1V45E

Crystal structure of human pnp complexed with 3-deoxyguanosine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Structure of human PNP complexed with ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v45E00
1A9QA 1PK9A 4GKAA 4DABA 5I3CA 3P0EA 1LV8A 5DK6A 3UAXA 1NC3A 5F7OA 5KB3A 4OGKA 5F73A 3KVVA 1NC1A 1Z5NA 4YNBA 4BMZA 3KVYA 1T8SA 2I4TA 1JDZA 3NM6B 3EEIA 1YR3A 1Z37A 4JOSA 5C80A 3GB9A 4LZWA 3NM5A 4DA6A 2AI3A 3DF9A 3MB8A 1K3FA 1JE1A 3BJEA 4NY1A 1M73E 1OTYA 4TXLA 2P4SA 2QTGA 4RJ2A 3UAWA 2AI2A 4WKNA 4WKOA 1U1CA 3PNSA 1K9SA 1JDTA 3OOEA 4R2WA 3FOWA 4D8YA 4NS1A 1U1DA 4FFSA 1Y1SA 4IP0A 1RT9A 3FAZA 1JDVA 4E1VA 1A9PA 4GMHA 1Z5OA 4QEZA 3PHCA 4TXHA 3F8WA 3OOHA 2BSXA 4JWTA 3P0FA 2A0YA 2OC4A 3KHSA 3EMVA 4YJKA 4L5YA 1G2OA 1Z38A 4M1EA 1ZOSA 4QATA 3FWPA 1TGVA 3DJFA 2QPLA 2OXFA 1PW7A 1K27A 3T94A 5CCEA 3E0QA 1U1GA 1PR5A 1JE0A 4JP5A 1A9RA 1Z33A 4OJTA 1YBFA 1SQ6A 3KUKA 4MARA 1VHWA 4PNPA 4TS3A 4DAOA 3EUEA 5ETJA 1ODKA 1VHJA 1TD1A 1B8OA 1RXUA 4TYMA 3KU4A 1SJ9A 3OZCA 1SD1A 2QTTA 3BSFA 3IEXA 4L5AA 4TXJA 1A9OA 4QARA 3GGSA 5CXSA 1JPVA 1OUMA 1ZL2A 3D1VA 3OF3A 2A0XA 3EUFA 3QPBA 4M3NA 3NM4A 5B7NA 2PGAA 4EB8A 1PKEA 5JPCA 1T0UA 5B7PA 2A8YA 4WKCA 1V3QE 3E9ZA 4TTIA 4F3KA 4GLFA 1Q1GA 3TL6A 1A9TA 2ON6A 4TXMA 1V4NA 1WTAA 1OVGA 4WKPA 4H1TA 3O6VA 4F3CA 4G89A 1V2HE 3K8QA 4QASA 4GLJA 3INYA 4L6IA 3UAZA 1U1FA 2OECA 2QSUA 1Z39A 1Y1TA 3FNQA 1C3XA 1YQQA 2AI1A 4D9HA 1U1EA 3PNPA 1TCUA 2I8AA 4DA8A 4M7WA 3K8OE 5F76A 5F7JA 1VMKA 3UAYA 4P54A 3FUCA 2HRDA 2GUWA 3FB1A 4LKRA 1JDSA 5FAKA 5B7GA 1LVUA 1A9SA 3NBQA 1VFNA 2Q7OE 4BMYA 5CXQA 1JDUA 1RFGE 2XRFA 4YO8A 2HWUA 1XE3A 1CG6A 2HSWA 4OGLA 1PR4A 4L5CA 3KVRA 2ISCA 5CYFA 1PR1A 4DARA 3SCZA 2B94A 4LNHA 1ODLA 3OCCA 4L0MA 1RSZA 1JYSA 3LA8A 1RCTE 5K1ZA 4DANA 4NSNA 1RXYA 4F2PA 1FXUA 1V45E 3O4VA 2HN9A 4UC0A 4ECEA 1PR2A 1PR6A 4BN0A 3OZDA 4TTAA 1PR0A 4LNAA 1TCVA 1I80A 2AC7A 1ODJA 1Y1QA 3DPSA 4R31A 4OY3A 4PR3A 4R2XA 1T8YA 3U40A 5IFKA 1NW4A 3OZBA 3OPVA 1CB0A 3IOMA 5F77A 4X24A 3DDOA 1ODIA 4BMXA 1OTXA 1ULBA 4MCHA 3LGSA 1Y6RA 1RYZA 3LBAA 4OF4A 5B7QA 2A0WA 5F7ZA 1V48A 2RJ3A 2H8GA 4LDNA 4QFBA 4KN5A 1TGYA 4D8XA 1Z5PA 4I2VA 4G41A 4U2KA 1Z34A 2QDKA 3E9RA 4TS9A 5EPUA 1PK7A 3OZEA 4F1WA 1RR6A 1QE5A 5F78A 1N3IA 4OEHA 3UAVA 1Z36A 3ODGA 3PHBE 4QAQA 1Z35A 4D8VA 1Y6QA 4DA7A 1ULAA 1RXSA 4F2WA 4MCIA 4WKBA 4D98A 1YRYE 1PBNA 3ONVA 1RXCA 1A69A 5EUBA 1YQUA 3UT6A 1OU4A 4EARA 3BL6A 5IU6A 2IQ5A 3ENZA 4DA0A 1Y1RA 1B8NA 4DAEA 5CYGA 3DP9A 1T8RA 4TXNA 4K6OA 3C74A 1T8WA 1V41E 4TTJA 3BGSA 1SD2A 4YMLA 5F7XA 3MMSA 1ECPA 2OC9A 5EFOA 1JP7A 1LX7A 1OV6A 5CCDA 4G8JA 1PF7E 1PWYE
chains in the Genus database with same CATH superfamily
2QL6A 5LVAA 4HDRB 4N48A 1MO3A 4MCAA 3N0VA 2W7TA 1ESCA 1UJ6A 5AUPB 3KLOA 1PGJA 3DWIA 5LQAA 1CUEA 3E9EA 1S9DA 5IWAB 3GEDA 1UP6A 2RHWA 3E3NA 1R6TA 3OUZA 4BAZA 1O3YA 2A2ZA 4HY3A 2EX1A 4PQFA 3MTBA 2DM6A 5HQJA 1B23P 2ZIAA 5BQ5A 3H0KA 4O4JB 1CHNA 2LIVA 1H8ED 1JNXX 1JHOA 3ANLA 2PRIA 4GL4A 2QTAA 1KQFA 5M7EA 1CPYA 4EW1A 5EP3A 3WK5A 1T0IA 1PT8A 2Y92A 3I5AA 2H7VA 1PCXA 2PWBA 1Z82A 3ZGOA 2PMWB 2HBRA 4YECA 1V11B 3BMOB 3HP4A 4BP3A 2WJGA 4WT7A 5E1DA 4G09A 1QRUA 3HJFA 4LW8A 3U48A 1A72A 3P9KA 2AI3A 1A4UA 4R69A 1N0WA 1XVVA 1W29A 2W43A 3WNDA 3CU5A 4TUYB 2IPNA 1ZO8A 2BUBA 4RAOA 5AI9A 3VX3A 1TTTA 1KEPA 4HH0A 1VCOA 1RC8A 1OAOA 1RE1A 3UXYA 3OQBA 4YI3A 5GJBA 2GYUA 3RYHB 3K70B 1EXNA 3HO6A 2HF2A 2R5FA 1QRSA 3QFTA 1ZQ1A 5AT1A 4Z54A 3QFCA 3ADKA 4K86A 1FNNA 5SYAA 1MB9A 1ZZGA 1JTEA 3GFQA 2DYKA 2LCFA 5LYJA 4WIAA 1E6WA 1WVIA 1NBMD 1V8ZA 3N0XA 4AECA 2QRHA 2MMCA 1RACA 1T4CA 1Z8HA 3CJQA 4Q1CA 2FP3A 1Z18A 3IAUA 3RIHA 3GGDA 3ZZ1A 3JZDA 1RE0A 1RT9A 3R8FA 4PZAA 1Z73A 1BE8A 1A8SA 3T9DA 4X5OA 8OHMA 2NP6A 2XNDD 3HKDB 3L3BA 2UUOA 3ILHA 1X14A 3NT2A 4M0EA 2P4HX 1CR0A 2ZRDA 1IIRA 1UJ4A 1XXHE 3GFOA 2H29A 2W6OA 3IPCA 1COWA 2Z30A 3EJWA 3EW9A 4DQXA 4YRAA 1M6VA 3K72B 1U90A 5DXJA 4F0JA 4Q7QA 5IZCC 2J3QA 2H1IA 2UV8A 1GSHA 4XQGA 2AJBA 1QYWA 1O94D 4PO1A 4WGFA 3GUUA 2UZ1A 3C3MA 3NBAA 2VHQA 2FJUA 3OO0A 2WBLC 4JYPA 4CLDA 1QQBA 2D1QA 1KBQA 1E79A 1NXPA 2WP8J 2GM3A 2QV0A 3O1HB 3O47A 3CW9A 2I6TA 5DHRA 5EFZA 4A82A 3OEYA 1P1CA 3VO9A 1G2OA 1IB6A 4QUKA 4YQZA 2LPMA 1MJNA 3PUVA 2ZUUA 4LYAA 4PAWA 4DZRA 4JI2B 1WHSB 5A5EA 3FWPA 1WUJS 1VG0B 1Y5LA 1FX0A 1LS1A 1Y3HA 4MI3A 3BEOA 4AICA 4CPDA 2O2GA 4DVGA 1AK9A 2ZRPA 3C3BA 3PXBA 3L49A 3L93A 1W5TA 2WHQA 5LBUA 1K27A 4UPDA 4ZGGA 2HLNA 1LQ2A 2VXYA 3ON5A 3V55A 4NWIA 3TRFA 4NCJA 4B87A 1M66A 2R97A 1KDZA 3MPUA 3V1UA 2Q0HA 3ZK8A 4B74A 3ZJUA 2PRYA 2H16A 3UIEA 5HXAA 1JV2B 4DM7A 3N2IA 2W2MA 3FNHA 4IKEA 2PBZA 1YASA 3C3DA 1MCZA 1R4MA 3JQ8A 1F7VA 4QREA 4JI3B 1MJ5A 2RKWA 3BCRA 4FYWA 5CIYA 3MJVA 1ZSYA 3D4BA 3HWWA 2DFLA 1KTIA 2QD4A 2W2XA 3T7JA 1QQAA 1P7WA 3GLHA 1Q16A 1X74A 2OO5C 2W2VA 3GJ3A 1NBOA 4R6XA 2QMYA 2ZSKA 5CTAA 5EG5A 4XUDA 3TJZA 1IZYA 4KREA 4A73A 1KFKB 3KV3O 4R3UC 4R9VA 1RHKA 1JEOA 4M49A 2MHCA 2XYRA 2OY0A 5ENDA 4BVHA 5IDQA 1SEPA 1DAPA 1Z4IA 4QVGA 3KU4A 3UMRA 1E1CB 1OFUX 2YHUA 3O8QB 5LR6A 2FMKA 2ST1A 2JI9A 3I2KA 2R87A 6GPBA 4ICIA 2W42A 1YRBA 4C07A 1NDQA 2H0AA 2C4KA 3BXFA 3JRWA 3NYIA 4EPWA 5FWYB 1RXWA 4ARZB 4Z2AA 1KI4A 3O91A 4RF2A 4QGHA 5IJ9A 4RTPA 1CUZA 2IDKA 2OFWA 4QBKA 3THXA 5CMLA 5ALIA 3GGPA 5ELLA 2ZRNA 3G9UA 1Q0ZA 3I5UA 2ZU6A 4O2LA 3Q8XB 3KQHA 1C7IA 2O3TA 5C7OO 3AVQA 1ZNWA 1OUMA 4Z49A 2JLZA 4PS1A 4DF3A 4GO1A 1Z0DA 4FQ8A 1GPWB 1I4LD 1W85B 1YJ8A 2L18A 2B5VA 4EEXA 5JNUA 3D4PA 1I36A 4HMPA 1BDMA 3KSUA 4O4HF 2HEGA 1LBHA 5DIZA 4EY4A 1XDSA 3H8JA 1JXQA 5FBKA 5TF0A 4EENA 1OGJA 2C5BA 4C89A 5REQA 3A6KA 4QU8A 1E3EA 1HL7A 4RFSA 2CDAA 2CFRA 1TU0A 1U98A 5KVAA 2ZG6A 1GGNA 3OU7A 1PD0A 2HWKA 3ZE8A 2FGKA 2J9FA 3BRSA 2IKQA 2V7QD 4QGAA 5KWIA 2NO1A 5DXAA 1BMFD 4M1MA 1Y33E 3F3SA 4QELA 1P2GA 4KR0A 5G4LA 4GLFA 1MJFA 1GV0A 1CVLA 1Q1GA 3EULA 3UJBA 2KBEA 3KQYA 1Q0PA 4FLFA 4CCWA 1JLHA 5FBVB 2HXYA 4R9SA 2FCRA 5EGNA 1V47A 1E2EA 1UDWA 1Z5VA 2HWXA 4HP8A 4TXMA 1KAHA 5H9VA 1HE2A 5C1IA 2RHHA 1SELA 1TDJA 2OO5A 1F2TA 3VTZA 1FUKA 5FPQA 4DUZB 1T6XA 2Q6TA 2HU5A 3IVCA 1Q44A 1PGNA 2ETXA 4IOJA 4JSRA 3RVKA 1JB9A 1NT4A 3NIGB 3D8UA 4AO6A 1CEQA 2DQKA 5IVHA 1SBTA 1GHTA 3PDUA 5GJWC 2XY4A 4FFDA 1U81A 3I9NA 3ND8A 2WD7A 2VIIA 2QDXA 1QK4A 4DMKA 4MDEA 3TTUA 1T0JB 1Y6JA 4YXWA 5NLLA 4J3NA 2DR2A 3BB1A 4B2YA 4G0VA 3ZDAA 5L3QA 2LNDA 2FFRA 5DCUA 3R6TA 5HK8A 5AJUA 1XRPA 3QI2A 1DCTA 2H2FA 1DXYA 5IAGA 3K94A 1T6BY 3E82A 3UJ3X 2ENUA 3QEMB 3SEAA 2QLTA 1G8YA 1PFYA 1WABA 2FRVA 2VDOB 2HHAA 1SU4A 1O9BA 1R16A 2FSIA 1MPTA 1V1RA 3AW9A 2UYOA 3MJCA 3R3HA 4QYTA 1SY7A 3L07A 3PXCX 5COQA 5ALZA 2C5FA 3DTVD 5AM4A 5FYDA 4I4TB 5ALHA 1K5DA 1ORRA 1YRLA 2P1ZA 3SF8A 3UV7A 1EXDA 4GMGA 3VDMA 1T8PA 1TC2A 4I9HA 4FB5A 3IT1A 3M6XA 4C4TA 4JQOA 2PYIA 3E9MA 3GT3A 2AFHA 3OMLA 2CZCA 5FBQB 2FNAA 2ESRA 2WTEA 2B92A 1E3WA 1XB2A 2CVZA 2VJBA 2XNJA 3PZBA 1BHJA 1H8EA 4BB5A 1ZM9A 2EFCB 4GMFA 3B3JA 4K81B 3URKA 1Y5RA 3R7BA 1VKHA 3WGZA 4CKCB 5HYVA 2NZ8A 1QCYA 1VMKA 4UNQA 2LCQA 4P0QB 1P7ZA 5CH3A 4DIBA 3TTWA 4V3CA 1DU4A 1ZY2A 4BP1A 1PTJA 1UEJA 2AMLA 2A94A 2HRDA 3L02A 4J0IA 2GA8A 3O4HA 1EJBA 2APJA 3TLAA 3ICCA 4AD8A 2DPMA 3CLTD 1KDOA 3H19A 4FQ5A 2FEPA 4MAAA 1T43A 3DQPA 2AR7A 5AUOB 3N2EA 1E5QA 1NUTA 3ASVA 1FP4A 4GC9A 4IV0A 1I2MA 2CK3A 3L06A 5IBPA 3GLKA 4B40A 1RADA 1LNQA 1OLSA 1RFGE 1Y89A 1O1YA 1U7UA 1YT5A 2EKQA 2NSJA 3AY7A 3JALA 1E4EB 2DG2A 5EZSA 4NESA 1I94B 3FDIA 4XQ9A 4B3GA 2ZRHA 5IN4A 2I4MA 5KTPA 1Z2AA 1ZH8A 3LF2A 4TV9B 5FKJA 2HSWA 3WWYA 1X38A 4EJ0A 5IH7A 2G6BA 2OCYC 3ETEA 3I83A 2HUNA 2VXCA 3IMEA 1JA9A 1HYEA 3GOQA 1D6NA 2FKAA 2ISCA 4CIAA 3EQ2A 2NUAA 1L2TA 1BXZA 1OZFA 1YQXA 2X23A 1XLTA 2XD9A 2F9FA 1GNVA 3OO1A 2MT9A 5JTTA 2G63A 1YS6A 1CR6A 4RYLA 4A8HA 4P4TA 5EP1A 2J7PD 3D6JA 1I5EA 3O1LA 4PWZA 3SOPA 4BB0A 3AF0A 3BN3A 3T1TA 3R5XA 2I4NA 2J0EA 1MT0A 4UFOA 4NSNA 1FW8A 1RXYA 4F2PA 4DSOA 2RAVA 2XMBA 2MSWA 4D25A 3KEOA 2DF8A 3MBIA 1UPUA 2W2TA 1GV1A 3B6JA 3KT6A 3PNYA 4C2UA 2PRKA 1Z6PA 5AM5A 1CNMA 2PZ8A 3ZDBA 1SXGA 4CUZA 1PR6A 1TO2E 3WBFA 2QZPA 2OCGA 4Y1GA 4FR5A 4C7MA 1CUJA 1LZLA 2I1VB 1VCIA 4UXJA 1XVLA 1EFAA 2VYNA 1NNEA 3NHLA 2HA7A 4C20A 1RYBA 3ANMA 2BMEA 3RVBA 2LVBA 1EJ0A 1DWOA 2BL4A 3K0AA 1I2CA 3OIGA 3U4AA 4JGIA 1SPXA 4H16A 4IS3A 4PIMA 3Q2IA 4LRYA 3TD9A 4NOKA 3HU1A 4R31A 4JC5A 1VHTA 2I1LA 2Q5QA 5ELMA 4UHFA 2UVQA 5B1HA 1KR5A 4PPGA 3DHNA 3P19A 4R2XA 1ZXBA 4WZAA 3B1VA 1I1HA 3MT0A 4HFJA 1SXJE 3RVMA 4AYWA 4BKUA 4KDFA 5DGDA 2W00A 2BKLA 4RPLA 2GYWA 2I2DA 3HBLA 4OBEA 1AT1A 4PNZA 3K5WA 4RAQA 3MUNA 3RBXA 4IIJA 5CDSA 2OAQ1 1X7XB 5HUJA 4R8KA 3JXEA 1EP2B 4L22A 3VAAA 4WK6A 4X24A 2QUIA 2G25A 4E12A 3CIOA 3UGJA 2IDZA 4J6EA 2VP9A 2ZBVA 3C5VA 1ULBA 3HDYA 1KY2A 4MCHA 4MUIA 1H9BA 4QYWA 4FZJA 1NVDA 3HXLA 2WFAA 5L3QB 2JAWA 2YW2A 3UK2A 5KMGB 1ZVMA 1RS0A 3BH0A 3PGJA 3BB3A 3CJRA 3LZCA 2WKQA 4G8DA 1N7IA 4N9WA 4X63A 1W5FA 1FVXA 1I1NA 5JLAA 3LYUA 3EVCA 4R7GA 3TEJA 3HJBA 5TT0A 1HFKA 1MU0A 2VYQA 3RSOA 2BISA 1Q12A 4DCCA 3I30X 2IE0A 4FNMA 2SCUA 2HRCA 4KOAA 2OBLA 2I1WA 4JEIA 2H54A 2PUHA 3MUOA 4LDNA 2BP7A 2C9YA 2C97A 2WVJA 1J2EA 2ERYA 2ZJ0A 3AHCA 3S7TA 1FFYA 3QJGA 1HKUA 5LKAA 1QGOA 1ST3A 1RQGA 4RGQA 3INNA 1ZJ6A 3ER9A 2AG1A 2OLEA 3IVAA 4G63A 4WFJA 4E07A 2AF3C 1L5WA 5BMOA 2Y2VA 2ZPAA 5EESA 5G0UA 4YRNA 1BMDA 1J6UA 1QYVA 5LIPA 2H3EA 4FYYA 4ES6A 1O94A 4CDGA 3B5EA 2B8TA 1OJLA 2F1JA 1U8XX 1DBRA 3M4JA 4OQPA 2Q3CA 3OLXA 4X9XA 1B8UA 1QHGA 1Z36A 1GYQA 3EXHC 3H2YA 3DKVA 2VNSA 3MJEA 4J29A 4DLKA 4DYHA 1ISHA 5AJYA 4DDVA 3NWPA 3CNQS 1Z35A 1YVRA 2GK4A 2WTMA 4HMOA 1RLUA 1UQRA 3LUJA 3ZKAA 1OHHA 2W5UA 4ARIA 4X71A 3BHJA 1NBME 1DG1G 5B3JA 2YVKA 3T5CA 4BIMA 1C1XB 2YWGA 2PA0A 1P9LA 2HA2A 2ZRMA 5GONB 4AY2A 3BD8A 2E7ZA 4C2BA 4L5IA 1UJNA 1E9CA 4B31A 2E4XA 3HXPA 3SYLA 2OWEA 1Z7GA 1HG1A 3OWHA 1CLUA 1EGAA 1OBHA 4MIKA 3A2KA 4K9SA 1H1DA 2XJ4A 3NC1C 1R8XA 2FUEA 3KETA 1FUYB 4X90A 3MLAA 3NONA 1SCQA 2WDZA 3F6PA 4Z7NB 3KM0A 3PD1A 4E1BA 4CMJA 1GQQA 5C7LO 4KI0A 4RVNA 3FZQA 1U0OC 2WJWA 4CV3A 5FPYA 1QGED 1JR3E 1E0KA 4L95C 1ENZA 1T1RA 1XMJA 1F7UA 3T5BA 3GEBA 2C2XA 3DT9A 4DZZA 3UWMA 1JKJA 2HGZA 2PLWA 4MDYA 5J40A 5GM2A 3EOBI 5IN5A 1NXXA 3VI4B 3THXB 1JKMA 1ID1A 4Q4HA 1EINA 5IHXA 3PQ8A 3KAJA 3LZDA 5IUKC 1JTVA 4YJDA 1U3CA 2LIPA 2YFYA 5FH9A 1FFXB 4B81A 4TXNA 5LU9A 4IINA 1VFPA 3PWTA 4KU4A 4LVNA 5EJ2A 1BU8A 1Z0KA 2C8JA 4J1SA 4S24A 1TIBA 2JIOA 3N86A 3D8BA 2XR1A 2XVZA 3KOXA 4IIEA 2PL3A 1RIFA 5B2FA 1GPDG 3K4QA 1IRXA 4LCBA 2D0OB 3D2BA 5DSZA 2WSBA 2E37A 5AKGA 1EE2A 1C3JA 3DDCA 3LKBA 3NHKA 4ZODA 1OKKA 5EFOA 2F2TA 4D46A 4QQ8A 3KFLA 5EIAA 2RCNA 5E4FA 5HFNA 2BM1A 1EXVA 1Y82A 3HYSA 2Z4TA 4WLEA 1DDIA 1PWYE 4A8JB 3I52A 1BZYA 3DOOA 3PIIA 3Q8KA 4J07A 3UVEA 1MDBA 3ZHVA 3G2QA 4RZXA 2O52A 2CVFA 1WZIA 3JQRA 3KUUA 2ZB8A 3I1FA 3F6CA 1H8HA 2E21A 2CLKB 3CX4A 1LV8A 2C94A 2QNBA 1FTWA 1XCMA 2NT4A 4J90A 1PWZA 2IHYA 1PTJC 3K5IA 3V8NA 4EO7A 3D59A 2B6NA 2FMXA 4V0KA 3AHDA 4J0GA 4UHCA 1P5JA 1F8UA 3CZMA 2GJKA 2QX7A 4XVQA 1TRKA 3IVMA 3THSA 1FC0A 2LDXA 3FHLA 3MYRA 3DTTA 1BO6A 4N18A 1N3YA 4MUGA 3GLGE 5HWSA 4ZVLA 1EIZA 1NW5A 1RWKA 3HJHA 1TF5A 1QAOA 4L5BA 4AO8A 2XAUA 1EVZA 3DT6A 4F2GA 3CX8A 1Y3DE 4ZVQA 2PLNA 3E5RA 1E2IA 4MV6A 2BWJA 4ONEA 1ZHFA 4XYLA 3C6KA 4OK3A 4RORA 3HCEA 4DA6A 2O7RA 5T4FA 3A4NA 3DBVO 1HKHA 4JLWA 2NO4A 1ACLA 3C8ZA 2ZUCA 3BDVA 2JJ1D 3PUZA 4KQ2A 5KTTA 4XX0B 1ZG3A 1GZDA 4RMIA 3OFKA 1T9GR 3MJDA 3HY3A 4ZVUA 4LK3A 3TXXA 1CR1A 1T9BA 3ZV7A 2A5GA 2JW5A 2Y4OA 3PNKA 4B75A 4BP8A 1AM4D 4S1TA 5IDWA 3D6HA 1E59A 1ZUIA 3X1KA 4KRFA 2G88A 3GZNB 4E13A 4AYXA 4CKBA 4X61A 2FWBA 5IXYA 4C4OA 1QB8A 2FUG1 4KPGA 3ND9A 4R40A 4Y2JA 2J0UA 5AK0A 1GGVA 3C3EA 1N9KA 2HJSA 2JAPA 2GVDC 1IPFA 3QVUA 1XUOA 4BMOB 1O57A 1T9DA 2AN5A 3WAGA 4A7PA 1QF7A 4D96A 3RUCA 3KQVA 3ID6C 3D6TB 2IBTA 1VIVA 1CY7A 1N5OX 2V3CC 5JWHA 4JP2A 4YMUA 2FK8A 1XL1A 2NUPA 3HI4A 3C3KA 2GJSA 1JEDA 3NZEA 4PFJA 2ROQA 4S1PA 5DYTA 4A8JA 4DREA 3G7SA 3THWB 4TUYA 1YU9A 1QHYA 2G4LA 3I3SR 4F71A 3RSLA 1FNDA 5HRUA 3I9MA 1YBHA 2FW7A 4ZAWA 3KDAA 4YUWA 1XBTA 3GN2A 5E2IA 4PN3A 4MCJA 1MO5A 1TCBA 4KQKA 4UFNA 4DCTA 2IU4A 4PYIA 1XMIA 1F2TB 5H4HA 2I67A 4K1XA 2QLFA 3QKSB 1Q7BA 5DULA 2FZ5A 4Y9DA 3RNLA 5KYYB 4KR3A 5SY9A 2QG6A 2HU8A 3QVGA 1D6MA 2NU6B 3GRKA 2D1YA 3UICA 5CR9A 1AMNA 1R10A 2HH9A 1I6MA 1IM8A 3FNBA 4GWLA 3QWIA 1TO6A 4ZO7A 1U8FO 4D3DA 4F72A 2OUKA 2IYLD 1H2XA 2JBAB 4L51A 3E0QA 2GZHA 2PWAA 5CM9C 2AXPA 1SIWA 4EY6A 5JS2A 3Q0TA 4JEMA 2AUNA 3GGCA 3KVOA 3PWKA 2C0QA 1QG2A 2GCNA 2K4MA 3AVYA 4JP5A 3TLGB 1KWGA 1J2UA 1KVQA 1MABA 4IXDA 1MVNA 4XD7D 1TLFA 5CG2A 3Q7TA 3ACBA 1YE8A 4ZREA 4DRZA 3DO8A 5BSEA 1YI0A 2J45A 4J7XA 1Y8AA 3MHTA 1GSOA 2GS9A 2R65A 3P9CA 4M46A 5AKJA 1Z6AA 5LD2C 4L6AA 4X3PA 1JQEA 2HIGA 1SCKA 1CY0A 4ZQFA 5ETJA 4D9EA 1SUCA 2EBWA 3A6DA 3GPCA 3DE4X 1TEVA 2ZUVA 5A4IS 4URXR 1P8JA 4Q16A 1MZVA 3NKLA 1NIPA 3EQ6A 1SNYA 2BZ1A 4DMUB 2HSDA 1II9A 2FXIA 2DFVA 4CI9A 3EG9B 4BGDA 3EVTA 5FT9A 2XWBF 4QKQA 5L95A 5K0EA 3NC4A 4YJFB 3F8TA 5HVNA 5JCJD 3K9FC 3U44B 2X77A 4HI0E 4KAXA 3ONFA 3RBVA 5M04A 3WRXC 2BGMA 3RS4A 2WHRA 4HB4A 1K68A 5ITSA 5KOHB 3R0XA 4GECA 2OQVA 3HWX1 1QIGA 4ACBA 3KT8A 1Z22A 5CVEA 3SS8A 3SNKA 1RLOA 2JGEA 3BD9A 3GPIA 3OKFA 1MEOA 2PO7A 3GGSA 1KC3A 4HN2A 3LCCA 4X8LA 3N2YA 4HV4A 1JQJC 4F9EA 4X54A 3OUUA 4AWAA 1KQNA 1KAEA 1L8QA 3K09C 2BCEA 2XKAA 1CRQA 2ECFA 2A0XA 4C43A 4DJTA 1DBSA 5K8VA 3EUFA 1KS2A 4H4EA 1EFTA 1YGPA 3LT2A 1P2FA 3G0DA 5A4MS 3CEMA 3K0EA 2BFBA 2JCBA 2W6NA 3H0EA 3L01A 4OO3A 1IXYA 4NMMA 1WQ1R 2DCUA 3KWLA 4O2AB 3D3NA 5F2KA 1ZCZA 1W75A 1DMSA 1Z15A 5AVKA 3CZ4A 1XRMA 5FPPA 3AM3A 3GFGA 4C88A 4NE9A 1HI9A 1N8NA 1OFIA 3B89A 5JADA 4E3ZA 3U4HA 3U3RA 3JWHA 3C4JA 3PRKE 3RTEA 1OA0A 4ED9A 3TG2A 3FAKA 3UWPA 2PA3A 3RFVA 3NV9A 1A9XB 2WE8A 5HDBB 3R9KA 4RCVA 3A9VA 3IR6A 3CZRA 4NBWA 3KALA 2WUGA 3OSZA 3SZ3A 2QMEA 3V97A 4UVDA 3N0TA 4TV8F 5T4BA 4EUSA 2UYQA 4KN8A 4FCCA 1FYXA 1S96A 1P7CA 1UPCA 4M9UA 1QG0A 3JS5A 1E9FA 4K8OA 1M10A 2GF9A 2IZOA 3H4TA 1E1QA 3P0IA 2MMGA 3H83A 4A1FA 1FXWF 4H6XA 4QU9A 1TECE 3EIUA 3LK7A 1G2QA 1EESA 4M4SA 2SECE 2VQ3A 4NR0A 4V0LA 3SP1A 1KO5A 4I9GA 3AF5A 1Y8CA 2C2HA 2PV7A 2CL7X 2OV8A 4ZCTA 2AFHE 3LUCA 4Q4DA 1QFYA 1QHXA 2HJGA 3SQDA 1PJZA 1VGRA 4DR7B 2ILVA 3RF7A 4F6CA 1IOLA 4I4NA 3G7NA 4RENA 5JRDS 4IV8A 2G82A 1MJGA 4IHJA 3I8XA 2MSLA 4C6HA 2V58A 3TBKA 3FCCA 4B45A 5JLJA 2A92A 5IVDA 2PXAA 2ADOA 4JP3A 2VP6A 1TMKA 5ARBA 3PX2A 1ZI8A 1I01A 4OFWA 5AOCA 2P67A 2X0KA 1CR4A 3HL0A 3LUHA 3AI2A 4HJRA 5ANRB 3U3OA 3WKBA 6ADHA 1GT6A 4JBYA 4FHDA 5GZ6A 7REQB 3KO8A 4XAQA 3C0KA 3U56A 2D5AA 3O4IA 2GZMA 2Y6UA 5GJCA 1AHIA 1AKEA 3H9BA 1WWKA 4LTDA 4OU4A 2JANA 3AHHA 3Q7PA 2W70A 1WA5A 2YICA 3OU2A 5F76A 3DAYA 1K92A 4EZIA 4HZUB 3PC8A 1CUGA 2D2EA 4HS4A 1QYXA 2JCYA 1J9EA 1GA4A 3D4OA 2AYXA 4R8SA 4MR8B 4OLJA 5DLYA 2FEKA 2EQBA 3VR6D 3SI7A 1O8CA 5ALLA 2RGNA 1PFWA 1FSGA 2WYOA 5AVQA 4FUQA 2WU0A 3WMWA 4MI6A 2V7EA 2H52A 3CLTC 5DHUA 1FBNA 5LNK1 3WWEA 4JAVC 3L7JA 5JBNA 3DZBA 4B4VA 4EHBA 3ZWQA 4DQLA 1OFHA 3KJGA 3F78A 1JDUA 1SIOA 1U0FA 3P0RA 4G37A 4LI3X 2QPOA 4OFBA 4REQB 4UUQA 2UUBB 2EZUA 4AQDA 4X85A 2HQBA 2L19A 1PU2A 4O4HA 5HBRA 1P75A 1AF4A 1GA6A 1CJSA 1XE3A 3D4LA 4JL6A 3PEWA 4HAUA 2QR3A 2SKEA 1TK9A 3FA2A 2HCRA 1PR4A 2DKOA 1G5QA 2VFAA 4W6QA 3H5OA 3LFHA 3TLXA 1LV7A 2FZKA 3CO5A 2G70A 5J4LA 1PG2A 2O05A 2Y1GA 4Q1AA 4QYIA 5TVKA 3D4IA 1SG0A 1QFJA 4E6EA 2GZSA 3NWBA 1C8LA 2ZI9A 2F7SA 4V2UA 3BCUA 4DARA 1RHUA 2G0AA 3E18A 1I5OA 5JFTA 4DV4B 3CV3A 3WMFA 1JSRA 3M89A 5LFAA 5M34A 1YFLA 2O19A 2IX3A 1WB5A 4OREX 1XZQA 1X19A 3IDAA 1NP3A 2O2IA 2YXBA 3KUDA 4TV9F 3WKEA 4D81A 4DLAA 4EEZA 1K86A 1R6AA 5E6SB 2EQ5A 1GCOA 2G17A 3ZZNA 4B76A 3TZKA 2M9MA 4XYMA 1QO0D 3HU3A 4IKOA 4AN1A 2VDRB 4CM9A 3HA3A 2GDZA 3NJRA 3U4IA 4LG1A 1OMOA 1C0KA 4NV3A 2HYDA 4N47A 3UJPA 5C53B 4CGZA 1N33B 4DFDA 1QGUA 4DKJA 1UZUA 4CIYA 3IE1A 4IHJB 1CYDA 1GDHA 4MVJA 4Q7KA 4WZAE 3H4MA 5FFNA 3CF6R 4LFCB 1V6SA 4F4JA 2F55A 2JFQA 1F38A 2II6A 1K7YA 3RE1A 1ZIOA 1C3OA 3GMDA 3VKUA 4OQXA 3BF8A 1ZNXA 1XD2A 1B6TA 2AE2A 4OIFA 4CU5A 1FL9A 4LNUA 2VF2A 3A9TA 5I7EA 2AX4A 2X6RA 2QA5A 3E22B 3MM4A 5I8PA 1U0EA 1WMAA 2RHCA 2HA0A 4LNAA 1KNQA 1F9AA 2DTXA 2AQHA 3D6NB 3RRJA 1PLKA 2ZBEA 4OUKX 1EWQA 2VCEA 2DT8A 2IUEA 1E94E 1ETHA 4FE4A 3R0JA 3DEJA 4H77A 4F5DA 1OWOA 5FHRA 1ECGA 2J30A 2MYUA 1XLUA 2VSXA 2ZBQA 1IHYA 4ZVVA 2VDUE 4F3YA 7MDHA 1M2VA 3CTPA 1UK6A 4JBLA 1YQEA 1X8KA 5E1MA 3W0LB 3QM1A 5JR3A 2R1ZA 2AEJA 4LDPA 4PBRA 4M8SA 3TZEA 3U9LA 4P38A 4QFCA 4ZICA 1KRXA 4KKVA 1MQAA 1S2NA 1PDWA 2ZIGA 2MSDB 3UHJA 4BMXA 5T8KA 3KR0A 1U0GA 4P7GA 3W2EA 3R2JA 2PLAA 2G77B 4P6VF 2BFMA 1WO8A 2KJQA 4ZDIA 3V4ZA 4X1IA 4KXVA 3STWA 4B7CA 1HEYA 3A7DA 4P84A 1ZBQA 4DPLA 1M1XB 3CX6A 1GLNA 3OIFA 5KAMA 1OAAA 5ITZA 2RD2A 1DX6A 1HX7A 2HFKA 2MJLA 3W4JA 1EJ6A 2BGRA 2VPIA 5E3JA 3X3HA 1QP4A 3HL4A 3Q7SA 3SYMA 3SDZA 1DINA 3KJIA 4CW7A 3W4KA 1YR7A 1JWAB 3A0UA 5F33A 1DUSA 1KJJA 3IX7A 3DKRA 1G3UA 1I6WA 3Q3IA 3I4LA 3TQCA 1ZOOA 4D8TA 3RT7A 3BWBA 3ZZUA 1WTCA 4WNIA 3DZDA 2E1RA 2XVYA 1V7ZA 3OZXA 4G41A 5FR2A 2Q8QA 3BQNB 5TS3A 3UPDA 1P1RA 5JSQA 2Q9BA 3E9RA 4F3TA 2P7HA 4CUKA 1K0FA 1JL3A 1HQYE 1U6KA 2BHRA 1QRRA 3Q98A 3UM9A 4C5CA 4DMHA 1KZ4A 1C4WA 2VF7A 1NN5A 1SOUA 2ACWA 4NYJQ 1CB7A 2BBWA 5L4NA 2CNDA 4IH1A 2I9KA 1T1EA 4N39A 3P5SA 4KG7A 3ODGA 2AVDA 2W2QA 3QW2A 1RRFA 1XD8A 5AVOA 5JAQA 4BFYA 2CXNA 16PKA 4L0CA 5C18A 1O5IA 4DC9A 2MSNA 3M1YA 2BHLA 4WA7A 1CZNA 1NJSA 2PXCA 1VOTA 5LLSA 2G40A 2O0MA 1EZ4A 1G5RA 2C9OA 4I36A 4PAGA 5UKDA 2JG3A 2BFNA 4PLYA 1OYYA 5DBFA 1XVUA 2GM5A 5KOJA 2A59A 5EOVA 4RLHA 4F2WA 2B36A 4YJ3B 1NJ6A 1UR5A 5A3RA 1TQ2A 3H8VA 1OILA 2UDPA 3KBBA 3UV6A 3L1JA 1HE3A 4JUAA 5F2NA 3OE4A 4Y2YA 5H68A 4XQEA 5FLEX 5J5CA 3TL2A 1YZTA 1Z0IA 4QPPA 2GEKA 5J4YA 1DC7A 2W11A 3SJBA 3PC7A 1IEXA 4U3JB 1Y9JA 2J7PA 2ZS7A 3LL7A 4QNNA 1QJ4A 2WD9A 4AP6A 4BLPA 4HYYA 3LW7A 4QOGA 1OIWA 4JI1B 4DA0A 4N8SA 4PTYA 1GNQA 3NHUA 4R9RA 1CV2A 1G8HA 2AW3A 3G0OA 3LWDA 2HDOA 4TKUB 4ASUD 1GPYA 3FWNA 2L69A 4OHFA 5GV7A 4RW0A 1UWCA 1RJDA 4PCVA 3SZLA 3GUVA 4IAOA 3C3PA 3DE2X 4BU0A 4N4AA 2AJCA 2O0LA 4EZBA 5TC4A 2WWFA 1NF8A 1RCUA 1MO4A 2GARA 2AC2A 2HRZA 2QRVA 2SNIE 3MMSA 3RFFA 1OI4A 4LOJA 1QHIA 4FP9A 4D3YA 2BKAA 4N6GA 3EFBA 3HWRA 4G25A 1AZSC 2GJAA 4YO7A 1D5CA 3CNBA 2ZOSA 4YEDA 4YN3A 2YWFA 3N59A 3H6KA 3MVEA 3M3DA 1OV6A 3NCTA 2B1JA 3AEKB 3O8QA 5E7QA 3I28A 3ZHQA 2W8ZA 1PTKA 3FOCA 3L8YA 5BSMA 3IEVA 4G1VA 5KYUB 1DTWA 3EB9A 2XODA 2OMKA 3KZNA 1T0BA 2RHDA 3G0BA 3W8NA 2RH4A 4NHEA 1FFXA 5CH8A 2OM2A 3I04A 4P33A 1GSIA 3HA5A 2I80A 2PO5A 2YYAA 1UH5A 3B3FA 4JI5B 1SVSA 3MXTA 1NC3A 1TX4B 3PLAE 1MHPA 1VE3A 3I2IA 4KXUA 2HCFA 4OGKA 5KB3A 3QV1A 4H7JA 1RHMA 3H0CA 1GP2A 1L7BA 1ZW1A 4PE5B 1WCIB 3L0IB 3NTOA 4RWZA 4XSHA 3ZD6A 3PRHA 3H5NA 1BC5A 3J81k 4H27A 3OLQA 2ACEA 3M49A 3PPVA 1JDZA 1ZJ4A 1NJ2A 1HTBA 3PQDA 1W0CA 3EMDA 3FE2A 2A0FA 2X14A 1ESZA 3L1IA 4QDZA 2NYVA 3Q88A 5JAPA 2B5OA 2YJZA 1KO1A 3IAS1 4O29A 5AJTA 2QENA 4QOFA 3NM5A 1MO2A 5DTRA 2XCSB 5HIJA 1GQ2A 1Z3IX 2FEWB 2VWPA 4IXMA 5IVPA 2I6UA 1IUKA 1EXWA 1E6EA 2OE2A 4ZKEA 4J4BA 1F51E 2CNLA 3L6OO 4NY1A 1IBKB 1CUAA 1E2FA 2IEIA 2YH2A 1CIPA 1OPRA 4QULA 3PFWO 4Q9LA 1F4VA 4V02A 5C3MA 5ADUS 5D8DA 1E0JA 1PI3A 2EATA 3TRKA 1QCZA 3H99A 3R77A 1B0PA 4M7PA 5A4AA 5HZMA 1HFWA 4I66A 4D99A 3A4MA 4DQKA 5A6SB 1YHYA 5FWXA 3P5BA 3RRYA 2FWMX 2PU7A 5KX5A 1JDTA 4DE5A 3LIIA 4YPVA 3RSHA 1SB8A 3ZW8A 4HDNB 1U02A 4LC0A 1Y6ZA 4J3JA 4Q3AA 2X6QA 5AI8A 4NU5A 5ICCA 3X2EA 1C50A 1UDCA 2A57A 1IBMB 3WYAA 2XW6A 3DPUA 3ROFA 4AM8A 1KK3A 1ZSNA 2XOXA 4QG7A 2FLKA 4I1OA 5CFZA 3A1TA 4L4YA 3RVSA 1B3BA 4XARA 1F6DA 2HM7A 3ZDRA 2B8JA 1QXSA 1DKRA 5H3CA 1O5OA 3LQQA 4LSWA 5D01A 4P83A 4G81A 2ZAGA 1EFHA 1O94C 4JWKA 5HOEA 4BX0A 2P7IA 3ASYA 2YIVX 3JD1A 3KHSA 3LLMA 4E5KA 4ER0A 2Y1EA 2QUAA 1E1NA 5HZHA 1XTVA 3EF0A 1XEWY 3EGVA 4O4LA 3UWSA 3WRYA 3DEYX 3DUFA 1KP3A 4MW7A 1ADFA 2YHAA 3UEOA 3Q87B 1YSCA 1IXSB 2UZ1B 3DE7X 3ELBA 3HLTA 1EUZA 4I9FA 2J67A 3ZU3A 2IOYA 4JGGA 1FJGB 1FS5A 1J0XO 1DG9A 1DG3A 2P9BA 2A5YB 2QXTA 4JNCA 1RRGA 5IK2D 3NAQA 2NNWB 4FEGA 2BTOA 2NU7A 4HOYA 2I99A 5DISB 3QYJA 3RTDA 3WHPA 4ZN6A 2ZAIA 3EH2A 1URPA 3F6EX 1R9MA 2NVOA 2XVAA 4KO2S 3HR7A 5CVVA 5ADHA 1EFPB 1QKJA 3UBMA 4QM7A 1MZPA 1M0WA 5GY7A 1WPQA 2YFKA 3QVKA 1I2ZA 1ZNQO 2R1VB 1I0LA 3EXEA 1ULHA 5EIOA 3PXDA 1A9YA 3ZCPA 3EWIA 1NW7A 1MVOA 3JYLA 4WNAA 3RROA 1UBOS 4CTOA 2XZLA 4F6RB 3T3MB 4QQNA 1S2DA 3RRZA 5K0TA 1IPHA 4AKSA 5JCJA 3IKTA 4FSDA 3V1NA 1OH7A 3TDMA 2ZCJA 4DGSA 3GXOA 3MJ4A 4RF3A 1QWSA 3CG0A 1DEAA 2R1TB 3EUEA 5AM0A 2R96A 3FUTA 3WGMA 1DWQA 1ORHA 3UXEA 2CLSA 4YRIA 2O0HA 4UOEA 5B1DA 2QTMA 3KE9A 3SC3A 3ASZA 5CFQA 4I5EA 5IAKA 3A6GA 4FZRA 1B8OA 1GDDA 1RXUA 2GBLC 3H3JA 4KE9A 1D1SA 2R8ZA 3ZZ0A 3M33A 1OI2A 1SUIA 2FKNA 2ZWVA 3C43A 1I33A 3WBJA 4RKFA 1H22A 2QTTA 3FGOA 4HDMA 3ZJVA 2AUMA 2DHEA 4Q24A 3JQGA 3FYUA 1KZ1A 4BQSA 1DQSA 2I3DA 3IEXA 4CEJA 1JPUA 1OASA 4PFQA 4OXIA 4KDCA 3QTLA 3OQVA 4E5DA 2IRWA 4YT5A 3EFOA 5IMBA 1E1RD 3X44A 2H2DA 4CZ2A 1DV2A 2FQYA 1DIRA 3OKCA 4QVKA 4FYXA 2QTVA 3QMMA 4U5QA 3I8OA 4A23A 4DV1B 1AQNA 3DOIA 2EERA 4KXNA 3ESYA 1ZD2P 1P6UA 2Z08A 2YZMA 3AB7A 3O83A 1AF7A 1OLXA 2P11A 4XWGA 1O9HA 4MGIR 3AILA 5B3KA 4K6KA 4Q4LA 4Q0MA 3D1VA 4DTCA 4JI8B 3A3YA 2ISQA 3IPYA 5KJ1A 2ZWPA 4AP5A 2EOAA 2V8OA 4LF6B 3ZW7A 3H86A 2H00A 5JPCA 2FUNB 3DTVA 5EMLA 2I7CA 5F3DA 5FL7D 5JRZA 1NBHA 3K9LA 2UUCB 3GBVA 5AJVB 4INZA 1NRJB 3U81A 5L45A 4Z53A 4Q1EA 2JGNA 4J75A 4ZZ1A 5F23A 1X1RA 2O14A 2XQIA 3MWFA 2IS6A 3WO1A 4J16C 1JEYB 4TQGA 2YY7A 4JA2A 3S1LA 4GIBA 5JCPA 2VL7A 3S2UA 5ALEA 2ZYRA 3FPHA 3ZWDA 2ON6A 1EM8B 4X95A 2IW1A 2ZSJA 2HSGA 4B33A 4YC7A 4YDQA 3R9XA 5AKXA 3HKBA 5AUNB 3WAJA 4DNOA 1FVOA 4LXTA 4XJSA 4MEJA 4D57A 4H1TA 2QX8A 1TO1E 1U6IA 1V5EA 3SYKA 4HNGA 4JOBA 2FLVA 2BF7A 5IP5A 1B15A 3SZMA 2A3NA 2BH9A 3K8QA 1RQPA 3TLGA 4JVMA 4REMA 4DNQA 5BOSB 3SSAA 4PBSA 2AMYA 3OM9A 2Q21A 1OFVA 3H8WA 1QP7A 3QNUA 4BZXA 5K05A 1R64A 1G7TA 1IUOA 3B6KA 5FWNA 1NV8A 1IRIA 1DARA 2Z8YA 1WNTA 1DEXA 4A6PA 3L4SO 1WOMA 3MFYA 4R3NA 5FOVA 3BKWA 3KFVA 2VHUA 1KR2A 4BNKA 1NVXQ 2IYEA 1UXHA 1ZRSA 2C4UA 3AEYA 1YCGA 3JASB 2CNOA 3KKPA 3EXHA 1NKVA 3IUJA 1P4GA 3DMFA 1T3GA 3KTDA 3O7MA 5IHPA 2WFMA 1K08A 2XE4A 4OP2A 4DCGA 1MEEA 2RGBA 1F1JA 4WWHA 3CWZA 1DAHA 2FZLA 2D5CA 3MTQA 2WB4A 4MYHA 1H8HD 2GMWA 2ZBGA 5EYPA 2VTDA 4AKHA 2A5LA 5ILGA 1I30A 2WILA 2DE0X 4M7WA 1PQUA 1AS2A 1E6KA 4BAGA 4K9QA 3VR5H 2XJ9A 3PGMA 1XV5A 5DK4A 5ERYA 2B9EA 4L08A 3WTCA 4B5KA 5IVKA 3DL7A 1KMQA 1N9GB 2XQVA 4GM1A 3GFVA 3LT4A 5BRJA 5T5QA 2H1WA 2V1XA 2UAGA 2XCOA 3HJUA 2J9GA 1J25A 3FYSA 5ESWA 1THMA 3QLUA 4FMDF 3PNBA 3ES9A 2ZITA 4MK4A 4ANFA 5A0VA 5BR8B 1WNFA 2XGOA 4LYGA 3VMFA 2C2KA 5L9AA 3QENA 1KORA 2LTAA 2O8BA 1NL3A 3LVQE 5BWBA 2C3UA 2PU5A 5DM4A 4OTZA 3IUMA 2ZI7A 1A04A 3GJRA 4QOIA 2D0IA 3F4KA 3IXLA 3DZKA 1BA3A 5EKDA 4D3ZA 1S2LA 1PJ3A 1E1MA 2JJQA 2V6GA 3IJEB 3D02A 1QH8A 3JYHA 4BHTA 5J47A 3H04A 5GOTA 1FDUA 1RLJA 3ZNOA 2XUPA 1PZXA 4CDRA 3BCHA 1PZFA 1VG1A 1DQYA 1MFZA 1M6HA 4QPDA 4JL5A 3HA2A 2F90A 1AHHA 1TQDA 2FEXA 4X00A 3FOZA 3IERA 3M8KA 2DQSA 2J7KA 4HLCA 1S4MA 2NTVA 3RVLA 1GPUA 3CPSA 2IEYA 3QVMA 3NBYC 4QYXA 3SCZA 3JYQA 4AXBA 5JUWA 2B1QA 3PPIA 4Q19A 5G1PA 2QEQA 4PZ9A 3PWZA 5G0WA 1JXMA 1GM5A 1XF1A 2X0DA 1E1CA 4YLGA 1AGRA 1RRMA 1YDEA 2J4CA 3AR6A 1VKOA 2KX7A 2W37A 4C0WA 4C0JA 1PGOA 2B7LA 3WRYC 2C9BA 2ZUBA 3BILA 4A03A 4ZIRB 2DECA 1YR6A 3SF8B 5PNTA 2J33A 1LSSA 4IRXA 4LZJA 2EVWX 3SZUA 4CMKA 2BGKA 4ECEA 2OGZA 4D4IA 3FLEA 1Z07A 4LY9A 4KUEA 2HO5A 1B73A 2PXXA 1A3CA 1G0OA 4Z3KA 4RA6A 821PA 3ZY6A 2X7JA 1TUGA 3UB3A 5TY0A 2Q3LA 1N1MA 4MWCA 3WGIA 2HOQA 4L4SA 3KJXA 2ODAA 3ZX5A 4CE6A 2DUMA 5DGTA 4V1CI 2ZYWX 1E4OA 2NWQA 3OU6A 2GZ3A 5DM1A 3WQSB 4BNUA 3KR9A 4I3FA 2CV2A 4PYNA 1XZMA 2ZTHA 1RM5A 5CU7A 2IV3A 3DXZA 4QBTA 4E5SA 2AC7A 1PBTA 2GA9A 1SM4A 1GR0A 1WXWA 2NPOA 2ODBA 2YV2A 3K1AA 1NUSA 3IKJA 2OCBA 1G41A 3E3OA 1SA0A 1EX6A 4CIBA 5HQTA 2PWYA 5I9BA 1P80A 2AXEA 2PL1A 1BIFA 3BFXA 2V0GA 3Q7RA 1NP7A 4D26A 5DHSA 3D8TA 4RNDB 1QU2A 3AJ9A 1MN6A 2AQ8A 1ZISA 2DJIA 1KDTA 2TMKA 1HE1C 2H31A 2YXDA 4WNAB 3SC4A 1C2TA 1WQ3A 3M0EA 1RAGA 3E9DA 1YNOA 3TAXA 3K0KA 2UVPB 3OPVA 4RK4A 3DDNA 2RC6A 3IOMA 4WD3A 8LDHA 1Q1QA 1NXSA 4CM1A 1C3EA 1E3IA 4TYPA 3AONB 4EYQA 2IZ5A 4XFKA 1B42A 2JFWA 2PD4A 2Q6LA 1VYHA 3JAKB 4WACA 1DHRA 4B6SA 1YVDA 1CULC 2AR0A 3BXZA 1SCDA 3FZNA 4AJ2A 3ZCVA 2IOQA 1ZOPA 3GCGA 3D6UA 4UM5A 3UQZA 1BYUA 1E8NA 3MJHA 4M37A 4IUBS 2W2LD 3F4LA 5F9MA 1G1AA 4GPZA 5CP8A 1QH0A 2MOKA 4XEUA 1N0HA 4E14A 5F7ZA 2GYVA 4MV1A 2QPAA 1DTSA 1L9XA 4RLFA 1KARA 2RJ3A 4GMKA 4JDUA 3IIEA 1XHLA 2E2WA 2FX3A 3M1IA 1FFWA 3NAGA 3GARA 5M29A 4QRHA 5FNVF 1U11A 1FNCA 1V6AA 2YWEA 4Q1DA 4E30A 2C7QA 2GI4A 1I0ZA 3PQ6A 4W1RA 3UMFA 4TZ6A 3JVUA 3KZCA 5EPUA 1HFJA 2AE1A 3EARA 2KLHA 3OZEA 3QUSA 3QBEA 4JJ8A 4DDKA 4F3RA 4LEIA 3DFUA 1ODTC 3RC3A 4EHFA 4ISCA 3TTSA 3G2LA 2FWIA 1N3IA 2BBOA 3PPYA 4MW5A 3V33A 5F5LA 3WMRA 2D3TA 3MT7A 3BGVA 3J80A 4HGZA 1E58A 2FFHA 1R88A 3VNBA 3D7MA 2P6NA 3F96A 3ZQJA 2Y76A 3FPAA 4EDFA 3X1XA 3EAQA 3NYWA 3S8MA 1UXGA 4QE3A 5KKCA 1DQNA 3EPPA 1XP5A 1RD4A 5BSGA 3I6QA 2OD2A 5EQFA 1HMPA 3DMNA 3QFHA 3V4PB 5E9QA 3ZEIA 1I7DA 1FYVA 1JVBA 1UT5A 2O3UA 3KOYA 4DA7A 5K4AA 1ULAA 2FW1A 3NIWA 4E5VA 1RMTA 3EQ9A 1D9ZA 1AB5A 1Z0UA 4WN3A 3ZHXA 2HHJA 4RTKA 1YI8A 4B82A 3IURA 1RYEA 2V6BA 4CG1A 5IU6A 4BNZA 3CRNA 3EX7C 4QBIA 1NBIA 2IQ5A 3U16A 4IXNA 1C8KA 1JRLA 3TAHA 2FQ1A 3Q3JB 4F4UA 5M5BA 2WPNA 4E6PA 4P31A 1THGA 3V8PA 4U2DA 3MCWA 4H31A 1B8NA 4AF8A 5KBYA 5DTIA 1C1DA 3QIAA 1CP3A 3DVSX 3DP9A 5A7GA 2M6LA 4KVGA 4NF2A 3UZUA 1LPSA 4LYJA 4WK4B 4PFKA 2H9AA 3FUWA 5EMNA 2D0DA 4CQMD 3M6AA 4B6EA 2UU9B 5D00A 3WWPA 3WP1B 3BB4A 4RD3A 3GQBB 1NBAA 1WMFA 4PHCA 4DWJA 4URFA 1Y7HA 4ZJZA 4Q02A 2Q41A 1P19A 1GUDA 4LHXA 3DXYA 1GCGA 5BQOA 5F7XA 2BSQA 3KPWA 2XTNA 3TKLA 3O2NA 3RUDA 4BEWA 2F1RA 3R6WA 4BMSA 4R1QA 4BY9E 4ZCLA 1VBNA 1LDBA 2PNFA 1QUFA 2LWIA 3K0CA 3CMCO 3L0OA 4JQYA 5A62A 1FLAA 3G59A 1VSBA 4FCWA 4YGXB 1LX7A 3GEMA 5FDFA 2J6CA 2CXUA 2JKVA 1NP6A 3B2QA 1H66A 4IX1A 1N1GA 2VXOA 2LKDA 4O4IA 4YMSA 1NOJA 2PGDA 5J63A 4F6LA 1RWXA 3P4XA 5J43A 2PMFA 5D5QA 3W5UA 3NNNA 4KLZA 2F4NA 4XCXA 4BUJA 2C7BA 3PC2A 2GJ8A 4R2KA 1V3UA 1Z2OX 4Q4CA 2JVKA 4IG9A 4BLSA 1JHXA 5KSZA 1AS0A 4B1FA 5DNEA 2HZ7A 1YZ3A 4LZNA 2R48A 3AG6A 4BWFB 5ALYA 5D51S 3E03A 3ZQ4A 3HP1A 4FWIB 1P1HA 5ILOA 1VKZA 1NULA 1Z5NA 3AGQA 4FZVA 1DOHA 4NULA 1E20A 4EJ6A 2PUBA 2R11A 3KG2A 2DH5A 1Y4DE 1UBUS 2FRDC 2AN3A 2QB5A 3F1LA 4QTZA 5HKLA 4BMZA 3DBOB 1H85A 1QAMA 3PUIA 4UVHA 3O1JC 1P0PA 4LTNA 3LAWA 1TMYA 2QOEA 4KHPB 3QX3A 1WJGA 4TZ0A 3B51X 3AIKA 3C6MA 4DCVA 4I1RA 3N3AC 3LU1A 4QOSA 4CLRB 2O20A 4PC2A 1GLVA 1JQAA 1PNQA 2BMAA 4EYGA 1U3GA 2OYSA 2QIPA 3HCDA 2QPTA 3HDGA 3LK6A 5AH0A 1JIUA 3W2TA 3IT3A 1AY0A 3T7DA 4MB2A 3OG9A 3GLGA 1AK1A 1N1DA 1I14A 3A10A 4PG6A 1BQ4A 4JUFA 2XMRA 2IBMA 1WXFA 4WY5A 4OSOA 1OX4B 2RDMA 4E2YA 2GBPA 3NTVA 2WT8A 3ISVA 1F17A 1U3VA 1D4ZA 3PQ5A 5HBGA 3TH5A 5A5DA 2FA9A 2FE1A 2HNBA 2I3AA 2KS6A 2OG1A 2WHYA 2YJNA 4KYTA 3SIXA 3GZNA 1XWIA 1S7GA 1DAKA 3KLPX 1ZD3A 3E9YA 3OIDA 3X2FA 5EJ8A 2GEJA 1KOFA 2WMDA 4X8MA 1N2EA 4YMGA 2JCXA 4OHUA 1G64A 2HLDA 1Q21A 2V55B 1T0PA 3L0YA 1AHNA 5CHYA 4DG5A 4NS1A 4UTZA 5I7AA 2WT9A 3W8FA 3B1FA 3IAXA 4PV7A 4D4JA 4KH1A 5BYKA 1QK5A 2QN2A 3KLBA 3GEEA 2W6JA 1CUDA 5TPWA 2QMUA 4KGXA 3ESBA 2J3JA 4NXNB 3TE6A 3AM4A 3N6XA 4FB4A 5C1OA 1MV8A 5HE9A 1D4FA 2M32A 2IHTA 4O5AA 5AWFC 4INOA 3C8MA 3HSYA 3IKVA 3KUXA 1ZESA 2FEAA 2JGFA 3PEFA 4HRAA 2FPIB 4RZUA 5ALPA 2PUAA 1TAHA 4FILA 3QFSA 2PKWA 1CK4A 5ADVA 1L4FA 2ARKA 2JARA 2Z4RA 1TL7C 3KYCB 4XVRA 4EQ6A 3GLFB 2QRNA 4KVFA 2C54A 3DVRX 1BN6A 1CP2A 4BATA 4BYGA 1XKQA 4KAAA 4L5YA 1FRQA 4OI4A 2YDYA 4CM9D 4WVLA 5DBHX 1SA0B 2Z5GA 3IVGA 3TW8A 1GTSA 2REOA 2HA5A 4RTSA 4CMGA 2ZRKA 1XU9A 1N7HA 4RQUA 1W94A 2C4MA 1NW9B 1CNFA 3NRCA 4FYKA 3ERCA 5IAJA 2V98A 4N3BA 1H5QA 3ICOA 3VR6H 3E3MA 1FP7A 5JCZA 2O54A 1DBWA 4O59O 1T2VA 1HZZC 3HB1A 3QOFA 4NBTA 3Q15C 1I10A 4ZMSA 3KB2A 3IR5A 3OC6A 2IF2A 3T15A 3LY7A 1OH5A 3KJEA 1CJMA 3DO5A 3F9RA 3IVXA 1CQXA 4GZ5A 2VZ0A 4HTFB 4E15A 2QX6A 5T3YA 4AJJA 1JE0A 1K97A 4IH9A 5CLQA 2J3KA 1REQA 2OCXA 3W78A 4TMZA 3VTFA 3QITA 2IWRA 3ISTA 3ICEA 1PQYA 5I9MA 2PEYA 5DLQC 4G9BA 4ENPA 3CN7A 1G5HA 1QDLB 4REQA 3SKVA 4JB0A 4NHOA 4HQNA 1KIAA 1KDYA 3KSDO 1ADGA 1ZR4A 4RKRA 1KKUA 2Q2NA 2CLCX 4RXMA 4RTMA 4LXYA 4BVLA 4M1TA 4HNRA 5JJCA 2ZUSA 5J2TB 3VDXA 3MOGA 2D7CA 4OIMA 5GIOE 4U7PB 2FZEA 3T6KA 1Q1NA 1KFEB 1M54A 2WSSA 2BDTA 2O8FA 4UM7A 4DADA 2H4FA 2NACA 4RQTA 3AU9A 4L5JA 4CM8B 1Q14A 3DG9A 4PLFA 4RFSB 1NUUA 1E4VA 4JEHA 1Y7LA 1V37A 3RJZA 2Y4NA 1WB4A 3ETGA 3JQ9C 1XZGA 3ACDA 4BV9A 5KNDD 3LBYA 1DEHA 3PPXA 4AUNA 5D1NA 4PGMA 3NRBA 2GZ1A 3LZ6A 5TGDA 5SZJA 2WIAA 2R8YA 2DSTA 4L0DA 5DEIA 5TEWA 2QXYA 5B1IA 3G2IA 3NTQA 5AHXA 4CKWA 4AMUA 5EUCA 4D9CA 1E1DA 3FHJA 2O2XA 4L8WB 3NHJA 3U3MA 3SSMA 3W3ZB 4RVHA 2H65A 2IPMA 3NHZA 4C0AC 3TF5A 4BQIA 1YKSA 3VR4H 4NENA 3L4JA 1FIUA 2XIJA 1G5IA 1W4BA 4DWWA 5C8XA 1U5BA 2VRCA 1OD6A 5FTJA 1GNRA 4RVCA 1PAUA 1PKEA 3RLIA 3BBPA 1NVVR 5E0OA 1H0SA 2Q4TA 1GQRA 4KNYA 5ALOA 8ABPA 1LC0A 4Z9AA 1FTQA 1L4GA 4KXFB 1LPAB 1VCHA 3BWVA 3UK0A 4AIRA 1G6OA 4KJXA 1AKQA 1BJTA 2PLFA 3ONWA 5TQVA 4CIXA 4OMUA 3W5DA 4AZSA 2ZRFA 5F4ZA 2XKBA 5JHGB 1YRAA 3CISA 1Q7CA 1TD9A 4MUAA 1XPUA 1KAMA 4UAJA 1RBMA 3COYA 2H5LA 3TFQA 2XNDA 4YPOA 2XQFA 1KXZA 3ICPA 1BGXT 2BUAA 3H42B 5H16A 4EF5A 2AOVA 3E1KA 3OH8A 3O3OB 4G8BA 1DIAA 1UC4B 4ODIA 2HWWA 1VG8A 2JJYA 1BXGB 3I9V6 4RY9A 5JARA 1J8MF 1H3EA 3T3EA 2QN1A 4JLUA 1BYIA 3CCCA 3YASA 5EE3A 2AB0A 1NBMA 2BN4A 2WM3A 4YCJA 4LJRA 2BD0A 2VUTA 4LV6A 5JANA 1PJBA 4Y6LA 1JMYA 4HX5A 4MIEA 1QZ3A 4S3MA 4GD3Q 5G1OA 5CPBA 3F3MA 5HKOA 1WB6A 2QRPA 1PWHA 3BGIA 2HTFA 1YB4A 3RFTA 3U9SA 4MRMB 4KTTE 4JIMA 1F2UA 2QP4A 4U2FA 5BW4A 3ZDDA 3UGKA 4BNMA 1B4DA 1UZMA 2CVPA 3G79A 3V6MA 4NZ9A 1D1PA 5JH7F 2ZK7A 1C9KA 1P9RA 2CKMA 3PHJA 2R6GA 3TDNA 4C6TA 3WKAA 3P9QA 1JBQA 3EPLA 4N40A 3R9XB 4X1IB 3ZNQA 4BN5A 3THYB 4KR2A 2CMGA 2V5UA 3AL2A 4PSCA 3DDHA 2JHFA 3H13A 2OZKA 3PTZA 4LV5B 4TMFA 5BSWA 4LF8B 3ZNPA 1R8QA 1M8FA 2OXCA 3ZLTA 2JLYA 1VYUA 3OE1A 3WGVA 3KQNA 4QX6A 2YDXA 4LUCA 2Q2QA 4JI6B 1CZHA 4RQBA 5AHRA 2Y71A 3LY5A 3EGXA 1PJAA 3L7OA 2FI1A 5B6JA 2XXJA 3O82A 2P79A 4ZJPA 4LY0A 1GARA 3DMYA 1S4QA 3BQMB 1MMFB 2PTGA 2Q4OA 3K8OE 4MWTA 4UMFA 1EUDA 1SD5A 2R7NA 1THZA 5A71A 4JXJA 3IQZA 1E7RA 3HVUA 3W5SA 1UOPA 2JD0A 4AJIA 1PX2A 1REQB 3GAAA 1JI0A 4HMQA 1Z5WA 4A1OA 3P9SA 4B4DA 1VMAA 3KKZA 3QUCA 4F3NA 3HJRA 4FTWA 3O5AA 4OYYA 1MENA 1NF3A 3HDTA 3WWZA 1Y0BA 4F5ZA 2QP9X 2OUIA 4FMCF 4IDDA 4UJ5A 4HK4A 4B71A 1LVUA 1PE0A 1FP6A 4TLAA 1CS4C 1XQYA 2DKNA 4U9HS 1TF2A 2EX0A 2Q7OE 4CEHA 4LXUA 5LJIA 3GR6A 2VTKA 3U7HB 4I7EA 5EUMA 1CHDA 3T8YA 4B4OA 5DW3A 5AD1A 4OGLA 1NR5A 1PQPA 4QYMA 5TGTA 2C77A 1BWRA 2VBGA 4MUBA 3ZBQA 5BQ3A 1E3JA 2NGRA 1E7WA 4ZEVA 2NV0A 3T5GA 4FMDB 1NN3A 2A4KA 4MYSA 4LGVA 3S7ZA 1UAYA 4IS2A 3LBNA 3QLVA 1BFKA 5JG7A 3PGA1 3M5WA 3TCNA 4L8GA 2YZ7A 2WI8A 2NIPA 5BMVB 1ODLA 3D7RA 3F2VA 4HQRA 2CDBA 4DIUA 1NE2A 3FCYA 2JKZA 1MAVA 4JX8A 4PRLA 4OBWA 4C08A 3ANSA 5LOVB 4W5RA 1M2KA 2FTKE 4Q37A 4LRSB 3RVOA 2CB9A 3CNEA 2K6GA 1EVYA 3IP7A 4TX1A 1V45E 1J22A 3NS7A 2ZRIA 3NCHA 4MA4A 1NXTA 4UD6A 1QH8B 1R9JA 2H06A 3KOUA 3W9BA 3JVDA 2FMHA 2TECE 1CDOA 4FFPA 3REGA 4B6JA 1J97A 4Q9KA 2QT1A 5C5EA 4OLHA 1P29A 3W6ZA 1ML3A 3N53A 1OF1A 4HKTA 3PSHA 3UAGA 2QT9A 3ZTYA 1O54A 3ESDA 5IT0A 2P6RA 1L5NA 1PJRA 3WIVA 1V16B 3K6RA 4II7A 4ZMRA 5I4KA 2H1LA 1KSJA 3L40A 4PN7A 4QFDA 1H93A 3NHMA 1E9DA 3DONA 2H92A 4ETWA 1Z0AA 1K8QA 1JZSA 2VCHA 3H84A 1ODJA 1JEAA 2HQSA 3NDIA 3NXSA 3QEMA 1ZONA 4RKYA 1ONSA 1LDYA 1RWVA 2ZE8A 4NAUA 4F1KA 4RE6A 3Q0EA 1NV9A 4CIVA 1CUVA 1H6BA 1Y4AE 3C85A 3FPCA 4NYJR 2V5AA 3AR5A 3EGCA 3ITNA 1ISRA 2ODTX 4LF9B 1T8TA 1U3UA 1GLGA 1PL6A 3Q11A 3LXRA 3HUFA 4L8FA 5AJZA 5K20A 1HORA 1JHAA 1UOQA 1LX6A 3OP4A 4XIGS 2B4YA 3SM9A 1ULZA 3K30A 1ODIA 4HGYA 3R8XA 2PLRA 5CNMA 3FOFC 6Q21A 1K8RA 3OQHA 4MAFA 4JB3A 3MT9A 4F85A 1MX5A 1VI5A 3DEFA 4JYCA 621PA 3IPRA 4EYEA 3FCAA 4HPWA 4ENSA 1XJ5A 3RPEA 5GAJA 1AB6A 2EHDA 3A6PC 2NSLA 4P5PA 2IH2A 1KL7A 1C9JA 5B7QA 1N57A 1TZJA 2HWYA 1I6LA 4OU5A 4WCFB 3E8SA 2AA3A 2Y0CA 3AR2A 3M81A 5AKZA 3SC6A 2QM8A 4IILA 2X0NA 3DVAA 4A0SA 4M1QA 2R5WA 1NVWQ 1MP0A 1WKVA 2PVPA 3TTTA 5KJFA 5BXQC 3NH6A 1I32A 2TRSB 5BW5A 1TGYA 3I2JA 3W6UA 1Z5PA 1UWKA 1YCFA 3C8HA 1OC4A 3KT0A 4K46A 4AX4A 3HYLA 3JWPA 4GLBA 2VPQA 4G9GA 4XB6B 1HM5A 4KE8A 4GQBA 1FDOA 1GXSA 2ZETA 4KPUA 1QC5A 3L5KA 2YINC 2Q62A 5LOVF 1W48A 2G4VA 2RI6A 2C83A 3L18A 2QBYB 3KNZA 3IQFA 5CBPB 1UBMS 3LHKA 3MCUA 4MJLA 3X43A 3LYLA 4BEBA 1WL8A 4F8JA 4BL5A 3RYCA 3O8NA 1P39A 5F21A 1XEXB 1JILA 3GLHE 3PTLA 3QGMA 4BO9A 5CB6A 5HQ3B 2XT6A 4IGFA 2YV1A 1EHIA 1H6CA 1HDZA 1SO8A 1UP7A 2VN8A 2GAAA 3GBPA 2OQ2A 1CDZA 3DOHA 1YB2A 4XIJA 1E5TA 3LX6A 5D7NA 4LRXA 3ZE2B 1U2DC 3DMHA 4CGYA 4DPKA 3AIIA 4ZO4A 3MK31 3KYBA 3PI6A 1KK2A 4FE7A 1CJCA 5K3FB 3TZQA 4B6QA 3BRWD 4WDQA 2QKYA 3WR5A 2BKVA 3MCAA 4CFZA 4GLLA 3W04A 2G3YA 2V03A 3R3JA 1AURA 3PQ3A 3RODA 1NI3A 1M5UA 1TZ2A 1O6ZA 1I7SB 2JC3A 2K2WA 1A0OA 2ZKIA 2QP3A 2ZDQA 2ZIVB 3CUEF 1YFKA 3HFSA 3KFXA 4P32A 1XELA 4QWMA 3CSUA 2WKPA 4C7VA 3EXEB 3OPYI 4DAEA 5CYGA 3THYA 1VI6A 2YJ3A 5L4LA 1WPGA 1FEZA 4MVJG 1NWHA 1R6DA 2XI4A 1N2XA 3F4BA 1P3DA 1BNCA 1Z25A 3LYHA 4EPRA 2VQDA 1MH1A 3TZ6A 3VHLB 1KO8A 2ZZNA 2AYYA 1XFAA 3SC2A 3AL3A 4Z3OA 4K6OA 4MRMA 1DAMA 3C74A 3D1JA 3KCNA 5EQJB 1G0NA 1GG5A 3ESAA 3Q7IA 4RACA 1SD2A 3GFTA 1N5MA 3I6BA 4Y2HA 1WP4A 1XMOB 3S4YA 2AQKA 4DUPA 3RF6A 1PD1A 1TEZA 1QZXA 4Q3CA 3GH3A 3VDQA 2IUTA 2HKIA 4YBRA 2F43B 5ADWA 2DFPA 2D8AA 3HMQA 1W47A 4HDQB 4IIBA 1PL7A 3PP8A 4YQEA 2ONKA 4DR4B 1KVSA 2REXB 3C7DB 2XOKA 5IMSA 5CVDA 2KBFA 1NKSA 4HNTA 2GHTA 4G8JA 2CNKA 1CR2A 2I7DA 1PSDA 2PT5A 3CR8A 3Q40A 4OK6A 3DV2A 4UHEA 4D2IA 3BT7A 3ZDZB 2V7VA 3GZJA 4LGCA 5CNIA 2AKEA 1JIXA 3RV3A 1HZJA 1KS9A 2PMCA 2C5LA 4J0EA 1DRUA 3EPKA 5F52A 1H3NA 1JSCA 2VLBA 3U4QB 1ZJJA 2QD3A 1AKMA 3PFIA 1FW6A 1UDRA 3L9XA 2FW9A 3RH0A 3TTVA 1KHTA 2VPWA 3CLSD 3I9LA 3K8ZA 4WBNF 3E48A 4UATA 3AHFA 1Y3IA 4S1WA 1MAAA 5D3ZA 4QGFA 4EHLA 4FHFA 3ZJTA 2H9IA 2B2CA 3KVVA 2DHRA 2PRZA 2PHZA 1UJCA 4ZCIA 4NBLA 4YNBA 5KYVA 3UUGA 2LBPA 3B3GA 2F3QA 2GN2A 4JBXA 1HH4A 3GJ7A 1TUBA 3O93A 3OFNA 3PUYA 3HDHA 5HF5A 4WNCA 2J31A 4X1KB 3AKDA 4KVZA 1KJNA 4HPJB 3KPJA 5FNVB 2XB2A 3H87A 1WV1A 2X13A 1X13A 4FYIA 1KYYA 5EWMB 5C7YA 1SN7A 1H2AS 2Q49A 2BKXA 3H2BA 3NKFA 1L3BA 5JY6A 3OCWA 4J1QA 2C7VA 4LZWA 5K8LA 3C5WP 1F0YA 2O0JA 3OQIB 3PKIA 4UD2A 4WCFA 5EIFA 1A5SB 2GM9A 5EXTA 2KLBA 1WMDA 2ZAYA 4FDTA 4MTCA 3ABOB 1CFJA 3HXKA 4HB3A 1E9BA 1JE1A 2PYDA 2XT0A 3A1VA 5KUTA 1RRKA 3OPXA 2JHGA 4N7JA 4WXEA 3V1MA 1W2HA 1OTYA 4A16A 4UE6A 2ZATA 3AHIA 3BORA 2NV2B 1DKNA 2ZVDA 3LCJA 1E1QD 1RAIA 3UJDA 1IBLB 2AI2A 4PSUA 4OK5A 4WKOA 1SUBA 1YC5A 2RG7A 3BXEA 3QH4A 3LRPA 2JZCA 3AHGA 1BW9A 1H4QA 1S9HA 3QKTA 4AMYA 1QC5B 2O23A 3LHDA 5BT8A 1PW5A 1SUAA 4L8LA 1SXHA 1YOBA 2PSEA 2BM0A 3CR7A 2IEZA 2PL9A 4DLYA 1TA9A 5DW0A 1DKUA 1FDTA 1HQKA 4IJQA 3ANYB 4JA0A 5CX1B 3Q1LA 4IP0A 5KYYA 2BMWA 3G13A 4AZ3A 3D2CA 5KSOA 2VSQA 5GGXA 5KX5B 1L3CA 2WSSD 4UUMA 4IIJB 4N7BA 5FI3A 1HNZB 2XUOA 3T9FA 1C29B 1W0JD 1QS0B 2DGDA 4G1FA 5DI9A 5E7MA 5EMKA 4IDCA 2C04A 2QLLA 4K6MA 4Z6KA 1HSZA 2P3LA 3TUIC 5IUNC 2FQQA 1KK1A 1XLVA 3OQMA 4CQLA 2O8DB 1QF9A 3U19A 1WMBA 3QXGA 3K1TA 3R5JA 4U6QA 3USCS 2GCGA 4MB0A 3C15C 1I3OA 4LQDA 1VM6A 1M2VB 3H3FA 3E8XA 3I6YA 4YJKA 1GNSA 1CZRA 3CSSA 3SIPA 3IV7A 2Q5HA 4CT4B 2ZJ5A 3OIWA 3GVPA 3BA6A 2F17A 4AF7A 4EK9A 4LDJA 4M1EA 2WWWA 1WP9A 2P4QA 5AOVA 2BDUA 3DAGA 3NBKA 2EF0A 3CUTA 3W7AA 2OHVA 2JAQA 4UZSA 3DJFA 3E35A 1SUSA 1SUEA 1HGXA 3IV6A 4IW3B 4LY6A 1TIPA 3D4NA 1L7AA 2I2CA 1L4HA 3QVSA 3TS1A 2VJDA 3PLRA 1D2GA 3N5CA 3WIUA 1ZD8A 2AF4C 2WZBA 3D54D 4GGPA 4I19A 4TQAA 2HPAA 1UKBA 4YWJA 3T9CA 1KYVA 3W06A 2GX6A 4WXPA 2GO7A 1ZITA 1JBEA 4YAGA 4IDBA 7ADHA 3LCVB 1EE9A 3RLFA 4TYNA 1XMQB 1K6XA 4POOA 1A2QA 4KYVA 1EWKA 1T4GA 2ZI6A 1IHUA 3VGPA 2IUFA 3FMFA 4EW6A 5HRCA 3O94A 2FV8A 3LUFA 2CJWA 3U1BA 3WX0A 4YB8A 3TYXA 1VB3A 1XDUA 1Z4NA 1VDMA 4M6WB 4GI5A 4CG0A 2ORVA 1NLZA 4OJNA 5EQTA 4LXIA 2IXGA 4Y9SA 4JJZA 5CITA 1JN0A 4X65B 4YP6A 5F9FA 1G1MA 1ZCBA 3MQ4A 4UNPA 3GAMA 5LLDA 4EFKA 1L5RA 4IHKA 4W6ZA 2WM2A 1GGEA 5DBEX 2QRVB 1ANKA 1LF5A 1XX6A 5EJ5A 3PK0A 1BWQA 2GHIA 5EJFA 1OU0A 2IYAA 1IG0A 1TFUA 4W9NA 3DQZA 4LSGA 1Q7GA 1EQAA 1AE1A 3IBGA 3KKNA 2GN8A 1JEQB 1Y81A 2F6RA 2VO1A 2JJMA 2PDAA 4ZV7A 4B80A 3RB8A 3MWDB 3N8NA 2EKPA 2O7VA 4LN1A 3SKXA 1UZLA 2PMKA 2VF5X 3H4VA 3NTRA 5KC9A 3W90A 3VR2A 3TBHA 1XLWA 3FNIA 5G53C 4MQFA 2Y99A 4ZJYA 2B0JA 1JG1A 2QSZA 4WZBE 4C3ZA 2E87A 1P5FA 4Q4JB 4ETNA 5A5GA 1N0VC 3H2HA 2HGSA 3OLWA 1IY9A 2D5BA 4KXQA 4BGIA 1G66A 2ZZKA 4GP6A 1V4BA 3A3OA 4M3NA 2MIIA 3C70A 5FI1B 3V8RA 1VLVA 4F5YA 5B7NA 2AD5A 2X9VA 3PDHA 4GBMA 4B3JA 3BJIC 3CGWA 1NUQA 4WXYB 3FCSB 2IYUA 4Y9TA 3B1KA 5CDYA 4GXNA 2PX6A 5HTKA 1GU0A 1NPTO 3QXXA 2C2YA 1O6GA 4BNJA 3LWBA 4C30A 3CUKA 3BK2A 4TSRA 2F1HA 2OV2A 1QTRA 1KJWA 3H17A 3RUIA 4BQRA 3G5MA 4XWAA 1H05A 2QN9A 3EGEA 4DB2A 4WSOA 2ENWA 3O8OB 5IYZB 1E2HA 3TXAA 1DIGA 4DL9A 3PC6A 1VL8A 3RM3A 3JAWB 1YJAA 2P6OA 4AJHA 1CVIA 4PONA 2GRUA 3BL8A 1L4MA 2YTZA 4R2HA 1QPBA 4AU1A 3CX3A 2CLHB 3LQRA 3FPLA 4YRKA 1GTG1 1UC9A 2A4MA 5BNZA 4P34A 4GM4A 1GTL1 1VMEA 2ZAOA 4IMJB 1N5DA 1IXKA 4ZU3A 3W5VA 5AK6A 5K4HA 1YMVA 5HKAA 3I9JA 3GYGA 5BWCA 2HY7A 5KYKA 4DIMA 1HPLA 3ORHA 2WJHA 4LHSA 3U6KA 3EDYA 3OJEA 2ZUDA 1OB2A 2WICA 3GRUA 1VMDA 4YAEA 3Q0IA 2DPHA 3LC1O 4FS3A 3KB6A 1F5SA 5K8IA 3H9JA 4P86A 5IXSA 4DA9A 1UMDA 1SKBA 3ZGZA 2JFGA 1FU7A 2QSUA 3WRXA 1EQ2A 3HZOA 4TL6A 5DV9A 2IU0A 4R0MA 1ISPA 4UEJA 2V4UA 5CDUA 3PTAA 2MSCB 1PNTA 1KSFX 1SURA 1JT2A 4ZVKA 1W30A 3HUEA 2C82A 1IJEA 1IY1A 1TJPB 2IE8A 2NQ2C 4TRNA 4U6SA 5K3DA 3DEIA 2XZDA 1QFSA 4B3TB 3WNQA 4PAOA 4ZGWA 2FH5B 4ENUA 3VSEA 1JEEA 1L1EA 2ZR7A 2HFJA 3GRVA 2ODWA 1SC4A 3ZU2A 5KTMA 5GADl 5DNVA 5C3UA 1DAIA 5LMCA 3LFUA 1I3NA 2VOJA 1YVUA 5C7IO 5H7XA 4AW9A 4TTPA 4DMCA 3IPLA 2I7XA 1YCDA 5FA6A 4YHBA 5A3VA 2NU8B 4EX7A 4HUTA 2CFCA 4A5SA 4NYMQ 4DWOA 2CEAA 3KYDB 3Q10A 3PX7A 2EDCA 2VF8A 4UU0A 2B2NA 1SUPA 1RZUA 2WG1A 1E2MA 4WJKB 1XPOA 3GJSA 4RK7A 4PO9A 5ECDA 5DP2A 5K45A 4Z86A 1EP3B 4RF5A 3PDCA 4H08A 3G2KA 4P7JA 3RCBA 5LIRA 3UB2A 3T1HB 3QU4A 5IKMA 4GF5A 3KQPA 5JMWA 3ZGVA 1UOOA 4OLFA 5MN5A 4WESB 3UB4A 3WK6A 4PQRA 1ACMA 2J3HA 3JZAA 3L7YA 4X94A 3R3SA 1SC3A 5JQGB 1ZZEA 3PC4A 3GRRA 1V35A 4JENA 1ECLA 2XCQA 4R9NA 1DQPA 1Q7RA 1GY8A 1G6HA 3K0FB 2VWQA 4RDIA 4Y8VA 4RL4A 1MRNA 3VKVA 1HTTA 1CG6A 5JQGF 1W5BA 4O08A 4NMLA 3KHUA 1G60A 5FQNA 3LG2A 2PZAA 3VJLA 2I5PO 3ZVRA 1BE0A 1YR8A 3E9NA 4EMSA 1LFAA 3E81A 1ZUNA 2YYYA 3LOQA 1BKYA 1DB3A 4CEIB 4F56A 1IN6A 3BDIA 3DYVA 2A5DA 3DC7A 4IWXA 4ACAA 3LC0A 5A1JA 2JJ2A 2MINB 2AN4A 4G01B 4S2UA 3RS8A 1BGVA 2I78A 2X6TA 4JGBA 3DLHA 1JIJA 1Z4PX 4K26A 4BCCA 1EUCA 1CDEA 4E32A 4ER6A 5FYQA 3BWMA 1AU9A 2FEMA 3ML1A 3EK2A 1NI4B 2DPXA 3CRMA 1G4AE 4AKTA 1C0EA 1FP1D 3GLIA 4CCSA 3C3WA 3SLGA 1P2DA 1RI5A 2PR2A 3GNSA 4HYQA 3RIGA 1O58A 3U7EB 4BV3A 1M2FA 1W52X 3FROA 3WLFA 4S1VA 4CHTA 2O1XA 4FHZA 5KDLA 5DMXA 4ENQA 4DV0B 2B30A 3Q7EA 2OO3A 3LT5A 1M8PA 2SKDA 2BGWA 3GWGA 4ALIA 2FSUA 2IP1A 2M6KA 2GOYA 3F90A 3OZDA 4AFNA 4OHYA 2WJ6A 1COWD 3RU2A 1D04A 3S2GA 2DB3A 1FS6A 5E6UA 3JCZA 5IYZA 3IP5A 1N5LA 4NICA 1J99A 1MV5A 3I6ZA 4MNTA 3OQ6A 1TCVA 4L27A 4NBVA 1SVOA 3RQIA 3STHA 3IHWA 3V80A 3R3UA 4JBHA 4O0LA 1LRLA 4F1JA 3DCJA 4AKGA 4CKCA 4BPBA 1OYVA 4IIJF 3COJA 2ONYA 4IDEA 4XXHA 3QWHA 4FBLA 4GSYA 2YHSA 4QAJA 1BDIA 4EA6A 2XIQA 4JMPA 3MRXA 2E85A 3VKHA 4OX9Y 1KRWA 2X5JO 4TN1A 4DKXA 3V32A 4PVCA 1KDPA 4EELA 2X2OA 1Q7EA 1DT3A 2R751 2G9NA 3RV4A 4GUAA 4EW3A 4I08A 3WGNA 1R66A 2WIBA 3MTIA 5CPFA 4B3RB 3A1FA 3VYVA 4M9QA 4E09A 1YA8A 3VUFA 1XEXA 1WDWB 4UCXA 2JFNA 3RABA 4NBSA 5H3HA 3MINA 4ALMA 1MAUA 1U2SA 4MV7A 2X8JA 2OZLA 2P5SA 3WGOA 4CCYA 1G8SA 5J58A 2XHZA 3G2MA 3LBAA 3IUBA 4UM8B 2B0CA 4WOCA 1M74A 2PS1A 4TZKA 3T9AA 3O9MA 2VDLB 4GX0A 3EMKA 2PQMA 3N9IA 3PXEA 3R5FA 3RHTA 1Q20A 1QV9A 2QVBA 2PNJA 4CKBB 3ZOZA 4XRRA 2V9CA 3JU3A 5JD4A 3ICWA 4A36A 1IL0A 2P68A 4I5IA 3RHFA 3ZCQA 5ENVA 4L15A 3WBBA 2CFIA 2SKCA 4A2QA 4EAQA 3KR1A 4HDOB 2O59A 1Z6QA 1L4KA 3HJNA 1QKIA 1U28A 4ITVA 4D43A 4U2KA 4DLLA 5KNBD 1QE0A 4AUKA 4NYIR 4TS9A 1D6SA 1OIXA 3JVIA 1VKJA 4CT0A 1A4RA 3SDBA 4EUKA 4N5DA 3NFYA 4G0XA 2ZYSA 4JS0A 1GL7A 4HGOA 4PU0A 3T3GA 4V0SA 2VWHA 4GZMA 2FPKA 3SQNA 2X8BA 3H1BA 3SPXA 5KOHA 4U7GA 2BFDA 1CF4A 2QN3A 4MQMA 1UBEA 4RELA 3C6YA 2BZ0A 2X4IA 2BR3A 1GITA 5KHLB 2Z9DA 1JYFA 2P9EA 3B78A 3ZD9A 4MX8A 1RU3A 4YYZA 4IWNA 1ES9A 1DC6A 5LUAA 3I0ZA 1CNEA 3MMNA 3IPAA 1DADA 3SJUA 2XOEA 1ONPA 5DZSA 3B3AA 3BS4A 3CH4B 2PZEA 1J7JA 5HS4A 1P6QA 2QAGC 5AYVA 2V7PA 3KOZA 2IH4A 4FJ1A 4KWHA 1R6VA 1SCJA 1P0QA 1PBNA 2BFBB 1G20B 3NC0C 5IEBA 5BSFA 2G04A 3PUJA 3VPSA 1EDOA 1D03A 2PD6A 3TLJA 1V5IA 5AHKA 4ZYYA 4S2EA 4RDCA 4Q9DA 1NF9A 4JJIA 3SAJA 2XAAA 1VI2A 1PG5A 2JLUA 4I50F 4JLVA 2DBRA 1LY1A 4FYJA <