZA 1P75A 5A4JA 1C9OA 2A5YB 4NBSA 5AUNB 4A3GH 1SHZA 3K0AA 1YR6A 1XNRL 2Q2TA 4JI3L 2FWRA 1NLFA 1YZLA 5LD2B 2Q9AA 4N0EA 1Z0FA 4TLEA 4PQRA 1RRFA 2JDIA 2V55B 2PEZA 2DR3A 1S3OA 1JAIA 4RZXA 1Y1WH 4ZPXA 4AIMA 4C3IH 2AFIE 2XZPA 2JEAI 2K52A 1N5IA 2AX4A 3TJZA 1GUAA 3U4QA 1HE8B 2REOA 1P2TA 4DV4L 1TQDA 2QGZA 4ARZB 2B3GA 2IBMA 5P21A 2FNAA 2WAYA 1COWD 5FTMA 1NIPA 3PGZA 4F92B 4NCNA 4D82A 1VCMA 4KKSA 3CCSA 4DV3L 1SROA 2PI2E 1L2TA 1GJXA 3RS2A 3MLEA 5CK5A 4IQZA 2P65A 5C1BA 3IIKA 1ZD1A 3S1NH 1YE8A 1WJJA 3ZJYA 3TS2A 4LJAA 1W36C 4GLXA 3B78A 4EPXA 2VUMG 2REXB 1A7JA 1I94L 3SYLA 3N5CA 1XRJA 3KFVA 3FKSA 3VR1A 1KD1C 4EQ6B 5DLQC 1A6XA 5EE3A 1NBMA 2VQEQ 4DUGD 5IF9A 1TQ4A 1R7RA 1UWVA 3CPHA 2C77A 1MJCA 3RNUA 2RHMA 1P6XA 2ODEA 1KRTA 4BFUA 4B3MQ 1SQ5A 1S8FA 2GCOB 2NN6G 2PCJA 2I5HA 3AB3A 3OW2A 4A15A 4HZIA 3EX7C 4QGUA 4GOPB 2FFBA 5IYCH 5EE9A 2XXAB 1G3UA 3NBFA 1R10A 1Z63A 3REGA 3OE7A 1AQUA 2AHOB 2YZ2A 2WSSD 5CJPA 1QVGA 4R4IA 3W5JA 1PV4A 4LJ9A 2ZANA 4D81A 3W5IA 4DLRA 1VCOA 2NOAA 5LBIA 3N2EA 2GK6A 4LBYA 5DYIA 3ZIAD 5CB6A 1IY0A 1GAJA 2R6AA 2NZJA 3NH9A 4PZLA 5F3WB 3Q8DA 3U60B 1G16A 3CWQA 4FCWA 4BA2I 2F43A 3SZRA 2D7DA 2WOJA 3BB4A 2WJJA 3AVWA 2WBLC 4HAWA 4Y7NH 2C99A 2ZRLA 3T5GA 4KFUA 1UE7A 3SN6A 2Q3MA 3W6OA 3KKPA 2HLDD 2XOKD 3LQQA 2JIZA 2GKSA 3KJOA 4YXWA 4CEHA 1Y3AA 4LHYA 2YHSA 1I5FA 3GJ7A 2GJSA 2EQBA 2YWFA 1BDOA 1X65A 2IHBA 4PQYA 2AXNA 1KO7A 1TWFH 4GZLA 4FINA 1KGDA 2H92A 4TTQA 1TF7A 4EPRA 1NMZA 3B7GA 2ZI5A 2W0SA 4BLTA 4PPNA 4Q9JA 4EQ6A 1YR7A 3AVPA 5C4JH 2FOLA 2AWNA 1W4CA 3QUSA 1YR8A 1VF7A 3NBHB 1II9A 3TE6A 5CDFE 2GF9A 1X86B 3HKZE 3CF6R 1TU2B 3E70C 3EC2A 1GUTA 4BA1I 4OHYA 2WV9A 1T0HB 1OPXA 2XZOA 4O3MA 3X1YA 2JA5H 2GCOA 5KSYA 3M4PA 4DAYB 1CS4C 1E2KA 3C8UA 3VAAA 1QRAA 1CSPA 1W4BA 2QM8A 3VMFA 4E03A 2F3IA 1SXJE 4KYUA 3S1QH 2CLCX 2Z4RA 1DELA 2AHOA 2ZTCA 2IL1A 4NPHA 4TT3D 2J59A 5IYCG 1J8YF 2QY9A 2JJ1A 4DXAA 1KAOA 1MR3F 3PF4A 3KXIA 1DG1G 5JBQA 3GTKH 3TZUA 4JI8Q 4JI6L 2O8DB 5IYBG 4GRAA 1TX4B 3Q7QA 2D3WA 4X65L 4FIDA 3PIRA 2F43B 2ZE8A 621PA 1G4UR 1ZKOA 2WAXA 2R92G 3UWOA 2GZHA 4B44A 4Q66C 3PSIA 3NC1C 2ZM6L 4Q4JB 4UJ5A 3S1AA 2PQAB 1CJVC 4X6AH 3FYHA 1UBFA 2RH5A 2DYKA 2QZ4A 4CEJA 3TSWA 1E32A 3CH4B 1E9FA 4F91B 3CR8A 4TMVA 4YWKA 3WXMA 3LY5A 3A37A 1SE8A 5FI0B 3TGPA 4DUYQ 1L4UA 2ZRCA 5TXGA 1G8HA 3T1VA 2HT1A 2ANBA 2WB1G 1K73C 3F3YA 3DM3A 4AG6A 2UXBL 3CCUA 1OFIA 3CX8A 5FJ8G 5G3YA 3G71A 3M3YH 2ZUCA 2KBNA 3M1IA 1Z2CA 3L82B 4JLAA 4H02A 1GVPA 1GRQA 2JEBI 3HP1A 4NYJR 5BW8A 2O8FB 5IP9H 2IX0A 2PMZE 4BY1G 2IUSA 3TUJC 5FBQB 5A5GA 3VNVA 5JEDA 3RNLA 1ASZA 4LBWA 3RLOA 3CMAA 1KJWA 1FVIA 1F2TB 2ZSAA 4LHVA 4JZKA 1T8TA 4C3JH 5DH9A 1E9BA 1FUKA 1RJ9B 1RYHA 1EYGA 4DR3L 1H9SB 4P73A 2BM1A 3LX8A 1E79A 3FMPB 3F0TA 1CXZA 1P9WA 4P31A 4E22A 5CITA 1BOFA 3TUIC 4HI0E 1IONA 2QMUA 5HGQA 1YKSA 4K46A 4LYHA 1ZC3A 4C3ZA 3VNUA 4TL6A 3HOWH 3VR6A 4B3RQ 1TADA 2EVBA 4CRWB 2DNEA 3K7UC 1IBLL 2JEOA 2QPOA 3B9QA 3LVQE 5H70A 3RRNA 1AJEA 1JEEA 4LPSA 3VA7A 2OAP1 2OWOA 2R62A 4JS0A 4NZYA 5K8TA 4Q4HB 4Q4JA 1HR0L 1NLZA 5J4HA 2PQAA 3Q7PA 3BERA 4GZYC 1G5PA 5FUWA 3T06B 1L4YA 2N42A 1GP2A 4UQOA 4CEJB 4CGZA 3OIWA 4JLKA 2Q9CA 1CKOA 3U61B 5KU1A 1E4VA 4Q1EA 1A2BA 2VP6A 2IT1A 3EZFA 1RW4A 4KHPL 2MO0A 3FHOA 4NYIQ 1OB2A 2JXMB 4UP7A 2A3RA 2BC9A 1UE5A 2FMXA 2GEDA 4G7OC 1Z6GA 1NBME 1L1OB 3RS4A 1JB7A 5LMNW 1MH1A 2A5JA 2ECKA 2H1LA 2RGDA 1JJ2A 1LACA 2GILA 4B2IA 4BEBA 1E24A 2GXSA 1NRJB 2GWHA 4RJLA 2OCPA 1L2FA 4OHXA 2G9NA 1W4AA 3PEVA 4LK2A 5SZHB 3EQLC 1N32L 1XWIA 4GZMA 4R1JA 1ZVQA 2EVWX 4GKJL 2MSCB 3DZ8A 3UMFA 2KENA 5IY0A 5M3FG 3FPPA 3V9PA 2C98A 3UIEA 3OW7A 2VLIA 4XVUA 5EXSA 4HAUA 1VYVA 3U44A 3AUXA 4KBFA 3N70A 2NO9A 1H9SA 4MTNA 5C4MA 2HYIC 4DNTB 4HJ9A 2JCSA 4UKDA 3ZD7A 4RD1A 4JYAQ 4AH6A 2EJFC 1UKVY 4Z51A 4M2LA 3THYB 4BGDA 3AYHB 4HATA 5IDVA 4KVAA 5EAYA 1Q12A 2ZAOA 3BGWA 4UJ3A 4E07A 4JV5Q 2DB3A 3UWKA 3EZ6A 1UE1A 1IN5A 1EFRD 2JAQA 4LW1A 3EIEA 2PI2A 1KIXA 4FW9A 2JJ1D 4ZKEA 1WBDA 1VQ8A 1OH5A 4I99A 4RZ2A 2OV2A 5EZ5A 5JLJA 3EWAA 3C4JA 1G21E 3AUYA 3LW7A 4OI4A 4BLQA 1CLUA 4OX9L 1R0XA 1E3PA 5FBVB 2CBZA 2LCFA 3MXUA 3RC8A 2GN5A 3L7ZC 4IPGA 3EZ7A 4HSEA 1I2DA 4GPTA 3JVUA 4KBGA 5L3QB 1W47A 1HQMC 1G7RA 3LRPA 4CIDA 2IS6A 2VBCA 1VQCA 1D8LA 4FD2A 4IFDG 3HYTA 1Z6HA 2PLRA 4XD7A 1CTMA 3AVYA 2F7SA 1XZPA 1GNPA 3MCAA 4LF7L 1ZJ6A 3AGPA 1W48A 4PC7A 2ZRMA 3TIFA 4IW3B 3K09C 2DUDA 1K8RA 1XTJA 2C35B 1W0JD 2GRJA 1HJPA 4I1VA 3U6BA 1KOFA 2YOFA 1X3GA 3NWJA 2ORWA 3U44B 1IYUA 3OF5A 3VQTA 3CRKC 3LLUA 3WNCA 2IY5B 1CR4A 2Q2UA 2V7QD 3PENA 4KHPQ 4W5JA 3ZS9A 4HZUB 3NEJA 1HZAA 1J6QA 3R9WA 4MNOA 3LNNA 2FSFA 1J90A 1LS1A 4A3CG 3DXJC 2A5GA 5ELNA 3GTMH 2VY3A 5AUQA 4LYAA 1ZM2A 3VX3A 4PSKA 4A3JG 3S15H 3WBJA 2VHUA 3HPRA 2YTYA 1OHHD 2FFHA 3U6KA 3IQXA 3ZLJA 1KKMA 5JMTA 1CJKC 3I92A 1OH8A 2F1JA 2CXXA 3RRZA 3KKQA 3U3JA 1IXRA 2XTMA 1G9XA 2LMCB 2HIXA 1EK0A 2FH5B 2BH8A 2A7QA 5BN3A 1YHAA 1E2DA 2J9RA 3PV0A 3W90A 4DJTA 2AWOA 2JA7H 3PEYA 3NEMA 4IPCA 1X3FA 5DHAA 1ODFA 1F48A 5ELXA 2OUKA 3BXZA 4M9ZA 1IYVA 1E2VA 1ZM9A 4ERNA 5L3QA 3SBDA 1N36Q 5IRCD 3HWSA 5KNCA 4M1MA 5JJIA 4IOCA 5DN6A 2GZDA 1G51A 4IFDJ 4KMUC 3SGIA 721PA 1XD2B 4ITRC 5L3VA 2OBLA 2ZYUX 3KTAB 3VR3A 3WMFA 2EJGC 1RL2A 1P2SA 4NCIA 3HOYH 1T5IA 4DV2Q 3BBPA 2OFXA 4EPYA 1Z3IX 1TEXA 2FF7A 1P9NA 4MGKR 4ZCIA 4TZ6A 1SXJA 1U0JA 1ZCBA 1G6OA 1KK2A 1A5TA 1OKKD 2PX0A 5BR8Q 3LV8A 2P5TB 3LQRA 1JR6A 4X62L 4ASUD 1VQJA 2FZLA 2QROA 3LNCA 3CCMA 1KDPA 2K4KA 4DLXA 4BPBA 3A1VA 2QA5A 2JDID 3K53A 3B6EA 5FL3A 1VIYA 2ZTEA 3M0EA 1XJ0A 5AJXA 2UUAQ 1FGUA 1NMXA 3ZGXA 3ADBA 2D2EA 2F1MA 3A7LA 3AH8A 2VL6A 3M85A 5HKKA 2XNDA 3IBYA 3ZVLA 4Z54A 4IDNA 1YZUA 5E7JA 4LJYA 3D4RA 3G48A 4TZ0A 4FWIB 3THWB 1E9CA 2J1LA 4Q1FA 4IPDA 4MA4A 3VFDA 2X8AA 4Q1BA 4DDWA 4LHWA 2A5DA 2ALYB 3KF8B 2B92A 1Q82C 2FEOA 4DK0A 1X6VA 2B7CA 1DO0A 2GTPA 2UZIR 3DEFA 3OEHA 4Q01A 2R6CA 1K3RA 2GBLA 5E4FA 1Q0UA 3T1YL 1X54A 4WXPA 4A3GG 4NXML 4HLUC 2H5XA 3NDPA 4B2LA 2UUAL 2H18A 5FUVA 3BIFA 1XMOL 3HJNA 5HPYB 4HJ8A 4KAXA 1RVDA 4OJKA 4DV0L 4DR5Q 1G3MA 1W5TA 4LJ4A 3A8IE 4NKRA 2VIIA 4JI4L 1XFAA 2OLKA 3OTOQ 1E2EA 2R44A 4XWAA 3GTGH 1DAIA 1GKUB 4EJSC 5BR8L 1PYBA 3A5ZB 4DV1L 1SXJB 1FQKA 3IRBA 2G1KA 3ZD6A 1F60A 4X66L 1GOTA 5GADl 4NL4H 4AIIA 4HIDA 4GOPC 1S0UA 2OSBA 4OWXB 1YZNA 2BMJA 1G3RA 5FJ8H 1E2JA 2W2TA 4Q1AA 4BXXG 2DWPA 1KNXA 1MABB 1Z08A 1HA3A 1N6OA 2L15A 3GFTA 4Q7JB 4TN1A 4IEIA 4A6XA 4BASA 4BFWA 5B58C 2QSZA 3WYGA 3L0PA 4A3FG 2ATVA 4V0OA 3TW8B 1AH9A 1T5EA 3BD9A 3NIBA 2VQFL 4JI5Q 3THWA 1HURA 4II7A 1QHNA 4L8GA 4EKDA 4US1R 2GA8A 2JIZD 1TWHH 3W1BA 6Q21A 1BIFA 3HOVH 2QBYA 2KCCA 4H13C 3P20A 4NCKA 2OCAA 3AVOA 3KDFB 1EWRA 1HEIA 1DG3A 2C95A 1DVRA 3LFUA 5IP7G 4YMVA 3NHAA 2JASA 2OT3B 1IBMQ 3UATA 3JVVA 1RE0A 4QNMA 3K81C 5JS7A 4X65Q 2FZ4A 2ZR0A 1VQFA 3KJIA 4S35A 1TKWB 2GJ8A 2QP4A 1YVDA 2BMFA 3AVUA 4OXPA 2IYLD 3BB3A 5LD2C 4TMXA 3X1ZA 3ZQ6A 1KI1A 2JLZA 3CPFA 1FQJA 4A1FA 1CUKA 1PH8A 2G1JA 4JI7Q 4MRNA 4CT5A 4B35A 1GRNA 3W9YA 3OAAA 1ZU5A 3W8RA 4XSGA 2XZLA 4R4QA 2VRWA 4PX9A 3I32A 4L9SA 4BFVA 1SFOH 2F4VQ 3H15A 4LWZA 4C7OA 3D8BA 3TW4A 4DNIA 4JLVA 4JLJA 2OM2A 5HZKA 5LPNA 4XTCS 1MABA 4DR6Q 2GCPA 2LWIA 4AQYQ 2CK3D 3FOZA 2AMCB 2RHSB 4M9SA 3G0HA 2GXQA 3LAWA 2IHEA 3A36A 3K0XA 5C3EH 5DNYB 1S9DA 1Q81C 2GESA 3JZMA 1ZIPA 1XMQL 5IYDH 5HTKA 3O47A 5SZIA 3SJCA 1I6HH 3PO2H 3PO3H 1E99A 2KB0A 2BE5C 3IIMA 2NIPA 2ZJOA 3K8AA 2AUKA 2BBSA 4DRZA 4PZ8A 2VQSA 3FKIG 3U4ZA 1K83H 1VPLA 4QFMA 3VKHA 1O78A 3CW2C 4B3ML 5KDDA 4LV8B 2Z43A 5JI2E 4IFDH 1AN0A 3P1JA 2QNRA 1KSFX 2AL7A 2FE4A 1LV7A 3FPAA 2EXDA 1II8A 4BZXA 4A3MG 2CCZA 3WHKA 3B1YA 1W0KA 4N1AA 5KNDA 1GKYA 2W2VA 1CR2A 2C9CA 2YC4C 1XJVA 4A8JC 1U0LA 4B34A 2VSXA 2CW0C 1XB2A 3CC7A 2UU9L 2WM9B 4A92A 2XB2A 2QI9C 3K0CA 2HHHL 4AKEA 1CI3M 1R0WA 4EX5A 4QJFA 4HAYA 4JBYA 4MYHA 4QGFA 2QAGB 3CRRA 5D3QA 1XX6A 2N78A 2JA8H 1KTVA 4A0HA 3CNLA 1NLYA 5B30A 3LBHA 3JC66 2QMHA 3TRZA 5TV2A 2VP0A 2ID0A 1TPZA 4POAA 1G8GA 1SVKA 4HUTA 1EX6A 1XNQQ 2UXCL 1T8UA 2G77B 2EYQA 3LH5A 2HT6A 3CONA 4RMFA 5HKKD 3U58A 3R8CA 3CCRA 5AR1A 5IYDG 3WDNA 1EOVA 3RR5A 3PF5A 1M2OB 5J40A 5JHGB 2ZEJA 1GFIA 1KXLA 4JI1Q 3TKLA 4DSUA 1II0A 3HOUG 1MJEA 1S4QA 3I1FA 2NO6A 1S9HA 2PT7A 5E7IA 3STBC 3CZQA 3EA5A 3CP0A 3I55A 2J87A 4D4MA 4YQFA 1FYCA 1N9WA 3BJIC 5C2JB 2B6HA 1Z0KA 3SJAA 2ZI9A 2QGQA 4A3MH 2QTHA 3BH7A 2CNWA 2QG6A 4A4IA 1X9NA 3VHLB 4JVSB 2B8TA 2V8OA 4Z8XA 4BLPA 2OE2A 1QUQA 2HEIA 1OXSC 1OFUX 2MNAA 5KDLA 5DLQE 1KHTA 2DFKB 4PZ7A 1EGAA 3WNBA 2KBFA 2RGCA 3RN2A 4JLOA 3FWYA 2WMNB 3AF1A 1L0WA 1N6KA 4AKHA 4PZYA 5D3MA 1COWA 1I3QH 1D9XA 3HOWG 2O0KA 2QORA 4M9QA 4JMPA 1E1RD 1G291 4A3BH 5DI9A 3A8TA 4OK3A 3L2PA 4O2LA 2OZEA 3M6AA 1AGPA 1BH2A 1LF5A 2IC5A 2DNCA 2IEYA 3NELA 1M7BA 5K8UA 1U98A 1VG1A 2QGNA 4AKIA 2FGJA 2I1QA 1KJYA 2B29A 1VQ5A 1GM5A 2JA7G 4BBSG 1OLOA 1ZMXA 2E5LQ 1Z0JA 2DY1A 2KWIA 5SZKB 5LDDC 3SFVA 2VSFA 1EX7A 3I2ZA 1NVVQ 3W3AA 1A8VA 4AWXA 3OIUA 2MFIA 1OYWA 2I1VB 1J99A 5C44G 1QVRA 4H9GA 2WIAA 3K70B 2E2HH 4DUGA 2Q2IA 1MO6A 1E1QD 1XTQA 1NBWA 2ATWA 1M7GA 4JI1L 4MDEA 4TSFD 2F6RA 4DPGA 4BZQA 1GSIA 1JI0A 1GWNA 4JL5A 5TDHA 3R7WB 4IVPA 2QQ0A 2J0QA 5JRJA 1KZ7B 3C7KA 1O87A 3N2IA 4MRVA 4G7HC 1HNWQ 4Q4LA 1BMFA 2EWWA 4MKIA 2F3RA 2C9OA 3U5ZB 4ACBA 2ZSDA 3IPYA 5JJLA 1HNZL 1E6CA 4IRUB 4FMCB 1ZUIA 1QUQB 2ZROA 3DM5A 3K0EA 2EWVA 3QEJA 2RGGA 3I73A 1N6HA 2NZ8A 4PC2A 1G7TA 4JL6A 2O8EB 1EFHA 3OHMA 4TYNA 4GFDA 4B2PA 3UE1A 2A69D 2B8GA 1SKYE 4BLRA 2XXAA 1VQ9A 4LF5Q 2SHKA 3KQKA 2ZTDA 1E98A 1DAKA 1G7CA 1TMKA 4PO9A 4R2HA 2WKRA 4ABYA 4P32A 5GJVC 2N8NA 4KLNA 4X64L 4LF4Q 3WMEA 3B2EA 1YNJC 1IN8A 1OYYA 4XWOA 4DNRB 3RLFA 1PH1A 3QKRA 4P4UA 1XTKA 4F93B 4V0NA 2D06A 3TBKA 2ES2A 4DLYA 3CZPA 4N0DA 1AZSC 2DBYA 3EIQA 3TQFA 5E3HA 5CJ2A 5H8WA 2RHDA 3NHBA 5GJWC 3BFXA 1RPZA 1T9HA 3GTJH 1NN0A 1NN3A 1J8MF 2F1HA 2V6IA 2ZRFA 4JT2A 3A8JE 1DO2A 2H16A 3O8CA 3RWMB 3TMKA 4Q47A 4P75A 5KTYA 1KK3A 3CCQA 2BA0A 1U0HC 2CHVA 2IYXA 3B8HA 3QOFA 3J81j 2ZTSA 2H5EA 4HAVA 3OESA 4PPQA 4Q03A 3ZVRA 2IX3A 4PR0A 3BAFA 2ODWA 2VZAA 3QBVA 2JLRA 4LF8L 1Q57A 4I4LA 5HE9A 2ONKA 4LNQA 1NKSA 2F55A 1E1TA 3I4OA 2ODBA 3TR5A 3VDYA 2GDJA 4XTRA 2L5TA 1YZQA 1UDXA 4LF9L 5FFMA 2IWHA 1K6MA 4NDZA 3B82A 2FU5C 3AF4A 4JSTA 3HOVG 3IQWA 1ZAKA 3CXCA 5EE0A 2IXFA 1X56A 3W8NA 1ZUNB 4EPWA 2C04A 5CYOA 4DIEA 5FPSA 3EARA 2IW3A 2K50A 2QQEA 3G4SA 1SN8A 2VHTA 1ONLA 3HOZH 1DAGA 1G19A 3OAAD 1OTCA 4OO1I 4LF4L 1H8ED 1VQPA 1VYTA 5EXTA 1H9MA 4HDOB 4LF9Q 4PTLA 3E2IA 2K75A 3CO5A 1LS6A 3UPUA 3W3ZB 4QGHA 4C30A 1XD8A 1OIVA 4MYUA 5IT9c 4P3YA 2EJMA 3QKRB 4BECA 2XTIA 1JAHA 4ZIRA 1KKLA 2BMDA 1HYQA 1X6OA 1I94Q 1TWCH 2QPAA 5DISB 4RG1A 1X8LA 2WSMA 1BS1A 5C4XG 1FJGQ 1WCMH 1VQKA 3S24A 1OKKA 3AEVA 3LWUA 1ESMA 2G0NA 2K5UA 2JGNA 5FPKA 2AFHE 4D0GA 4DHEA 3EPKA 4R4OA 5AJ3Q 3ER0A 1EIFA 2HXSA 4M1WA 4O0AA 4A75A 4PO8A 5B57C 4JYCA 2A6HD 3KZ1E 2V3CC 1K0RA 2CHGA 4RCNA 3I5XA 4A2QA 2N1BA 5C3EG 5H1SE 2AUJD 1E2LA 1YZKA 3K9LA 3LD9A 4A9AA 4B76A 1G6HA 1ZBDA 2WTUA 2I0QA 2PMKA 2K7VA 2QP3A 4JBJA 3FFAA 4BY1H 4AC9A 4A0GA 4YMTA 4X8LA 2RCNA 3A4NA 2W83A 2XX3A 4JYBA 4KVGA 2RGAA 2GEUA 2QMOA 4Q19A 1Q21A 5LMNQ 1Q44A 1HV8A 2ZE7A 1ETUA 4C0JA 3MRSA 2IUTA 5FPYA 5FL7A 3FMCA 2AKWB 4LUVA 2CL6X 3GLHB 3CQZH 3GJ6A 2V9PA 3QQ5A 2ZJQA 1M1KC 1JECA 3BZKA 1G8PA 1CULC 1Z0IA 1E2IA 2BOVA 1P16A 2A6ED 1GIAA 2EU8A 4JIMA 1DAEA 4GL2A 1QZHA 3H3VI 4OK5A 3CC2A 3UE0A 3KJPA 4O0MA 1RFLA 5AJWA 4B3SQ 4TT3A 2YYZA 3E0EA 3MJRA 1IOZA 1Q7YC 2ZJ5A 1J2JA 1NL3A 1MV5A 1TUEA 1Z22A 2Z6VA 3B13B 5L8VA 4I1UA 1IJFA 4APVA 4JI0Q 1G41A 1CJUC 3A1SA 4BUJA 1CBUA 4Q4AB 2ZRIA 2JLSA 4M21A 4DR2Q 1UM8A 1VG0B 2G88A 2ZAMA 3GLFA 1GZSA 1U94A 4MRPA 4DVGA 3OYYA 1YU9A 4TLAA 1YZGA 4DBLC 3HKZG 2PJZA 4NHOA 1WBBA 2E74C 4FMCF 4X62Q 3SYKA 4TMKA 4NU0A 2ORVA 5FR2A 1HZCA 5AJVB 5FLMG 3LXXA 5J4LA 2Q3HA 3BK7A 1XJCA 821PA 1Q8KA 4UNQA 2VYFA 1O7IA 1ONBA 2ZVQX 4MKFA 2NPFA 1UKYA 1GDDA 4BRWA 4ZI3A 3X2SA 1VTKA 1ZNZA 3OIVA 2H8KA 4TL7A 1KDTA 1B7YB 3QPVA 3IIJA 4KN4C 5M3MH 4MGZR 2I5LX 4M53A 1KC8C 1V8QA 1F2UA 1KSJA 2BJVA 2MO1A 1RRPA 1N36L 1G3QA 3GLHA 3Q72A 4MQBA 1VHTA 1KI6A 1Q1QA 3AP3A 4GP6A 1E2PA 4B48A 4LC1A 4A93G 4FMDF 1VQAA 1FL9A 4BFTA 1P73A 2ZRJA 2R6GA 3KKMA 4NONA 4GMDA 1KAWA 1P2UA 2QRNA 4PAOA 2WWFA 3SC3A 3THYA 1TEVA 2IS2A 3GTQH 3L0SA 2QTFA 3H94A 2WPDA 3HR7A 4B6FA 1NG1A 4POFA 4BY7H 2KJQA 4OK6A 1G64A 4JI2L 4DR7Q 3RWOA 1HZBA 2WIBA 1N6NA 3KJEA 3ZYCA 1WOCA 3H84A 4FMDB 3ERSX 3S14H 1D8TA 2OTLA 4DV5Q 4KFTA 1CSQA 3JAMc 4Q4AA 4TTRA 4C2TA 2R65A 1YNXA 1R0ZA 3SR0A 5KHOC 3GLFB 2B63G 2FV8A 1W46A 1YNNC 1TWGH 3OFNA 3CF5A 3IDQA 1VQLA 3X1WA 4PHHA 3OEED 2HQLA 2DGYA 2IYUA 3AM1A 2C96A 1XCMA 3DKPA 4A2PA 1FZQA 5EE5B 2F52A 1N0VC 3JAMi 1NN5A 3S1MH 2PX3A 2ZI7A 3IHWA 3QBTA 3RS3A 3F8TA 3DPUA 1PJRA 1SKYB 3L0IB 1VCNA 3F2BA 1WDTA 3GQBA 1CR0A 3DO6A 3I8SA 3KKNA 4MITA 2PPBC 3R9IA 4KKUA 1S1MA 4A0RA 4A2WA 2I3BA 1EWHA 2NO1A 2CL7X 4DLWA 4YCUA 1GRRA 1KI6B 2V1XA 3MWLA 2Y0SG 3UKDA 3K9HA 2R7ZH 3HOYG 1LTLA 4A3IG 2UU9Q 1NTGA 1AKEA 1Q46A 3IPXA 3D31A 3KX2A 4WW0A 4AYBG 4A3KH 3Q5DA 3CIOA 4RD3A 4BWYA 5J4KA 2A68D 1GUNA 3H0GG 1KAGA 3PUXA 4AD8A 3KQNA 4JI7L 4PC3A 5DYGA 2VUMH 3T53B 2WJVA 3EPHA 1GD7A 1FFHA 2G3YA 2ZITA 1NBMD 5EZ6B 4D4JA 3M4OH 2N3SA 2A9KA 4B3TQ 2Y0SE 1VHLA 4CF7A 3K7AH 2UXDL 5FI1B 1ZCAA 3UDXA 1QHHA 1AS2A 4DT1B 4Q9HA 3K80C 4QNRA 1XMQQ 4V0ME 5BWMA 1YHNA 4EFMA 4LF6L 3CW2A 1N34Q 2OO7A 3PFIA 3L8YA 5KNBA 1MKHA 2QSYA 4YC7A 3AKCA 3AKYA 4IOKA 4POGA 2OBMA 3RABA 2Q0HA 1HUQA 3ND8A 2RGXA 4JCVE 3KJHA 1IL2A 3WMGA 1N32Q 2OLJA 3KDSE 5G41A 3SBEA 1MOZA 4RKFA 4OHWA 3U3MA 1IQPA 3T15A 4B33A 4YWMA 4DAMA 3DOEA 1K5GA 1D7QA 2DPXA 4OWWB 2GNOA 2WJGA 1KJZA 3BORA 4G1UC 5KSOA 1CKNA 3ETLA 3LDAA 1T5LA 1XXHB 3IO3A 2VS1A 3KUCA 3D0FA 2NVQH 1U8AA 3PIOA 1PUJA 4A3KG 2CMKA 4OQXA 4M1KA 3RSLA 4RD4A 5EQTA 1A4RA 4DV7L 3CC4A 3NBYC 4DK1A 4GN4B 1NIJA 3C16C 4IEEA 4JLDA 5AUOB 3GP8A 1XTDA 2ZE5A 4A4DA 4IOJA 5GVSA 4D0NA 2IYSA 1RC8A 4OWTB 4UP8A 3H0GH 4HIOA 4GOXA 1VYUA 2OFOA 3VKGA 1DE0A 1W44A 4B3BA 2JJ8A 1KI2A 2C8VA 2GCNA 4Q7LA 3UMSA 4QJ4A 2E75C 1AE2A 4DK3C 1Z6AA 4L16A 2PJRA 4JI5L 4DT1A 5BQ5A 1NF3A 1CJMA 1WP9A 1KY3A 1EQRA 2J3EA 2NGRA 4OQFA 3PQCA 4WIAA 3MEFA 1ZINA 2E2IH 1Z06A 3HOUH 1YRAA 3HR8A 5K36H 1RIFA 2R9VA 1HH4A 1WA5A 1YQTA 2B8FA 3QF7A 4S2EA 4A0FA 4F38A 4I1SA 1P61B 4OQMA 3EC1A 1U9IC 4Z1MD 3ULLA 1LB1B 1OFHA 2WSSA 1N8RC 4L8JA 4YCWA 4DCSA 4ZI2A 1CR1A 4KJZA 4IJHA 4DEXA 1KIMA 4Y0AA 1KSHA 3FMIA 5DSZA 1N6RA 4OO1G 1FTNA 1P2VA 1O7LA 2VF8A 3BDOA 4Q5IA 4RZUA 1XPOA 2H7VA 4IOMA 1KK1A 2BDOA 1E2FA 1ANKA 1CKNB 4NCHA 4AKGA 2ZJAA 2XB4A 4DEYA 3SI7A 4DCTA 1GTVA 4B3RL 4JK1C 4DUYL 2EFGA 1E22A 3CX7A 4NB3A 1XMJA 2JLWA 4HJ7A 2WB1E 4RY2A 1R0YA 3K8YA 1XCGB 3EIHA 1V9PA 4U7DA 2VH5R 2WWHA 3AGQA 3SQWA 1YIJA 2VQFQ 4LYJA 2NO7A 3QEOA 4ZV4A 2E87A 1NY5A 4JI0L 1S96A 4B3XA 2IHFA 1ZM4A 1FUUA 2AXPA 1E0JA 1Z7TA 1NJIC 2VHCA 4AG5A 1YJWA 2UUBL 1G5TA 3LO5A 1WE2A 2ZIAA 3MD0A 4KU4A 2ERYA 1H9JA 5JWOA 4FDBA 4CEIB 4IFEA 2YVUA 2UVQA 3NE5B 3ZZUA 2QBYB 3PCRB 4JL8A 4HLUA 1TF2A 2EQSA 2A2ZA 3KDFA 4ILEA 1G5RA 3ZVMA 4JI6Q 3NC0C 5FLMH 4B74A 4JT4A 5FPHA 3SYNA 3KOJA 3HGBA 4F7WA 1NSFA 1M1YE 1IN6A 1B70B 2Z6KA 1XPRA 5EJEA 4QM7A 1VQGA 3TUZC 3TSOA 2KHJA 1DEKA 1M34E 2PEYA 4KYIB 4A8JA 3K70C 2YC2C 1WYDA 1K5DA 3ZZTA 1YBYA 1IY2A 1SVWA 2HF8A 2HV8A 4US2R 2QP9X 4KFSA 2VO1A 3HYRA 4LV5B 4WJ3M 4TKOB 1BYIA 4ZO4A 4A93H 2J0VA 3I72A 3HOXG 1GKHA 1EFWA 3SJZA 1I2MA 8OHMA 1M8PA 3T1YQ 5CIWA 2DHRA 5L3SB 1N34L 4HB4A 2ZM6Q 4A3JH 1PH6A 1PH3A 3UK6A 1X1RA 2GK7A 2ZREA 5IWAQ 3IHLA 3X1XA 2NZHA 4C7OB 2W6IA 3ZVNA 2UKDA 4YMWA 2PMDA 5IE8A 3U7EB 4UNPA 3UMRA 3WHLA 1PLKA 1UFQA 2RHQB 2G6BA 3T5DA 1LFDB 1UE6A 3PO3G 3PO2G 3FMOB 3TVTA 3QVUA 2OG2A 1A62A 1Y63A 1TQ6A 2D2FA 3LVRE 3U3KA 3GJ4A 3FKIH 5JEAG 3A0JA 1FOEB 1G3IA 2DCUA 5JRZA 1BKBA 1FMLA 1P5ZB 1YVCA 1JT8A 4GS3A 4CEIA 2ZJYA 1Q3HA 1PH2A 1HNXQ 4A76A 1KMHB 1YR9A 2J45A 3IFTA 2PH1A 2NMVA 2OHFA 5FUYA 5E95A 4BFXA 1R4AA 4V0MA 1GO3E 3K9GA 1P4SA 1GITA 3OEEA 5M5WH 5EUQB 2GXUA 2CWAA 4URXR 3U3RA 4LX0A 1II8B 3PXGA 4HUQA 4GDFA 1NVVR 1P9RA 1W4RA 3IBGA 1YZ6A 4Q18A 2P6RA 3HDTA 1KDOA 1US8A 2CCKA 3DMNA 1UKZA 3P32A 4NYMQ 1S1CA 2L0XA 2ZR9A 3A4MA 4TLBA 3TR0A 4EPVA 1XF9A 4WA7A 5C18A 4G5QA 3U9SA 5HCIA 5JZVA 3HKSA 1KO8A 1ZU4A 2EDGA 4YY3L 1JBKA 3GFOA 2QAGA 2ZJ8A 4TMZA 1VQHA 1YZTA 5L3SA 2JLUA 2F9LA 1XBTA 4QC2A 2WWWA 1W2HA 4XD7D 4NXNQ 2Q6TA 1Z9FA 5G3ZA 2JA6H 2JQOA 1KI4A 1IY1A 4MDFA 1XZQA 1GL7A 4DCNA 3L2OB 1P8LA 1CU1A 2GVBA 3PITA 5FTJA 2C9YA 4MUAA 3BS4A 4NYMR 1XEWX 2CLSA 3U3OA 4KO8A 2IXEA 4Q7MB 3QVVA 4YDHB 1Z6YA 1BYUA 1ZNWA 4IPHA 5SZJA 5IHPA 5F9FA 3GEEA 1DGSA 1JJ7A 2J7PD 4JC0A 4KLZA 1Z8FA 4QGGA 3O8BA 2DFNA 4LSGA 2KCTA 5JEAH 1KMHA 1UBCA 4B3FX 5M5XH 3TVDA 1TWAH 5K8IA 1CF4A 2VP2A 2JATA 1SMXA 5GQOA 2WVJA 5KYKA 3HOXH 3IILA 3SNHA 3TREA 3G82C 3T1QA 3ZH9B 4LF7Q 1BBUA 4DSTA 4JVLA 3RLNA 3GJ5A 1JR3A 4IJMA 1BVSA 1ZW6A 1B23P 3BZCA 2BDTA 5GAGC 1JMCA 4XJXA 3CKLA 2UZ3A 3AB9A 3WNDA 1ZNXA 1XTRA 5D3MB 4IO9A 1WCV1 4UNNA 4C9BA 1XEWY 4L15A 4R4CA 1QG4A 5CM9C 4PZZA 1K8MA 5A0FA 2ONJA 4OX9Q 1C1YA 1FP6A 2ZJ2A 4A3BG 2CWPA 1M7HA 4Q9IA 4DDTA 2D2CC 3S1RH 1DADA 2BM0A 2PNRC 2NZOA 2DWQA 1IYJB 4ZKDA 2ZRDA 1A0IA 4UY8C 1HT2E 1N6PA 1XU4A 3C14C 3RANA 1EFTA 2NVTH 5ANRB 2QUZA 1B9MA 1WRBA 2K5NA 4LFBQ 3K0CC 1ZM7A 1FTSA 2HCBA 4P4TA 4XSHA 2CVFA 2YTXA 4GLAC 2XNSA 3OFND 3BH6A 4HB3A 3H3VH 4IHQA 4TYPA 5JECA 2ZT9C 4DB4A 2PNHA 1J70A 3GFPA 2OQKA 5GADC 2BKUA 4DC9A 1SVIA 2HDNB 1XD9A 2H17A 1MRNA 2ZU6A 5DE3A 4RFVA 5CIQA 2WWYA 1L8QA 4DV5L 5IYBH 5UKDA 3R7WA 3A7AB 4P0TA 1LNZA 4ASUA 4B6EA 3Q5EA 5G40A 4YDSA 1E9EA 1EIYB 3T51B 1O3YA 2UXBQ 4JKYA 1N33Q 1IAQA 4G5SA 5JWHA 2NTYC 1ZRHA 3RS0A 4F4JA 1UEBA 3CM0A 3AVXA 1WQ1R 2G83A 2P5SA 3KLWA 2ZU0C 4IKEA 3UXMA 3A1UA 4RKEA 2DFLA 2P3SA 4CZ2A 5LMNL 3T35A 1VQ4A 1QG2A 1NY4A 4DR2L 5FL7D 1R8QA 4A3CH 4PQFA 3KQHA 2JA9A 3SFZA 1BKDR 2O8EA 4TLDA 1Q86C 1YI2A 5HY6A 1KRSA 3I62A 3TSZA 1V1QA 4QIWE 1U5KA 4BY7G 2ZUBA 4DR1Q 4TL9A 3T1HL 4C0AC 2QN6A 4LUOA 4MKGA 1QJOA 3PIPA 4GKKQ 1JEDA 1GKIA 2ATXA 1AIPA 2V7QA 2Z5FA 3GLHE 3LA6A 4ME3A 1G17A 1WMSA 3CRVA 2IWRA 2BIFA 1HR0Q 4B43A 1WXQA 1LW7A 5EP3A 1PUIA 2WKPA 2IS1A 1G1MA 4HB0A 5JJKA 1LF0A 4XOIA 3AEZA 1MT0A 1Y14B 5LB4A 4C0KA 4LFAQ 3NBZC 4O2RA 5KO2A 2BCGY 1IXZA 1GHJA 3QKTA 4A8JB 1DPFA 5GAHC 2N46A 2RGNA 3AV0B 4KSBA 3K1JA 4YMSA 5DI3B 4HJ5A 4V02A 4QQBX 2ZSEA 1H9KA 1I6VC 3CF0A 1NJGA 2WP8J 1Q20A 4QGAA 1OHHA 3Q8XB 1HT1E 3UDFA 4KV9A 4TQ9A 5E7MA 2ASEA 4HJAA 4O25A 4PAQA 4LHZA 2O8BA 3EPLA 2BA1A 1MO5A 1GUSA 4ESVA 2C5LA 3B1XA 3QXCA 4URYR 3W6PA 2HF9A 3AF2A 2YV5A 3GLGE 3B1ZA 4IVQA 4EDHA 1E3MA 1CIPA 4W9MC 3QPUA 3DOFA 2ZR7A 2CVHA 1H95A 3PUWA 4JI8L 2PL3A 4EFNA 3I4NH 3LW8A 1B8AA 4F4CA 4L5TA 4QM6A 3I7FA 1VQIA 4TTPA 4OI0A 1IZ6A 3LBIA 1RIPA 1PLJA 3MWYW 3K9NA 2CE2X 5H68A 2K5HA 5KUTA 3EW9A 2VW9A 1IM2A 4ZDJA 4AYXA 5TB5A 5F98A 3HPQA 2ZETA 5EXPA 1Y8NB 3GTOH 1G20E 2VHJA 4PSAA 3V00A 4PG3A 3GEIA 1DOAA 5JFGA 4LI0A 3FB4A 4DSOA 4JLPA 4PAMA 3GTLH 5KDOA 4EJSA 1ASYA 1D9ZA 4IXMA 4GMXA 3C5HA 4D2IA 3GCGA 1EWQA 2QMEA 3THOA 1OH7A 3QKSA 2K14A 4EAQA 2ZQ5A 1JNYA 2ZE6A 4ZIRB 2R93G 4D6PA 1L1OC 4FMBB 3ICQB 5KSZA 3V4RA 3CF2A 2J0SA 2CFMA 5LB2A 1HY3A 4A3IH 2NVYH 1TL7C 3KKOA 5DI3A 3GJ3A 3VTKA 3OZXA 1ESNA 2E76C 1OW3B 1P7CA 3AVVA 1PZNA 2XITA 3FE2A 4QHYA 1R5BA 2HJVA 2XJ9A 2PCLA 5C4GB 5FH9A 2WOOA 1YJ5A 4Q1DA 1SGWA 3C41J 3GLGB 2FPKA 4DR6L 1BBWA 1NMFA 1KY2A 1H9RA 1E2NA 2JLXA 3THXA 3J81c 1E0AA 4GI7A 3FFBA 1VECA 2J5XA 3GJ0A 5TVKA 1GL6A 4LJ8A 5CLLA 5FBRB 2VF7A 2Z0MA 2ZRPA 4JBWA 4MYTA 4B3CA 1LTQA 4W5WA 1N6IA 4LJ5A 3LLMA 3RDPA 2ZYWX 2X19A 5C46F 4G7ZC 2F1IA 4LF6Q 1FNNA 1F5NA 2ZRBA 3L8ZA 4TYYA 2HLDA 2XOKA 5JCZA 4HB2A 4Q9LA 1OH6A 2FGKA 3NXSA 1NNEA 3PJRA 2WWIA 4AYBE 2X2EA 4BE7B 1OFTA 4FI3C 4IVRA 3NKVA 2WJHA 2R7DA 2F9MA 5BN5A 2EFDB 4UNSA 3U7GA 5FTKA 4YXWD 2Q21A 2G0TA 5IK2D 3A74A 3PUVA 4X64Q 4DUZQ 1W2GA 2N49A 1VQNA 2BVNA 3LX5A 3MG9A 3QKSB 2IX1A 2ANCA 4MKHA 4BFYA 5KOYA 3W1GA 2VP5A 3KF6B 1X3EA 4DWJA 1GILA
chains in the Genus database with same CATH superfamily
4PG5A 5ALPA 2IHKA 1EWIA 1SYGA 10MHA 1NW8A 3E2PA 2UVPA 3RFVA 3PKZA 4PIPA 1L5GB 1W0KD 2I6UA 4OFXA 1UBJS 2XUZA 1H8EA 2C2YA 3ZWYA 1SVOA 4I7EA 5AUPB 1U0RA 4FYHA 5FP0A 2R93H 5I9LA 3FHTA 3BWDD 1XRMA 4UARA 4DIMA 3BGIA 1QH0A 4DC1A 3CVXA 1AQJA 3NQ41 3EAGA 1RYFA 2ZJ6A 3LY9A 4IS2A 4OMUA 3FCCA 3MJHA 3C8MA 1C7IA 1Z5ZA 3L0YA 4L2IA 2JLVA 1IXRC 1W1IA 2PK3A 3G17A 1KR2A 3D4NA 3MLBA 4GYKA 1BE8A 5KSPA 3F9IA 3FKSD 4RY8A 1ZJJA 2Q2WA 2QSUA 3TDKA 4M8NE 2P9EA 2WKWA 4PLHA 4AF6A 3MFQA 4W82A 1THMA 1R12A 3MGBA 3QM1A 1PFWA 1TXGA 5F4BA 3EJ6A 3WDLA 4V1CA 1GSAA 5CB4F 2IPNA 3HBJA 2L1BA 1EJ0A 2R1TB 3RUHA 1KI9A 4ESHA 4GN5A 4GQBA 4AZTA 4BZPA 3Q5GA 4TRJA 3NT2A 1PKEA 5C1DA 1W49A 2AOTB 3REFA 2IYTA 4KD4A 4ONEA 2AFIB 4LF5L 3KUDA 1WW8A 2GNAA 3N3BC 3FMFA 3QXHA 4M9RA 2B0CA 1G21A 1ZYUA 1L1EA 2ETXA 1FS4A 3SBOA 4YHHQ 3DMDA 3HSKA 4BNJA 3CRQA 1ND5A 221PA 3DWAA 4EB0A 2BKVA 3DVLA 3GEDA 3KAPA 5J3BA 4FYIA 2D62A 1HNZQ 1I4LD 1Y9EA 1YAHA 3B7PA 1NRWA 3CGGA 1RQXA 2ERCA 3FHJA 3FR8A 5HCNA 3LHDA 2OXRA 3QI2A 1DDOA 1H8HA 1T4CB 1Y8QB 3E7PA 4CN8A 5JJZA 1LK7A 2FW1A 1OB5A 4MS3A 4HR7A 4JR0A 1RQGA 5B64A 3D7MA 1TAGA 1T0IA 2R60A 2Y1LA 3WRXC 2CL0X 4A6PA 1Y8ZA 3LSTA 5IC5A 4D26A 1RXVA 4WBNF 1LX7A 2KHZA 3HFJA 3ZI0A 3GLIE 3V1TC 4UHJA 1IHZA 2OESA 3HZOA 5DT9A 5C5LA 2AYZA 2JD1A 2LKDA 4ZD6A 4OM7A 5TY0A 2XWBF 2QRHA 2OG1A 3OEHD 2RDMA 4Q24A 1X2EA 1XJQA 3JWIA 4G89A 4PLGA 3SJBA 2CDBA 4N47A 4CM9D 5JATA 1IZ9A 5L6MB 4MUBA 1AVTA 1G2SA 3VTZA 4HADA 3PPVA 4QUBA 3ET5A 5KPJA 3WLAA 3NQTA 1NOJA 3HA5A 4V3CA 2DPMA 4M8LA 2A73B 4P5DA 1N0HA 4YUVA 1RI4A 2I3AA 2YHBA 4RJ2A 1SVMA 2HA0A 3NG1A 5J4VA 3S28A 3X3HA 1AO3A 1NVUQ 1ZJZA 4I5FA 3X1MA 2AFIA 4I6JA 1E96A 4DMMA 2CKZB 3PHIA 4PYIA 3C70A 4P3NA 2BDUA 2CK3A 2O1WA 2O0HA 2QJWA 2WKQA 4KRGA 2AKAB 2F0HA 3NALA 4HQKA 4PX5A 2B2CA 4L95C 4TL8A 3OFVA 1QVFA 1DMRA 4MO2A 1J1ZA 5CH8A 5J5AA 1KRXA 2D5LA 5C4XB 1F8GA 2NQ2C 3DTYA 2YCBA 5CV7A 2AR9A 1FX0A 3SGLA 4GDMA 3MSCA 3DDNA 4ZAIA 1CFJA 1NCVA 4N8EA 2W2MA 1FVHA 5KPDA 4MLCA 4GM4A 1KC1A 2A68C 4XT1B 3RHFA 1YZVA 2ET6A 3UUWA 4CKYA 1U11A 1IQUA 1F8FA 4KKXB 4J3FA 5KWIA 1Q90A 1XF1A 2C0QA 5CLJA 2R2GA 4XVRA 1VQMA 2F0KA 1NX6A 3VOBA 5FO9B 3TPCA 5KNCD 3G2MA 1LBTA 3ILXA 2VJAA 3AUSA 4EJ0A 2AZDA 3Q7RA 2G1PA 3NDJA 2PL1A 1ORIA 2PANA 3FVQA 4MRAA 1R5NA 1ZYRD 1UT8A 2H2IA 4PLVA 1FP7A 4R8RA 1KK0A 5EKUA 3UH0A 2FUCA 1LO5D 1Y1WB 1WQ4A 1K0FA 1UEIA 4RFSB 1DQPA 3H9BA 2XGJA 3PTAA 4KOAA 1DTWA 1YQXA 4LFBL 3KLBA 1Q3KA 3SC4A 3WQBA 2O0LA 3K1TA 4YAEA 4DV4B 3WO1A 2EZ4A 1V8PA 2VPYA 3W7AA 2XCOA 4EGAA 4HEA1 1KAHA 1IN7A 2A8VA 1CETA 2WRZA 1H2BA 2OEOA 2ZYRA 3A4LA 4ZDWA 1HE4A 4ZYVA 1TYDE 1HDRA 2YIJA 3TQIA 4QVKA 4UTVA 4MI1A 3HWWA 4KLKA 2P5YA 5K2MA 1QVCA 5C5CA 4M87A 2FWIA 1XEFA 2HRQA 2JFBA 3I2JA 1KQ3A 4J4TA 4ZA2A 3GUUA 3N0XA 1D04A 4HEQA 5EHGA 4IL5A 2E9SA 2EYLA 1SXJD 2P77A 2NPIA 1DCZA 4LHEA 3RH0A 4UHHA 3H9JA 3BMNB 4NE2A 1DUVG 4N54A 3HXOA 4DADA 2RH4A 4BMZA 3JPWA 2PH3A 3ZWCA 3JQGB 4U7GA 3L6DA 1W6JA 1Q0LA 8ATCA 4DKAC 4YRTA 5JAUA 3CCLA 1PFVA 2Q5JA 4E1BA 5JS8A 1C0KA 4CG2A 5CNJA 4Q3NA 1SJHD 3SHFA 4RK6A 2QN1A 2QCPX 2FCAA 4ODIA 5JPCA 2XVXA 2BSAA 1CPYA 2X8JA 5IJAA 1HOTA 2ZGVA 1M1XB 1Z45A 3K1ZA 2Q2HA 1NSTA 3PZRA 4QBGB 3A9UA 4R7ZA 5IJ0A 2AVNA 2FEXA 4IZHA 1DC7A 1U81A 4BO7A 4OBEA 5KVSA 5K36G 4XFKA 4DPLA 3IKJA 4J0IA 2F0NA 3WY9A 4JROA 1P29A 1W5EA 3CR7A 3SZLA 4BNZA 5L4LA 2JFHA 1IZ0A 1YFZA 2QA4A 3DZCA 1UR5A 3TMYA 3FPFA 4IHAA 2C2WA 4LC0A 4K14A 1C0LA 1RCFA 3N59A 1WUKS 5BYJA 2XAUA 4OJMX 1K7YA 3NRBA 3T9AA 1DBSA 2R8YA 4PCVA 2O20A 3AP2A 1WBJB 3KJNA 3UHAA 2P8SA 3GOHA 3I8XA 3KXLA 3S7ZA 1R0RE 1QNLA 5EMJA 5FR1A 3VH4A 4E09A 3PO3B 3PO2B 3OP1A 2GEFA 3TZQA 4ARSA 2DLDA 2JLQA 3OX3A 1CFMA 3JAML 3FSJX 1H9BA 1LK0A 3JQBA 4F60A 4TN5A 1P3Y1 3AHEA 1WXWA 2O48X 2ZBRA 3ASZA 2NTVA 3G5UA 5BV0A 1W3SA 4B76A 4EFLA 3DKVA 1UBEA 4ZICA 2CJPA 2IEAA 2OL4A 1A9QA 4X66Q 1TI7A 4HEHA 4KI7A 4YONB 2XB8A 1PFBA 4YCVA 4DR4L 1PEYA 1PWZA 2ZWVA 1E18A 1RWOA 2JAXA 1IEVA 5KRUA 4ZI7F 2QDKA 4BQOA 4J2HA 1G7SA 1TVEA 1XQ6A 4JI4Q 2ONZA 4O8CA 5CM8B 4QUEA 5IVDA 2V1UA 3FGNA 4URWR 1CEEA 4DB2A 1GNQA 2FN4A 2Q1WA 1I3CA 3UUEA 1S2MA 2JI4A 1VG8A 4K0KQ 3VC2A 3ZDCA 2RBGA 5A5DA 3T9FA 4IVNA 1I7PA 5C5DA 3RGGA 3IAM1 4H0LC 4GWKA 4UCXA 2RAFA 4QJ5A 4MULA 1I01A 3O9VA 3OT1B 1AD2A 4YRIA 2CHQA 3CZ9A 4Z3KA 4JQCA 1P62B 2AEMA 1T5TA 1E61A 5JXGA 1UBHS 4W7HA 4FFRA 4YN3A 1D03A 1ZONA 1Y1PA 3CTMA 3U13A 2BGUA 3H7IA 3KXKA 4FS3A 3ZPXA 1V9LA 1OIWA 1U7TA 2X0IA 1JB1A 4QRIA 4TTSA 5EHNA 3TK1A 2ZDHA 2AKYA 4MRRA 3OCCA 2UUBQ 4LZJA 2V7GA 4RSGA 4MNTA 3WLLA 3RMHA 1T25A 5F21A 4FLMA 1JA9A 2IYQA 1AF7A 3ICCA 3LQKA 3B70A 1RYDA 4K0KL 2FXQA 3KFXA 4OHMA 1OT3A 1HDEA 1P4JA 3NXKA 1UFVA 1YZ3A 4G0QA 3VKUA 1W36B 1QV7A 2IZZA 1LSSA 3H2KA 2BI7A 3I76A 3R8XA 2JFXA 4WORA 4DV0Q 4DR5L 3P9NA 2RF4A 2JARA 4FP5D 2FMMA 1KRHA 4R4JA 2CXNA 4V38A 3U7FB 2H1OA 4IOAA 4P5EA 3RG2A 2YWHA 3A10A 1GRVA 4WXRA 3HMKA 1U90A 3PC8A 3FCYA 1E9DA 1IOWA 5FLKA 4CL2A 4BJ1A 2WUWE 3W2TA 2VA8A 3H8VA 2AR7A 3GPIA 4A3JB 1AT1A 4QUJA 4TMFA 3JCZA 1SUIA 3DB2A 1SU6A 3ELUA 3DBLA 3TOSA 3H1TA 2FJ2A 2F1RA 3WK5A 2X6LA 1SHKA 1ZUHA 3DS8A 1KQSA 1EUJA 1QKKA 1B0ZA 2QZZA 4D25A 1OBCA 1N2IA 1LV9A 3MT8A 3W3AH 3ZHOA 1P4GA 4TRNA 1OO9B 2X8WA 4Q39A 4F46A 3IL2A 4UAUA 2X69A 2H00A 3FCSB 1H1TA 3K0FB 5C1OA 3VYUB 3C7AA 5LR6A 4I1PA 2HHJA 1SSOA 1E2QA 1G8YA 1WMAA 2OEPA 2WF9A 3ETHA 3GAFA 3OECA 3EIOA 4HWKA 1Z07A 4Y1FA 4DLTA 1JJAA 1HNNA 1PE0A 3CEJA 2PKEA 2Q2QA 4KHZA 5JHHB 2BH2A 1DQRA 4FEYA 3DBIA 3EYWA 3CCVA 3QWAA 4HAOA 2H2DA 1JKFA 3R23A 4UP9A 2RJ3A 1IRIA 1RJ9A 3GZJA 1G42A 1GHKA 1UZMA 4YR7A 3RC2A 1T36A 1YRBA 3H1BA 4RNDB 4BNKA 1A9YA 1KGSA 2W22A 4BQQA 3PEWA 2B5WA 2P4HX 3PE4A 4D8WA 5TMBA 4DJEC 1XMQB 1NFRA 1VQEA 1I1QB 2QVZX 1IBSA 2F3PA 3A26A 1Y1VH 4Y2QA 1F4LA 3SDSA 2PMBA 1X9GA 1KO4A 1ISMA 1EFCA 4Z99A 2JA1A 4P4SB 2X0EA 1QZXA 2HLNA 3ZGNA 1NQ5A 4Q4HA 1NQOA 4QUIA 2HN9A 2A1TS 2J6HA 3TTSA 2HL6A 1Z7GA 3IV7A 1C2YA 2WFWA 1EFRA 1W5BA 1WFQA 4G57A 4FT4A 4M1OA 4CQMD 5K3EA 2H9AA 1OX6A 1N2CE 2EOTA 4MGHA 3CCBA 4EO7A 1SRUA 2IHYA 5A7HA 4BEJA 5TF4A 3ICEA 3SCZA 3A4IA 3E1KA 3R5KA 4EP1A 5HRUA 3CYFA 1GG2A 4N0PA 2FP3A 1QF9A 3BD7A 1PVOA 1UC5B 3GGCA 3L0ZA 3PHGA 3VR6D 4AQDA 4CM4B 3D7SA 1F0PA 3D6MA 4MVJI 5D84A 4OHZA 4PPFA 1NXSA 1PFSA 3VYUA 4L1KA 3NTIA 3IAS1 3A4YA 4GXQA 5EGSA 3W5SA 3A8KE 2JC3A 2GN4A 1M6NA 2PBRA 3DL0A 4DGQA 5JCXA 5KTNA 1O9GA 3ZWMA 1NF2A 2WG0A 3IBCA 1Z18A 5LN1A 2X77A 1GXSA 5F23A 4UU8A 2O0MA 3QE9Y 2I4TA 2O0JA 2Q8TA 2LKVA 1EVKA 1GARA 1WVIA 2D0IA 1NATA 2NG1A 2QD3A 4GOMD 4RGQA 2QTVB 4NMMA 1QWSA 4TMTA 4WOKA 4LV6A 3TH5A 3GOQA 2E4UA 1ICFB 3HWRA 1LQTA 2HQRA 4IDQA 4BLOA 3GEGA 1WHTA 4O59O 1T4DA 4WCDA 5K5PA 3OUUA 2R6HA 2QVYX 1EK2A 3S0JA 4DLUA 2SDFA 4BY1B 4O3FA 3IXMA 3SU8A 5DN9A 3KFUA 4OO3A 4ZT2A 3WFIA 3N0RA 3K9FC 4ZRZA 3MMNA 1MRZA 1MDBA 4E12A 4IDFA 3HUUA 4EZBA 4K1LA 1U8UA 3O31A 4L5SA 5K09A 4O4JA 2D74A 1WM1A 2PPLA 5GONB 1NTRA 1ONPA 4DIOA 5E3JA 4X60A 1BOSA 2F4VL 5KIAA 3KE8A 1XEXA 3ASYA 4CCSA 3DGFC 4AJEA 1J2YA 2Q6IA 5ENDA 5KHLB 1VQDA 4IXDA 4C43A 4CDNA 3USZA 5CDGA 2D5DA 4A3DG 3OMWA 3H0KA 4PYMA 2P5ZX 2I66A 3HOZB 1QBKC 4PPGA 2C57A 1IOVA 4U2DA 4YAJA 2G7MC 2ZBEA 3EWSA 3VR6H 5D1NA 4C29A 1DWPA 4TM7A 5AKGA 4DAEA 1WD1A 1VE9A 2HBYA 4F1JA 3IVMA 1UOPA 5CDSA 5CM2Z 4R69A 1HZZC 2YWRA 5HWSA 1DIHA 1JHMA 1GG9A 1Q1GA 4RDHA 3A28A 3K71B 5ALVA 2I8CA 2RGUA 3AV3A 4I6GA 1L5YA 4I2VA 4BBZA 1PTKA 2IXTA 4C3OB 4CQLB 2F67A 1Y4SA 2ID8A 4F6CA 2OZLA 3VC1A 3GFFA 1SCDA 3PBKA 4YMUA 2P5UA 4L6AA 1DTSA 4EI8A 3I09A 4YAIA 1MTOA 2GBFA 5CX1B 3E0QA 5E6RB 2R8RA 1U0FA 2KI5A 3KYHC 2VDRB 3NEPX 4M54A 3U9TA 2GEJA 5CC4A 2H4WA 3BKXA 4HAEA 1GN9A 4YLGA 4C87A 4BMNA 1VIAA 2EXXA 1NXTA 2VK4A 3F3KA 1DAMA 4NPSA 1L5SA 1UXGA 3QWFA 5JPMC 3M7NA 2OO5C 4JNKA 5LZ5A 1N5LA 1HDXA 1Y33E 3RUAA 1SVSA 4OXIA 2A19A 3QY0A 3I4LA 1XEXB 4QU9A 4Q1VA 1U3FA 2WT4A 4KQWA 4V03A 4RH1A 1WSDA 5DIFA 2OCYC 1JSXA 5EMMA 3WSVA 4IZ6A 4K26A 4PBTA 3ZV6A 1I5EA 2QLJA 1JFVA 4P2CB 2ADFA 1PYSB 1N2EA 3DDWA 4HWTA 5TGTA 3FJ1A 3PG5A 4PC6A 4C7VA 5LNK1 4FHCA 3DM9B 1XD2A 1XVVA 4L50A 2REBA 3U48A 4YUWA 5K6AC 2QIOA 2Z08A 3GVPA 4K9MA 3TSAA 4IF6A 3IEUA 1KRWA 1MSGA 1SMYD 2GN1A 3WO0A 1SRRA 4OIFA 2VH2A 4ZODA 5KYXB 1YB4A 4A91A 1G66A 1TKRA 4JBMA 1OF1A 1TUIA 3CA8A 3CU5A 4MGIR 3R9XA 3NIDB 5KS2A 1QHEA 3E9YA 3ORHA 2Z1CA 5FOSA 3BTSA 1YBMA 1XZLA 3BFKA 3CPEA 4PYOA 5ALJA 3E9RA 5AKYA 5KKCA 1YHQA 4J7AA 1S7CA 2JYOA 2LXJA 3KZKA 4B3SL 2BEWB 3DOOA 3W5VA 5CG2A 2VEDA 4B3TB 1CZNA 3TB4A 4R6WA 2Q5HA 3O8RA 4HGNA 3L49A 3UCFA 4G01B 5FUXA 2YWJA 4YHHL 4F2PA 4WZAA 3VKWA 4HNAB 1FMJA 3BG3A 2AOWA 1FA9A 4R9RA 1E2ZA 1GNRA 2C9MA 2RC6A 3NJRA 1RRKA 1JPJA 4Q9DA 5DGXA 1PAUA 3C5CA 4IJUA 1IBLQ 1T8SA 1THGA 2R6FA 1R16A 1Z7BA 2EKBA 3AMUA 1QGYA 2GSDA 4A3EH 4MZ9A 4HN7A 1KFJB 1KIFA 2Y9PB 1YEZA 4L5BA 4MW2A 4TTTS 4WVLA 3W06A 1EGHA 1HYBA 3FPGA 1N57A 1PQYA 1QFYA 5KTSA 1VQBA 4O4LB 1VMPA 3SOPA 3H5WA 3TAXA 1Z6XA 3LRTA 4QG3A 1AZTA 5C9ZA 4IXWA 4PZ9A 3K70D 3C8DA 3FUUA 4R3NA 3SX2A 3THXB 1ZVVA 2BKAA 3U81A 3UAZA 1CD5A 4N6NA 2VOEA 5D5PA 5TT0A 2R5WA 2CEKA 1JXOA 1XWEA 2VDQB 4KCGA 3OFSA 1ZMBA 3CAMA 2VUMB 3R09A 1FPMA 2DUWA 1N0IA 4BO6A 4BJHB 4OREX 3ONFA 1SMYC 2TSYB 3E82A 3SQXA 4I81A 4IFBA 3B5JA 4OHUA 4C0HA 2HUPA 2QDXA 5FADA 3GLGA 1S3SA 4NU8X 1O96A 1PT6A 2P67A 4K0KB 5AKIA 2ZJBA 4TQAA 2X7HA 4YLEA 1KO5A 3VO8A 5GMOA 4DLZA 3P0EA 4MCHA 2NVXH 5GJCA 3NT4A 3GGPA 2G08A 1JYFA 4GNKA 4HO1X 1PK7A 1Y8OB 2VDNB 4BBRG 1YRLA 2A4MA 1RTOA 2AYXA 2DPLA 5ALWA 2DJ5A 4IV0A 3IYLW 2B8WA 1EJ2A 5B2ZA 5JO0A 2YOHA 3CCJA 3C45A 3GDEA 5AKKA 4RTRA 3ZV7A 2A6HC 5JNVA 1QJCA 3TNDA 4PNEA 4JYMA 2EIFA 2KA7A 1H2FA 4PHTA 4BGEA 3KO8A 1SKUA 3MWEB 2HZBA 1JILA 4EJ6A 4EKEA 5BVHA 2CNBA 2KQUA 3BDAA 2GF0A 1G8KA 1UBSB 3FHLA 3K6OA 1Z7EA 2ZRQA 3QFFA 4UM8B 4ZREA 1XTSA 5CNKA 1KEWA 2PLFA 5JYEA 1YB1A 3C7TA 2NZVG 4C22A 5FJJA 2ZVPX 4IKPA 3MXNA 2Z58A 4U7WA 5GM2A 3K15A 4I4TB 4DIDA 4RD0A 2LXKA 4DQUA 3A9RA 5DBIA 1AURA 1AE3A 1A2KC 1FJGL 2QT9A 3D02A 4J4HA 1K7FB 4QDUA 3GROA 4Q9KA 3JQAA 2IEBA 4JJKA 1JEYA 1P7ZA 1PJQA 3DC7A 4IDCA 4YRMA 1ESCA 4GMKA 1X1QA 4IIJA 3ZZ1A 5COAA 1XLWA 5FTNA 3K57A 1YCGA 1ZK2A 1ZWKA 3O4HA 3ODGA 4MB2A 1IXYA 2ZUWA 3H5VA 3OICA 2IUUA 3UGJA 5EP2A 2EW8A 4JQOA 4K1XA 5LUBA 3T7DA 5EYPB 1E1MA 2C3UA 2ZI4A 4YRCA