The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
47
|
sequence length |
152
|
structure length |
152
|
Chain Sequence |
MYSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Hydrolase
|
| molecule keywords |
alanyl-tRNA synthetase
|
| publication title |
Molecular basis of alanine discrimination in editing site
pubmed doi rcsb |
| source organism |
Pyrococcus horikoshii
|
| total genus |
47
|
| structure length |
152
|
| sequence length |
152
|
| chains with identical sequence |
B, C
|
| ec nomenclature | |
| pdb deposition date | 2005-01-27 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Replication Terminator Protein; Chain A, domain 2 | Replication Terminator Protein; Chain A, domain 2 | ||
| Alpha Beta | 2-Layer Sandwich | Threonyl-tRNA Synthetase; Chain A, domain 2 | Threonyl-trna Synthetase; Chain A, domain 2 |
#chains in the Genus database with same CATH superfamily 1TKY A; 1WNU A; 1TJE A; 1TKE A; 3RFN A; 3RHU A; 1V4P A; 3WQZ A; 2ZZF A; 1TKG A; 2ZTG A; 2E1B A; 3KEW A; 1V7O A; 1WXO A; 1QF6 A; 2ZZE A; 2ZZG A; 1NYQ A; 1NYR A; #chains in the Genus database with same CATH topology 4XR2 A; 2I05 A; 3EI3 A; 4CI1 A; 3RFN A; 4CI2 A; 3ZX4 A; 3I7P A; 3EI1 A; 2E1B A; 2B5L A; 1ECR A; 1WXO A; 1NYQ A; 3ZW7 A; 1TKY A; 4AR8 A; 1WNU A; 4AR1 A; 2IUU A; 1TJE A; 3EI4 A; 3ZWD A; 4TZ4 A; 3I8C A; 2Y50 A; 2B5M A; 3E0C A; 1V4P A; 2ZOS A; 2Y3U A; 2HYE A; 4ARF A; 5FQD A; 3I7H A; 1NYR A; 3I89 A; 4AR9 A; 3ZWK A; 4E54 A; 1TKE A; 2Y6I A; 3ZU6 A; 2I06 A; 4ARE A; 1TKG A; 3I7O A; 3ZTY A; 4XR0 A; 3ZX5 A; 4XR3 A; 4A09 A; 2ZTG A; 3I8E A; 3KEW A; 1V7O A; 4E5Z A; 2EWJ A; 2ZZE A; 2ZZG A; 4A08 A; 3EI2 A; 3ZUP A; 4A0B A; 4A11 A; 1WZC A; 3RHU A; 4XR1 A; 3WQZ A; 2ZZF A; 2IUT A; 3I7L A; 1XVI A; 4CI3 A; 3I7K A; 2IUS A; 3I7N A; 1QF6 A; 3ZTW A; 4A0A A; #chains in the Genus database with same CATH homology 1TKY A; 4A0B A; 4AR8 A; 4XR2 A; 1WNU A; 2I05 A; 3I89 A; 2IUU A; 4AR1 A; 4AR9 A; 4A11 A; 1TJE A; 3EI4 A; 3EI3 A; 4TZ4 A; 4E54 A; 4CI1 A; 1TKE A; 3RFN A; 3RHU A; 2Y6I A; 4XR1 A; 3I8C A; 2Y50 A; 2B5M A; 4A0A A; 3E0C A; 4CI2 A; 1V4P A; 2I06 A; 4ARE A; 3WQZ A; 2Y3U A; 2ZZF A; 1TKG A; 2IUT A; 3I7L A; 3I7O A; 4XR0 A; 3I7P A; 4CI3 A; 4XR3 A; 3I7K A; 3EI1 A; 4A09 A; 2ZTG A; 2E1B A; 3I8E A; 2B5L A; 1ECR A; 1V7O A; 1WXO A; 3KEW A; 2IUS A; 3I7N A; 1QF6 A; 4ARF A; 2HYE A; 4E5Z A; 2EWJ A; 2ZZE A; 2ZZG A; 1NYQ A; 4A08 A; 5FQD A; 3I7H A; 3EI2 A; 1NYR A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
