1X94A

Crystal structure of a hypothetical protein
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
191
structure length
176
Chain Sequence
MYQDLIRSELTEAADVLQKFLSDDHNIAQIEAAAKLIADSFKQGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPGIAIDYVFSRYVEAVGAKGDVLFGLSTSGNSGNILKAIEAAKAKGMKTIALTGKDGGKMAGLADVEIRVPHFGYADRIQEVHIKIIHIIIQLIEKEMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Phosphoheptose isomerase
publication title Crystal structures of two putative phosphoheptose isomerases.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Isomerase
total genus 66
structure length 176
sequence length 191
chains with identical sequence B
ec nomenclature ec 5.3.1.28: D-sedoheptulose 7-phosphate isomerase.
pdb deposition date 2004-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13580 SIS_2 SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1x94A00
1M3SA 2CXOA 3IFSA 1IRIA 1MOQA 2CB0A 3OTOB 2UUCB 4B3TB 1NUHA 1JLHA 3I0ZA 4LF7B 1N8TA 5I01A 1N34B 3FXAA 3CVJA 2CXQA 3T1YB 3QKIA 4OX9B 1XMQB 3ETNA 1T10A 1DQRA 4S1WA 2PGIA 2ZJ3A 4JI3B 4DR1B 2I2WA 3ODPA 2ZM6B 4JI0B 3SHOA 3FJ1A 4LF8B 3NBUA 1HR0B 2DECA 3TBFA 2F4VB 3C3JA 1JIQA 4LFCB 4M0DA 4GKJB 2I22A 4JI2B 4LFAB 5BR8B 1XMOB 2VF4X 5IWAB 4IVNA 1J5EB 1GZDA 4GKKB 2HHHB 2CXRA 1C7RA 4DV1B 5FLXA 1X94A 1GZVA 3J7AC 4K0KB 1G98A 1N36B 1U0FA 1VIMA 1JEOA 2Q8NA 1ZZGA 1IBLB 2CXNA 2PUWA 4DR2B 4B3RB 4DR5B 3J80A 4LFBB 2UXDB 4JYAB 1U0EA 1XTBA 3Q88A 4LF5B 1X92A 2O2DA 1MOSA 4LF6B 1X9IA 5LMUB 1KOJA 1TZBA 1VIVA 2E5LB 2V4MA 4DV3B 1MORA 4DV7B 2VQEB 2UU9B 4AQYB 4NXMB 4DR4B 1IATA 3JAMA 4X66B 2UUBB 1HOXA 4AMVA 1N33B 1U0GA 4JI7B 3FKJA 1X9HA 3UJHA 3T1HB 4EM6A 4YHHB 1Q50A 1C7QA 2CXPA 4JV5B 2PUVA 2A3NA 4X64B 3M5PA 2PUTA 4JI4B 3G68A 3JX9A 1XNRB 4TOIA 4JI1B 1I94B 4S12A 2O2CA 4DR6B 4YY3B 3LJKA 2CXTA 2CXSA 4NXNB 1IBKB 4DV5B 5LMNB 4B3MB 4DV4B 2J6HA 3PR3A 4JI6B 3BJZA 4LF4B 4B3SB 2VQFB 5IT9A 5BY2A 4LZJA 1HNZB 2UUAB 2CXUA 4JI5B 3HBAA 1WIWA 4X62B 1HNXB 2XBLA 4LF9B 3TRJA 1N32B 2X3YA 2YVAA 4X65B 5LL6P 1NRIA 2XHZA 4U6NA 1JXAA 5A2QA 2UXBB 2POCA 4DV0B 4JI8B 3Q7IA 4DV6B 4DR3B 1J5XA 2E5FA 3BCHA 4DR7B 4KHPB 2VF5X 2ZJ4A 2WU8A 1HNWB 3FF1A 3OOJA 3HJBA 4DUYB 2DF8A 1HM5A 1FJGB 1VI5A 2CVPA 3KNZA 2AMLA 1VI6A 1TK9A 3EUAA 1IBMB 4DV2B 4DUZB 2UXCB 1B0ZA 3J81A 1XNQB 1TZCA
chains in the Genus database with same CATH superfamily
2CXOA 3VR6H 2ID9A 3KJGA 1KU0A 1VG8A 5ALFA 1R0YA 2AD1A 3IQZA 1H0RA 4JLJA 1P2DA 4I36A 1HE5A 4OSOA 5ENVA 4BV2A 3HVIA 4F5DA 3DXXA 3BIOA 5JD6A 1SQ0A 4M76B 1L7EA 5ADHA 5DOVA 5J1SB 3BXFA 2VRNA 5I3CA 2WIKA 3CU5A 1FYXA 1NX6A 2WKPA 3Q1LA 5BMOA 2XQJA 1G3RA 2HQRA 3DG9A 3GQBA 4QPDA 3ZXSA 3JWGA 4EUSA 5BT8A 1WM1A 3S29A 2VTBA 3A6KA 3AHIA 1V7CA 2O2EA 3JD1A 3P0JA 2IXDA 5JADA 3DDCA 3R3SA 2ZB7A 4JU8A 4ZVQA 1PN3A 3RK4A 3KYIB 1TYDE 1B2LA 3OIDA 4AFNA 2PX6A 5DYYA 1YR3A 2QKYA 3DV0B 1QRTA 4L9AA 1D2CA 2TSYB 5AKEA 4CWAA 1KY2A 1Z2EA 4BP8A 4DMHA 3FNBA 3X2SA 5D01A 3AY0A 2DM6A 2H1IA 3DMDA 2IEBA 2CNNA 5HBRA 4RKQA 2MU1A 4QUBA 5A4JA 2W6QA 2PS1A 3HEMA 3OU7A 1XLTC 4KLAA 3WISA 4ARIA 2XB4A 1H1DA 3I9KA 3ZPXA 1DV1A 4MV9A 3GRYA 3IVCA 3RH0A 3CN9A 1NKSA 4DWOA 1G5RA 1QVVA 2O05A 2D1QA 2FPMA 2X9NA 5CT5A 4CF5A 3L4EA 2ZCVA 4YJHA 4YS6A 1E3DA 1UZUA 3AHGA 1BWQA 4HSGA 4NZNA 5TX7A 1DRJA 4AJIA 2PKQP 4UPDA 2HJSA 3KBBA 2H65A 1ZRSA 2HWYA 3BDIA 5CPFA 5EJMA 3V7FA 4L3WA 1FUEA 2QM3A 2RJNA 1NQTA 3WBFA 1CS4C 3NH6A 5JASA 3DWFA 3DZHA 4ND5A 4D9MA 4RS4A 3U13A 5FWXA 1HORA 4BUZA 5FH9A 3HUUA 2ETXA 1A9TA 1NW9B 2Q6TA 4JZKA 1IHOA 3SX2A 2HHLA 2HJVA 4OGGA 5CA0A 4GMXA 1Q0UA 2XUQA 3EXEA 4FCCA 3JPYA 2XUDA 3V33A 1WUJS 4LXIA 1OI3A 1YRAA 2WTAA 3Q87B 4L6IA 5FTNA 2GCEA 2Z3WA 3TJMA 1VRWA 2B4AA 2IOYA 3K4PA 2WWGA 4LY9A 4RD2A 4BASA 5C1BA 4Q3NA 2I2AA 2QAJA 2O0JA 3A9SA 3UJBA 4GOJA 1I4TD 5KNBD 2F8TA 1S7CA 3HY6A 5A3SA 1AUQA 3M83A 4I2VA 1K2WA 3RHZA 4E22A 1XKTA 3COYA 3KLOA 4ZI3A 1AO3A 4QTXA 3PYLA 2WMOB 5MGBA 4YJKA 4P3OA 1WV0A 1QDEA 2BR5A 3KV3O 3ZU6A 3S2UA 4CEIB 1SVUA 3ZU3A 1G4AE 1C1YA 1HFKA 2HU2A 2Y0PA 1KBOA 1M1YE 5EJFA 2VDWB 3UCXA 1FS4A 5HE9A 4CE6A 4XQCA 4MWCA 1UAAA 2DUWA 2E55A 2OV4A 5F33A 2P62A 1VMIA 3I23A 2W6ID 4LOLA 3E9QA 4S1TA 1ZL2A 1TI7A 4YDQA 2I4IA 2WU3A 4N4AA 5IT4A 5BO5A 3JAWB 4QOEA 1KNXA 4P4NA 1PT9A 1NVBA 2IZ1A 3A9UA 2VDKB 2IK8A 3LECA 1ULBA 721PA 4MA4A 3X0DA 4BNIA 4CBVA 1E8DA 2APJA 2VJQA 3C70A 3NG1A 2CCKA 4MOWA 4S04A 1RQXA 4IHJA 5HDBB 4WFJA 2F64A 3KZ1E 5IZCC 4WVFA 4FOLA 1WXQA 4NK4A 1E2JA 1FL9A 2QVGA 3GU3A 3OJWA 2PIDA 1Z4MA 2PQ0A 3EQZA 1OLUB 2WHPA 3A9CA 3BXHA 4RJIA 3HJGA 5G0UA 1L3CA 1VKNA 3VR2A 1YAJA 1DDOA 1T2UA 2E1PA 3KZVA 3L6EA 4KMSA 4MRMB 1EHCA 1MVNA 1EFVA 2CVOA 1UM8A 1PQWA 1Z3CA 4IIXA 4D74A 1MAHA 3IP7A 3NXKA 1HNNA 5TRTA 3DOCA 1CLUA 1BJRE 1MDFA 4QYWA 4V1CB 3CZRA 1L8LA 2XQGA 1G63A 3TSYA 2DFLA 3BF7A 1H1LB 5AM3A 2H18A 1B14A 2X4LA 2COKA 2AOTB 5EIBD 4RDIA 1QWSA 3ZTYA 1YJ5A 1EFLA 1I4WA 1T34A 1HEYA 2IYEA 5JR3A 1T13A 1EAMA 3WLIA 1YIDA 2G0TA 2SKDA 3WQHA 3WDKA 1NY6A 1OMOA 1RP1A 2ALJA 2CXNA 2O2IA 3ED5A 3QX7A 5CLLA 1YRWA 4QOHA 4B43A 5BVGB 4Q4HB 2I1WA 4F4JA 3WE7A 5FJIA 2B1GA 3VHRA 3T9CA 1KE2A 1L9XA 4PNHA 3N39C 5AOBA 2QUHA 4JDPA 2DLDA 4X66B 3FFTA 3CA8A 1WQ3A 3JWIA 2RGNA 4J0IA 4FMPA 1Z4KA 1LVGA 2PZEA 4NICA 2MYNA 2P40A 4EX7A 1QONA 2OCDA 1GILA 1AM4D 4YBRA 1DG1G 1JG3A 1NUPA 2PDAA 4XCVA 2P6NA 4ZI2A 4FM9A 1OX4B 3VHXB 3BA1A 4B33A 1Z2NX 1KFCB 2ZJ8A 3R2JA 1F6BA 4JIGA 1E2KA 1IXKA 3EQ6A 3W78A 1RWWA 2OHOA 2J0EA 1FUYB 5JS6A 4PLWA 2G1AA 2D13A 2ZVJA 3NJ4A 3F73A 3PDWA 3DHVA 4Q7KA 1OY1A 1TW2A 2VL7A 2ZXFA 3ACCA 3KOYA 3AOEA 2C88A 1R0XA 1N6IA 4HBGA 4EDHA 1EBBA 4G8DA 2P9BA 3DF9A 4GXQA 4HHEA 2Z0MA 2H59A 4FLFA 3ROEA 4W82A 1PJRA 2I3BA 4FPXA 5IN5A 2Q9UA 3GLHE 2NSYA 3UC9A 3GZJA 3UV6A 4C0JA 3ERCA 5KYXA 4HRXA 1WDMA 4RCZA 1CK4A 1T1IA 1U2ZA 2CHVA 3GWZA 1YR1A 3WB1A 1M0SA 1TT7A 2EV9A 2Q50A 2VNSA 3LNTA 4ESVA 3AV3A 1ZH8A 1P0PA 2PZKA 4XPZA 3ZY2A 3G0DA 2IBTA 2PFGA 5E3JA 3R7BA 5K45A 4KPFC 2OD7A 4UC0A 1H05A 2N46A 1I2AA 1N3LA 2R9VA 1TD1A 3GX1A 3EGWA 4JOBA 2DY1A 5CVCA 4EO7A 3P2YA 5IJ0B 5B12A 4E03A 3L4KA 2HO5A 3K94A 4O0MA 1MQAA 2VDJA 3HZOA 4BS9A 2Z2JA 2G6BA 5JO0A 3DZCA 1YOVB 1U8XX 3A9RA 1EZZA 1U1FA 2ZWAA 1IZ8A 4FEGA 4G23A 3VR2D 4QC2A 3OUZA 5C3UA 1Z33A 2AFIE 1Q92A 3C48A 4IDQA 5LQKA 3H2JA 4HN9A 4H6VA 1R12A 2BDEA 1SBIA 3ZBQA 4A92A 3IIMA 1I33A 1G8HA 2O5VA 4ZGWA 3OT1A 4N0QA 5JQGF 3G2OA 5KYKA 1KRWA 3OZXA 1YQEA 2VXCA 1MC8A 2F67A 4ND8B 5ICCA 4JGIA 3WB2A 3A4TA 5SYMA 2UUCB 2HF2A 4BB9A 2PYDA 3EPRA 1Q44A 3QBDA 4R1OA 1O9BA 3RJZA 1E66A 5GV8A 4PZ0A 1Y3BE 2BOVA 4D96A 3PL5A 4PCAA 4BMDA 5AKGA 2OO5A 2NU7A 3ZJTA 2HDOA 2I54A 3ZH2A 2NUTA 3NEAA 4IZOA 4PG4A 5IH7A 1GG2A 5SY6A 4XM1A 2DHQA 1EMDA 4OY3A 1WMDA 1A5SB 1JAXA 4OHVA 1KO7A 2WY2D 1ZVKA 3UZUA 4M7WA 4CKCB 5LIPA 2VF4X 2QW1A 3LO8A 3OD5A 1URPA 4FE4A 2VTDA 5DMXA 3C98A 1HF3A 3G5MA 4XD7D 4BMVA 3AVYA 4IGAA 3RVMA 2IGBA 1X94A 2F59A 3L0ZA 2ZT8A 4G84A 2HU5A 1KARA 1ONBA 2V7WA 3AJRA 3EULA 4RK6A 3SJ7A 4FXPA 2P41A 3EIEA 4Q19A 5I48A 1NA5A 1NDQA 3KSZO 5JNTA 2PA3A 3QOFA 1GCUA 1R8SA 2GAFA 3CINA 4JQOA 3TB4A 3AF2A 5EXPA 1GWNA 1UJBA 2C7VA 3E1KA 3HSSA 3L04A 1K98A 4GBJA 3K0FA 4IHKA 1CULC 4R2MA 3FZQA 1TZBA 4RACA 1P6QA 3F3MA 1HRKA 3GVPA 2AMFA 5T3YA 3QF7A 2R6JA 1IATA 4E12A 1JLRA 2LBPA 1NJGA 1XCBA 3G2MA 3FWKA 4RKWA 4W9RA 4O25A 4P7KA 4C07A 4BLPA 3FKJA 2C2OA 3R9WA 5L3VA 5CYOA 4M54A 3DBVO 3GEBA 5D6NA 5E9AA 2EC5A 4LV8B 1JJAA 2IXGA 3COSA 3G17A 3HZHA 2DYKA 3CZAA 3P0EA 2O0LA 3D8RA 3NVDA 3LDHA 1BOFA 3L1IA 3QLVC 1EDOA 1BXGA 1WCIB 2VQSA 3JSXA 2CUKA 2IIPA 3HLKA 4YGXB 2OA0A 1VKHA 5DTEA 1MF7A 1Z4NA 1T8WA 1PHPA 3E7DA 2NU6A 3A2MA 3LT4A 4UKDA 5ECYA 1DU4A 1HZZC 3A1SA 5HRAA 2RG1A 1X19A 2XB9A 2FWNA 1EGAA 3MJEA 2QQGA 4OG2A 4G86A 1AQNA 2QX9A 2I1VB 1XTSA 4G1VA 4I9HA 5ALRA 2CBGA 3FI0A 4D97A 5IX8A 3C7CB 3VI4B 1W4AA 3BQ9A 2P5SA 1S2OA 3I05A 1SHLA 4WK0B 5D5HA 4D0RA 5AD1A 3W3AH 2D1RA 3G5LA 1V1RA 3DZDA 4U6SA 3SX4A 3KOWA 3UB3A 5CLHA 4MI1A 2PUFA 5ICFA 3BJRA 1V4BA 3DUFA 2ESRA 2AK3A 3C5VA 1LJLA 2I33A 4LYHA 4EYKA 1MAVA 4BQRA 4J0FA 2CMGA 5JPDA 4MKGA 1P0QA 2J07A 3UOAB 2WK1A 3R9KA 2HCJB 3RIXA 1C80A 4QXPA 1BC5A 4Y8VA 2ZQZA 5DI3A 3AFOA 5CVUA 4DSNA 4ZZIA 2N1BA 2ZJAA 3U81A 1NULA 3LY7A 4B2LA 1MH9A 2DCMA 5IVPA 4B3BA 2DT5A 1FFYA 1KJZA 1UOOA 2DG2A 2DBZA 2WZBA 1FJXA 3FETA 1NJ8A 5EUCA 3Q0TA 4M9XA 1NMYA 3GJ8A 4PYLA 4U8HA 1N5OX 3AU9A 3GGJA 3AR8A 2B20A 3K9QO 4H1WA 4PSAA 1QYWA 3FIUA 3RFXA 1U9IC 2OR3A 1FVFA 2VFAA 3ONWA 2GRAA 2SECE 4YJGB 3ZGNA 3ZHXA 5B3KA 4QO8A 3OWXA 2W8BB 2YWJA 4LE1A 5HF5A 3VKFA 4WZBB 3IT3A 1N6LA 2XXJA 3TQOA 4DIFA 4N0PA 5WRFA 2RHOA 3JY6A 4B9AA 3TJRA 2MT9A 3FNGA 2IP1A 2L69A 2PL3A 3IT0A 3OZSA 4DBLC 3U6BA 1QZ3A 1E1CB 1X80A 1DBIA 1DKOA 1XWWA 3FUWA 4JP1A 4JQCA 4RSMA 1KC1A 4UCWA 1TA4A 1Z6PA 3SZGA 3EARA 2E48A 1LUAA 1Q0ZA 2LCIA 1X7WB 3JVUA 5JNSA 1H66A 1AIPA 1VKZA 1X1BA 2AFIB 3A4IA 2C00A 3ED1A 3FGOA 2CJWB 1AE1A 4GXTA 1N36B 1A95A 1GZSA 3TPFA 2DPLA 2YHIA 5HJ5A 1A9QA 1AKRA 3PENA 1IUPA 3G89A 4N54A 4BLWA 5AOAA 5MN6A 1COZA 3N2LA 3GXOA 3CUKA 3FNQA 1B8PA 4UAGA 2BGIA 4AZ3B 4EY6A 4YRCA 3FPAA 1E69A 3IP9A 5FOVA 4BC1A 1YJBA 4KIFA 2X0DA 4MAFA 3AEQB 3TTWA 2VEOA 4JHXA 1QHNA 1N75A 1VPEA 1FZQA 1UT5A 2WJYA 3KOXA 5CJPA 3TE7A 1LTQA 4X8OA 4ICIA 2O7RA 3Q3IA 2AFHE 3L5KA 5AKZA 4PEVA 1QIFA 2ZW9A 3DH0A 3GLHB 3HA2A 3KB6A 1RMTA 4A91A 3Q98A 4MV1A 2I0FA 3VA7A 1EGHA 1DJNA 4LUCA 3M5PA 4YI3A 1UOPA 1YDFA 3EIUA 4W1QA 2E5WA 4Z8XA 4HH1A 1OH8A 1F8UA 5AHXA 4Y67A 3WMRA 4CODB 3JTEA 3ASUA 1O95A 2MSWA 2J5XA 4EY3A 1YL5A 5KKCA 4B3MB 3W6NA 4N7JA 5A03A 3QUCA 5TJ9A 1P2SA 3V42A 3FR8A 3GVIA 4UFPA 3EG5A 2X8JA 4BNMA 1ZEJA 5TT0A 4EQZA 1KBZA 1DXYA 1Y4SA 4LZJA 1RRMA 2E87A 2ZZMA 3SYMA 1LRJA 1ZK3A 4H7KA 1PKXA 2LZ0A 4GXRA 4NY1A 2YDXA 4QIHA 1E1RD 4EUNA 4X93A 3FPJA 4XVUA 5F2NA 3JXEA 1Z6AA 5IBPA 1W19A 5DM1A 2SBTA 5E6SB 4PVDA 4BE7B 4RNCA 2W2KA 3A7DA 2QP9X 4OBWA 1XUOA 1NJFA 1TEXA 2XWQA 1M9NA 2Z8YM 4BP3A 1R4AA 3R8CA 2C2ZA 3MFYA 1P2FA 1L5VA 1NU8A 4Q4HA 2NMVA 2WABA 5LDDC 1I2CA 3NDPA 3Q40A 3QVGB 5I9SA 4CG2A 1IQPA 2YC4C 4R1TA 2GN1A 1NV9A 1ZKDA 4RCYA 4EGQA 3TGLA 2G4CA 4DUZB 4EHNA 1TO6A 2H7CA 3LY5A 5EERA 1B8OA 4MW2A 3HHEA 1UJCA 4MUXA 1GTZA 4I6GA 3HP7A 5EN4A 5M3BA 3VJKA 3ZDEA 1NXWA 3EIXA 4MI6A 1N3IA 3I9MA 3WR5A 5JS7A 2XMQA 4DIDA 1GEEA 2BVNA 3DE5X 1HL7A 2MOKA 2CZQA 3AINA 1XVUA 2J9XB 3MGGA 3P9CA 2OTCA 1TT5B 3JQFC 3V2IA 4IWYA 1OX5A 2ZRGA 1TCBA 1FFXB 3DXZA 1SKYE 3GCXA 4RTMA 2C5LA 1U2RA 2ZYUX 4ML3A 2VBFA 2ZJ3A 4YDSA 4L27A 3RS3A 3ZDFA 4M83A 4E31A 5CA1B 1L7RA 4UHEA 4BX3A 4AS1A 1UM9B 1NLMA 5FKJA 2IOFK 3QKRA 1Y7LA 4AYXA 2FUG1 1R0BA 4XGQA 4X1YB 1YQ9A 3USES 5JMPA 4FVTA 2ASVA 1L4EA 1YRYE 3R5SA 4IEIA 3GUCA 3QLUC 4J0EA 4TKVA 5J4VA 4TWZA 2V9CA 2B1JA 3FCSB 2JCXA 3GHYA 2FW6A 8MHTA 3L1HA 6ABPA 4YP7A 3WK5A 4KPYA 3HVJA 2C58A 4TZKA 5DO9A 4XQEA 4NCIA 4M9CA 5K6AA 5KWSA 1D3AA 1Q3HA 1TQDA 3AIIA 3T6KA 5LSAA 4II2A 2JFZA 2O3JA 4ENSA 4IKPA 4D9BA 2IP2A 1XU9A 1XD2B 2ORED 3DQZA 3F67A 4KN8A 1CUCA 3R0QA 3S3TA 1OZ0A 3KJXA 4TXMA 3MCTA 3SC2B 3FUUA 3ZGZA 1AHNA 1NQVA 2GJ9A 2ZE8A 3KJFA 4FNGA 4Y6OA 3LYAA 4NC9A 3EWNA 4BP1A 3O8CA 4CMJA 3ZIDA 1X80B 3WHPA 3EH1A 3TSOA 4DZRA 1WPRA 3F49S 4B9EA 3ECCA 1PG5A 1Q6YA 3GRKA 1CP2A 2D4HA 2E7ZA 3FM9A 3V1YA 5GONA 2QL6A 2GI4A 1DOAA 2GN0A 3GFTA 2XJ9A 3I12A 4PRZA 2DQYA 1P72A 2IYTA 5EMHA 5G0SA 3O3MB 1P8JA 1E3EA 1AY0A 2V7TA 3SAJA 4DSZA 5I9IA 2BR3A 1JAHA 3PSHA 1PJ8A 2R5FA 3ILXA 4MYCA 4UNSA 3SSMA 4DA9A 4DJTA 1IXRC 3ORFA 4QBIA 2JLYA 5DMHA 3AUAA 5BW4A 2VWHA 3OQHA 4HNAB 1N8SA 4NF2A 4ABYA 2LCFA 2XRMA 5U9CA 4MW7A 1HFEL 1AKEA 3QELB 4DAOA 4QVGA 4QKQA 3TLXA 5LBUA 2GUWA 2PVCA 4AX4A 1WP4A 5JO9A 1JN0A 5BYBA 4CTJA 3DLAA 1XT6A 1XMJA 1OVMA 4O4IB 1VCHA 4MCJA 4PR3A 4CT0A 4DCUA 5EJ4A 4MPDA 2Z58A 4CLDA 1TTTA 2G09A 1F1JA 1R7RA 3IS3A 1W1IA 2GQ0A 1KK3A 3DE0X 3UO8B 3EHDA 1OLSA 1OIVA 2WILA 3FCUB 4IH9A 1E2LA 1JIVA 2D2VA 5IM5A 4D98A 2HR1A 2G9UA 2M6SA 3PGXA 3A1CA 2GPSA 2PMBA 4LVCA 3ZQ4A 2DF8A 4COKA 3TZLA 1DKQA 2JGEA 3E1SA 4EHBA 2C4TA 3AM5A 5H59A 1YJ8A 4B79A 1SIBE 2OG1A 1ODFA 1LBEA 4D82A 4BXOB 5FWYB 2CUNA 2FVXA 1PDOA 1KO8A 4GUAA 4CTNA 3BAZA 5C0OE 2SKCA 5FAKA 1R15A 4M60A 4CDMA 1Z16A 3UOWA 1OF1A 2PWBA 2O3SA 5LUBA 1U7WA 4IEEA 4O8ZA 3FVVA 4Y18A 2Z95A 2QSUA 3A06A 3LK7A 2CYBA 3ZCRA 1N2XA 2UZ0A 1BYUA 3ETJA 4Q9DA 1TYAE 4KOAA 2O7VA 1FDTA 3VNVA 1HFWA 3QTTA 4BY9E 2JLSA 3ZOKA 4MLZA 5AM1A 1DZ3A 2Z4TA 4A6PA 2OFPA 2VRBA 1Q5PA 4EAAA 2ZS7A 3QVXA 1WOYA 2IYUA 3GGPA 4O63O 1UF9A 1W4RA 5T64A 1FTQA 5E0KB 1D2GA 4HN4B 3CUYA 4LXXA 2PSEA 4K6MA 1MPTA 3DNFA 1XNGA 4KTTE 4AROA 3GP8A 2F43B 1SZPA 4RHFA 4UUAA 4AB1A 5HQJA 1XMOB 5MF6A 1RCFA 2OZLA 4RZIA 3RF6A 3X1JA 4BN0A 2AEEA 2IYLD 1JHMA 1RKXA 2QTRA 2XMCA 4TRMA 4UCQA 1C3VA 1YR6A 4QWWA 3OE7A 1DBRA 1NHGA 3IIKA 1EWVA 4HDRA 3GPCA 3L8EA 2ZT6A 4NJMA 3HWX1 1KL7A 1L4BA 5SY4A 2C0QA 2GMWA 1FNCA 2Q62A 3PFIA 5KVQA 4I5EA 1RKVA 3PWKA 1D2EA 1NXXA 2BM0A 3STVA 4C04A 3IT2A 1ZWKA 3KSBC 2ZBDA 4HNGA 1W76A 4YA6A 3QKRB 4KR9A 4F21A 2YZMA 1QCYA 4G56A 3VM6A 3P2KA 3ZCXA 2FRDA 2VWQA 2YQ5A 4INAA 4KITB 2WWWA 1QTIA 4TL8A 4ZO7A 1QIEA 4IO1A 2X7JA 3L8DA 3A6PC 2FSPA 2DZDA 4H35A 5B3JA 1HG1A 4M1EA 3RVJA 4D02A 4DWWA 3IRUA 3EQ9A 4NPCA 4AKEA 1G4UR 1K3UB 2HWKA 2Q3BA 4KVZA 5FNVF 3WB9A 3T4PA 1SU6A 2X0IA 4HGRA 1H8ED 1NVEA 3CGGA 4BVBA 4HRAA 1IY9A 4B17A 1RLIA 5FB3A 4V2UA 4DMUB 1QG2A 3QBTA 1GGFA 1Y4AE 2A0YA 3BOSA 1W94A 1G8YA 2NYAA 4PG8A 4WERA 5BYKA 4CCYA 4MGKR 2J5BA 3TCKA 3ZHQA 1W4ZA 2ZT7A 2XF2A 4R05A 2JRLA 3GLIE 4HWPA 2W4QA 4KRYA 1MJFA 5JALA 4IVPA 4ZDWA 3VXKA 3EIFA 4XWOA 4RPHA 1Z6XA 3EZGA 1HNZB 3AOEC 2P9ZA 3MLBA 2FEXA 5TQ0B 3BMOB 1WIWA 1RHQA 1U6IA 3HXKA 1RZRA 1NNUA 4NOJA 4FFPA 2B5WA 2V7EA 4NMLA 1SN7A 2A1UA 2LW7A 1NBAA 3V1LA 4ZXPA 5AM2A 2JFUA 1QHGA 2R8RA 3O93A 3KXIA 3HJAA 3E3NA 3OHPA 4I99A 3HJFA 1DKRA 5HZMA 2FETA 1TQ2A 3AW8A 3WGGA 1MGPA 4KX3A 2PKRA 2AG6A 5IULC 1CUDA 4HBZA 2GK7A 1XRMA 1RHMA 3HNRA 1CUSA 4C05A 3LLCA 1EK0A 5F4BA 4ABTA 1NQUA 4BEVA 3PNLA 3DV9A 5AJUA 2OCBA 1WV1A 1IQ0A 3GJZA 3PC7A 3QQPA 4IDNA 4WOCA 5GPBA 1JVSA 3I04A 3HA5A 1J2JA 1EEXB 2C5FA 2VP4A 3U9SA 5JXWA 5I5GA 1G5QA 2RFLA 3ORQA 5IJAA 3RV4A 5C3MA 1VL6A 3TM4A 3AYZB 2R5WA 3RVPA 1DP4A 1Z45A 3H83A 2BZ1A 5TNXA 2EG5A 3ENVA 4BKUA 4EGAA 2XV1A 3RYCB 5LQSA 3RLIA 4OLBA 3SBXA 5F98A 3EQ8A 4XX1A 4QQRA 4WJKB 3B9PA 1IZZA 1YS4A 2H85A 3FI9A 4CEJB 3A4VA 1FP1D 4PFJA 3HLTA 4URZR 3V5NA 5I5EA 1V16B 4KXYA 1ZP6A 4NZMA 1U0NA 3VNSA 4RJKA 3EN0A 3WAJA 2HCRA 4MKXA 3NYWA 4AW9A 1LGYA 5JV5A 2QAGC 3C87A 2P2SA 4A0RA 2SHKA 1MB4A 4KSCA 3YASA 4MW4A 3M5WA 4F5ZA 1IN5A 3IIIA 1PJ3A 4OJNA 5K0CA 2XTNA 2IL1A 3WYCA 1CF2O 2CLLB 2IPXA 2DR0A 3OX3A 2WTXA 1XIVA 2C99A 4ZAFA 2DWOA 3VRHA 2PZFA 4MNTA 4UE2A 1CDDA 2O7QA 2QZPA 3WKAA 3KUUA 4U0KA 1NE7A 4UBOA 2FPUA 3CR7A 3VYRB 3PQ3A 1M1UA 4G0MA 4P34A 2C4VA 4DIMA 2NGRA 2FEMA 2PSHA 1QYVA 3L84A 4BO3A 5JSQA 3AR4A 4EK9A 1H6BA 2JKYA 1BVYF 1TM7E 4XDYA 4MROA 5HIKA 1R8JA 2V7QD 3BFKA 3C7KA 1Y6GA 3FMGA 1MG0A 3LBFA 3PEEA 4OQDA 4GLFA 3GRUA 1VCOA 4RPLA 1V2GA 2ZUWA 4K28A 2OC9A 3G9XA 3QXCA 4PBSA 2IH4A 3ZXIA 1LWOA 1P2UA 4DQXA 5J2UB 3G8DA 3T3HA 4BGVA 2BLNA 1ECGA 1G66A 2LPMA 2ZJ2A 3AF0A 3WK7A 4G0UA 1CUYA 1GY8A 3ZC3A 3EASA 4LTMA 2QMUA 4GM1A 1FTNA 1JBQA 2AEJA 2QN6A 2QZ9A 1I4LD 3LDAA 3MERA 2EGGA 1U9CA 3D0QA 3IBYA 1EVEA 3ESBA 3THXA 3DWEX 1G3QA 1XEFA 3L79A 5ELXA 2QLMA 4GPIB 1L8QA 1LPNA 3G49A 4JD5A 1KQNA 1IY1A 1T43A 2Y66A 3GXBA 5J3JA 5B7QA 5AJHA 3D54D 5EMMA 4ZOLB 3SS9X 2R85A 3BJZA 5TS3A 3NHZA 2XUZA 5B64A 2D1SA 3SLGA 1WXGA 3DNMA 2YW2A 2WOJA 3M7IA 5LZ5A 1BHQ1 4GLBA 4D42A 2W37A 1ACJA 4BVHA 2FEOA 3K7EA 5KCMA 1QH9A 2I5PO 4YP9A 2BHRA 2NUBA 2YY7A 1Q1NA 3QE2A 4IMPA 4IGEA 1D9XA 3MGKA 4IJQA 2YVAA 1ZMBA 4C4XA 2D8MA 5JSYA 2Y77A 3CR3C 4KPEC 5KYXB 4RVOA 5EGNA 4YAKA 4QG7A 3KKQA 1H2YA 3N5CA 3EG9B 5J59A 2FOXA 2JJYA 2TMYA 4UXHA 4P22A 2JATA 4ZI7A 1D1QA 2UZ1B 1KEPA 3B6EA 2OXEA 1JF8A 1W35A 3PYMA 1WF6A 4P4TA 3GAAA 1SHUX 4N65A 5ILQA 2RC5A 3HXQA 4UJ3A 2VWPA 2B82A 3HBFA 3I04M 4LHZA 5BWCA 4I4TF 1M5RA 4RD0A 4RH3A 2JIMA 3LLSA 5CNKA 3PK0A 4XLLA 1RWVA 2IF2A 2PT7A 3PR1A 3Q15C 2BD0A 4ZJZA 4EF5A 3BMOA 2VQDA 1PQUA 2NP6A 2YX1A 2HOQA 4H7HA 1EGMB 4R9NA 3ADBA 1MOQA 5CNJA 4IIHA 5CBKA 2Q6LA 1WZ2A 1TKCA 3A1NA 4OHMA 3UB2A 4UQOA 4MAMA 1ECPA 3G9TA 2KHZA 3H84A 4S1OA 4ZRNA 3H5NA 3ZHSA 2KS6A 2BP7B 2W4IA 3ZY3A 1Y6QA 3GJ7A 2DWPA 4TTIA 5IVDA 3DCIA 1UMCA 3E18A 3FMIA 3MS4A 3WAKA 2CLOB 3B7GA 3LQ2A 3R8FA 2MIIA 1U9IA 4Y2HA 3RF7A 3ZE1B 4REQA 2MCFA 2PFSA 2FZ5A 2CD7A 3RS9A 3FHTA 4NFLA 4DCVA 1CW2B 4EG3A 2GPAA 3BE8A 4CIXA 2EYQA 5K09A 2WA1A 3TS1A 3PLAE 3OO0A 4A8JA 4PLPA 4Z7JA 2O2XA 3GGDA 1PR3A 4DT1A 3K2IA 4XIGS 1K06A 1OLXA 2O4CA 1D8AA 3O3NB 4MWEA 1A71A 1O96B 2A33A 4FFNA 4R2HA 1J39A 2ARKA 1ZM3A 2FJ0A 3WC4A 1D1TA 1SBCA 1EXDA 2O8CA 4EBBA 3DZJA 2RH8A 2GETA 4TKUB 5JDIA 1R0LA 4IQ4A 3SQWA 1JHOA 1TMOA 2WLSA 2VPZA 1DIGA 1KGDA 1NUTA 4YMLA 4DB2A 3VTAA 3M9LA 3FTCA 5EIFA 3HU2A 2X15A 1QDLB 1EFHA 1OXBB 1AKWA 1T8YA 2W71A 4OHPA 5LBTA 4BO8A 4F38A 5BUZA 2R1VA 5LMCA 2FMIA 2QL5A 3PSAA 3AM4A 4ZQGA 4ZEVA 1IG3A 5GVRA 4CUJA 2X1VA 3DR3A 4EF4A 2HCFA 1EFKA 1WABA 2Q41A 4QT4A 5JVDA 1J42A 3IEIA 2QQEA 3TIFA 2G5TA 3CURA 3QITA 4UBNA 4R41A 3GEPA 4B46A 1K7CA 1RDFA 1CUGA 1ZD1A 3BT7A 4J16C 5H4GA 2P5TB 4FMCB 4EYQA 4URVR 1E1LA 1P7VA 4K9DA 3ZEAA 1PR2A 4EI9A 3PD0A 2JHCA 2I1QA 1RZ3A 1XPJA 4X94A 1VSVA 1T3HA 3MTQA 4YMGA 5LZ4A 2QRHA 3H7AA 3V34A 4DLSA 1XTKA 4EOGA 1PZXA 2A3RA 1LQ2A 2F3RA 2P8SA 3OOYA 2JJMA 1IIBA 4YAFA 1IMOA 3IAS1 2O52A 3FN4A 4GI1A 1E8MA 4HDKA 3UOGA 3HI4A 1VL8A 3X2EA 3DEAA 2HSJA 3AXTA 4OIFA 2A94A 3OKFA 3O83A 4Y9UA 4N47A 2RAFA 2PKWA 4RGYA 2QYSA 3DPSA 3K71B 3P19A 1B6GA 2EBFX 1I4DD 3TEFA 1WB9A 2IWRA 4H0NA 3IODA 3AM3A 5CD9A 2RGEA 1EAYA 1RYZA 1X70A 2HRBA 2PY6A 4R1PA 3V6LA 3ZGLA 4BLUA 1P5FA 2H57A 1I7QB 4X65B 2O06A 2PGOA 1BGXT 4MDEA 2O8FA 1OWLA 1T2CA 1K3TA 1M6NA 1NF8A 3GD5A 1WEKA 1DPFA 3ABZA 3NIDB 3L1KA 4TRNA 2OVBA 4G9GA 2EF1A 4JJIA 2C7RA 2PZJA 1KA9H 2RSLA 4D6PA 1E7RA 5F35A 4JL5A 5FQOA 5KWIA 3TF5A 3OIVA 3T5DA 1YV9A 4D4IA 1ISPA 4BTLA 4DMMA 2YJGA 4UHFA 1SNYA 2QXUA 1T4DA 3S55A 4KQGA 1HUQA 2XNJA 3UJ7A 3UW3A 1MO3A 4MUJA 2YWRA 2UXCB 5DGHA 3LIPA 5C51B 1K63A 4AQDA 5BV2P 2OCPA 3AF6A 1SVNA 5FO1A 5FLKA 1OKKA 3EMBA 4Z1OA 4XSHA 3TGWA 4R9RA 1Q1BA 3V8PA 1RZUA 1RP7A 2JKVA 3UKDA 2O23A 4QM6A 2ZR9A 2AFIA 3G5TA 3PUVA 4P80A 3R7WB 2E4UA 3VC3A 1IN4A 4INPA 4OQFA 1RLJA 5K3CA 2BEKA 2Q4BA 3KT8A 1PTJC 4WTOA 3W04A 1XMQB 2XEDA 2WICA 3AFMA 1DE0A 2QQFA 2BCEA 4HAWA 3PHBE 1V47A 4IJWA 3T38A 5A9RA 3F5QA 2A59A 2AQ8A 3NGLA 3NNSA 3WQQA 2CE2X 1NR1A 2GDZA 2AV6A 3L7IA 4D9HA 1RC8A 2Q29A 3EXG2 4YCCA 3H6GA 3PHGA 3EVEA 1W87A 1D7AA 1SCDA 3SC3A 2IH5A 4G8JA 3BK1A 4F84A 4FGUA 4Q4LA 3WWOA 4DDUA 1C8LA 2ATCA 3SVLA 3ZUGA 2WDPA 1KIAA 4XYGA 4MDFA 4I55B 3V46A 2KQUA 1QIHA 2P9QA 4Q6WA 3F9CA 3AI1A 4TMXA 2DY0A 4YQZA 5P21A 4X1OA 4U00A 1DAMA 2LDBA 1U0EA 3BE6A 3M70A 4K8RB 4WT7A 3TOXA 3W3AD 2I8AA 2V1XA 4OA8A 4CQJA 3UH0A 2G83A 2G0AA 3GROA 1KOJA 1VRVA 4BQOA 1PGPA 2VJMA 2WJ3A 4LY0A 3BORA 2RB4A 5CA0F 1TRHA 4MVJM 4L6CA 2GKOA 2H9IA 2WU1A 3DKPA 4ER0A 5ICEA 5CX4A 3SOPA 2PUDA 1Z26A 3EW9A 3DD1A 2PUBA 3U39A 2CXPA 3H75A 5LA6B 4IHAA 1O96A 1O54A 2WM9B 3GLHA 5KTTA 1QORA 1A76A 1G9TA 3EXFB 1F38A 4JLUA 4YEDA 2X4IA 4KJZA 1SXJA 4I46A 3PKJA 4O08A 5A6SB 3NP7A 3U7IA 3BL5A 5BNWA 2Q5FA 1Y6JA 1YH3A 2ZJ1A 3AVPA 4ZQHA 2HN9A 3REGA 1VE9A 4AJ9A 3KZKA 3UM9A 1BKDR 4LJLA 5CCEA 4F5EA 1WZCA 4D5GA 2X2EA 9LDBA 4F46A 4D99A 3GDFA 4BWVA 1COWA 4S0ZA 4DZTA 4GVPA 3VTKA 2CSUA 3DFIA 2EJUA 4GPAA 2BFMA 1A9ZA 2H3HA 4WD3A 2OFOA 4AJOA 4UHHA 3ZJYA 1QG0A 1KSHA 4AF8A 4JR0A 5HUQA 5J4LA 1FQWA 5KJ6A 1J8VA 1K5HA 1Z08A 3HYTA 3PQCA 2ZE5A 3WYFA 2B4KA 4N3CA 2WT4A 3KD3A 4WN3A 3JQAA 3D6JA 4Q3BA 1Q7GA 2ZUCA 3CBGA 3HCEA 5G2OA 1B00A 1Q6ZA 1X1AA 2BE7A 2AIRA 1X87A 2V9PA 2GVDC 2NQTA 2P8JA 1EVZA 3AV0B 5LDGA 4XX0B 4YMHA 3FAKA 4E1AA 2H31A 3Q3CA 5EJ9A 4W9MC 1NFRA 2INGX 3T5MA 1BXZA 4LC0A 1Y4ZA 2EJTA 2Q4EA 5KSPA 1N2CA 1ZC4A 4MGIR 3H17A 2XUOA 1RE1A 4Q3AA 2HMYB 1L5NA 1CWUA 2B4QA 3MJTA 4UDOA 1SA0B 4MUIA 4XCXA 4R0VA 3GMIA 3NHFA 4MUKA 2YWXA 4L15A 1EDBA 1RJWA 5A4MS 4RIEA 3SFZA 4D0NA 4M22A 2X6QA 1UWVA 2ADMA 5CLIA 2WWFA 3DWGA 1U3UA 4B75A 4BHTA 3C5EA 2ZJYA 5I7RA 3Q0IA 4EYOA 5CRIA 4CM1A 4RTPA 1XLWA 3KDSE 1M74A 1V1JA 4CG3A 3CEHA 1F8YA 2GEKA 4OLJA 4I1YA 4C3OB 1KVRA 2PVPA 5J4HA 1A4XA 2AFRA 2JA1A 4B84A 1JB1A 1NM5A 1TQ4A 1XMIA 2C20A 1H85A 2ZJ5A 3FNRA 3KWFA 4ZCPA 3GJRA 3S6JA 3SS8A 3ZKAA 1WD7A 1I2MA 3LKZA 3PC4A 4BWGA 1F20A 4YRBA 3NC0C 1W30A 4H3SA 5JRJA 1MVOA 3QKSB 3LPCA 4W7IA 3PTLA 4HG2A 5FV7A 2ZS9A 3OOHA 5LD2C 3T9FA 1JDVA 4ATNA 4MB0A 4WLVA 4GXNA 1O77A 2ZDQA 4KN9S 4PE5B 4L22A 5TB5A 1BDJA 1P0MA 3VZSA 3C3EA 1LSOA 3M6LA 4Y2SA 2LCQA 5IC6A 1TVCA 2ET6A 4R1QA 1W5TA 1ZVMA 4CHGA 5K0JA 1WMSA 1BHSA 3C3AA 1MGOA 1R5BA 1AD2A 3BK7A 2RHLA 1F8XA 1G2PA 3R3XA 2DCUA 1NUAA 4NXMB 1OGJA 4BB5A 1IEQA 3MEQA 1A97A 4EEKA 4CU2A 1RAFA 4OYHA 5KTNA 2ID8A 2ATEA 1UZAA 4XTCS 1MZVA 2C77A 1VOTA 5AXCA 4IIVA 4BQPA 4DUGD 4JI7B 4KW7A 1N2GA 1MO4A 1V5IA 2FW7A 3AB7A 3EDCA 1PQ4A 1YASA 3MD9A 1MCZA 4LDPA 3N8HA 4AS2A 4EITA 1Q7RA 1EWTA 1THMA 2V65A 2IY9A 4BLVA 4C4PA 1QZZA 3O91A 5KU1A 1DKLA 3DZGA 1I94B 1SQ6A 3EFHA 3O8DA 4UTZA 1H2ZA 1XA0A 4JENA 1FOEB 6AT1A 1E64A 4X90A 4G4GA 1V5WA 3BRCA 3ANNA 2FG7C 3G2IA 2XZTA 4ZRMA 1CR4A 1JPUA 2ZAOA 3I3SR 4L08A 1YK1A 4GG1A 3OLWA 2PU7A 4R8RA 1JG7A 4Y2JA 3A70A 5F9MA 2CBXA 2HD4A 5H68A 5C5CA 1SD2A 1MRZA 4AY3A 4CL2A 4L51A 1CQZA 2FQQA 2NNLD 1BFUA 1SUPA 4C7MA 3KXLA 4XWAA 3WHKA 1WCWA 2HLDA 4WY5A 1Y9JA 3KTFA 2ZIEA 1W25A 3PQ5A 1L7OA 1RT9A 4ODIA 5J5CA 3QPDA 2GCIA 2OCGA 5EE9A 1U8ZA 1RTTA 4WINA 5ETJA 5F64A 1J5PA 1OI7A 3VKGA 4NPHA 1J24A 2V55B 3WWEA 3H2SA 3KXKA 1K4KA 3O74A 4EUKA 5KTYA 4J3JA 2CEAA 2OCIA 5KSOA 1BU5A 4ZN6A 3SICE 1T5TA 1R66A 2W58A 3DL7A 3IP5A 3UJHA 5IDXA 3R6DA 4QUGA 4QVIA 3PUJA 4ZO8A 3K5PA 5JNRA 5DYIA 4FCWA 4LOJA 3X1DA 4ZAGA 2Z8YA 1SQ5A 4QPJC 3NATA 4R1NA 3MCAA 2V9ZA 1B8NA 1UBTS 2HTEA 3HVUA 2WLTA 3ORHA 3LCRA 1DI0A 1A7JA 3VHXA 3UICA 1YQGA 5C37A 1K7EB 5CHEA 2OKGA 4UE3S 1LK5A 3FD8A 3OQBA 1NYTA 3RGGA 2XXAA 1RXYA 2C3PA 2Q7XA 4MWTA 4V0NA 4Y9DA 1DAFA 2XR1A 1C9EA 3UJAA 4EO4A 13PKA 4ZAYA 3HKEA 5E6RB 2AI1A 2IVZA 3DBLB 4NRDA 4J0GA 2BUCA 4S1PA 4X60A 4YO7A 3N2KA 3J7TA 4IQFA 3LFHA 2OC4A 3H9UA 1Q2XA 2YYZA 5DWQA 2XMDA 2Z4SA 1GUBA 3U26A 4L3OA 1GPUA 2HMWA 2WMYA 1KNQA 2NYUA 1CFZA 1OC4A 1WB6A 2JZNA 1TAUA 3CXRA 1GPBA 1RAIA 4QJ5A 2WD9A 2K4MA 5TXGA 4GBGA 5CYGA 1JR4A 1ST3A 3EC2A 4E11A 5E1MA 1EVQA 4N6GA 4CYMA 2F43A 1J99A 2C0PA 2GLUA 3PWSA 3TTYA 2PAFA 4C7VA 4FKMA 4NS4A 1TVKA 2NTNA 4D5EA 3FZGA 1LA2A 1PEDA 1YR8A 2F7SA 3LAWA 4J94A 3T4XA 3J7AC 3CRMA 2TMKA 2EW8A 3ZYCA 1JQ5A 5C4GB 4B09A 4MITA 4GS5A 1PVDA 2W6NA 4HQOA 5AXBA 4EYSA 2C7PA 4IXMA 1E3WA 4XR9A 2PUHA 2UXDB 4G5XA 2GO1A 5ERYA 5LJLA 3F9RA 1DC3A 4RXUA 4P93A 4DA6A 2OOKA 4OXYA 2AN3A 2X5KO 3DAYA 1XJ5A 4MQLA 1HTWA 1ZOPA 2ZSFA 4DOMA 3C74A 1NVMB 1FQKA 2JVKA 5IAOA 2OILA 2C3OA 3SQXA 4BKOA 1E5TA 3PWZA 3B52X 3NEPX 1CJBA 1G5FA 4E2WA 3NKVA 1U3WA 5CDFA 1XDBA 1GTSA 4ZJPA 1SUAA 4BFUA 4I4IA 4K2HA 2VPYA 1XCLA 4YDHB 2XVYA 2N3ZA 3BXPA 1M2FA 3PDCA 2J59A 4QBGB 1N0VC 3WJAA 3HNOA 4L85A 2FFAA 2QG4A 3EAQA 3OMXA 4J1TA 2BC9A 4QHSA 3DMPA 5FOUA 3ZDZB 1E9BA 4CGYA 4TQGA 1WPGA 5HOEA 1FSZA 3ZD6A 5AUPB 1YDHA 4R4JA 4JLBA 1JG2A 1JLMA 3AUYA 1T0IA 2D5AA 1NOJA 2V3VA 2Q3JA 3CPSA 2D59A 2QEQA 2PQMA 3E84A 1CNFA 1Z7YA 3AG5A 1CSEE 3MQ4A 3OZBA 4YMTA 3OX2A 2BYTA 1R27A 4XAQA 5C8VA 2R6CA 1FPQA 1KY3A 2XTAA 3HKCB 4TMKA 3HBAA 3Q9NA 5JJCA 3QVWA 1Q14A 1N2IA 4PPFA 1U8FO 4JS0A 3MGBA 2OPHA 3FYUA 4YUXA 1NUUA 1QZTA 1UADA 2P69A 2GX6A 3CN7A 4M0FA 1NQ5A 4W99A 1QHSA 3AVVA 2R11A 5JHHB 1ZHOA 3LW7A 1RXVA 1SBYA 1HLFA 2A1UB 5AUNB 4CMBA 2GFHA 1I5RA 3WWPA 3GLQA 5JBIA 3WDLA 1R4NA 4RVGA 5CM8B 2BFDA 1PE0A 2QX4A 4PQFA 3CMMA 1T5BA 3DC7A 1XRPA 3STWA 3DC2A 3L8CA 3WKEA 2B7LA 3OPYA 3UHJA 4WZAB 4JUDX 4ZK6A 3HCFA 1QB7A 1B0ZA 1QR2A 2EFDB 4OAOA 3TSZA 3PIIA 4DMKA 1L4UA 4ZTBA 3HKBB 3E9RA 1L0BA 3P71T 3AH8A 3PDIA 4PZLA 4EG1A 3HL0A 3C6KA 3I6IA 1XZNA 1DAIA 1NLUA 3CHYA 5DF1A 3IH5A 1ORVA 2K2QB 1C7IA 1HFJA 2Q2OA 1P81A 3OE1A 2B1QA 1N2EA 3DDSA 3T1YB 1KQOA 4Z99A 2A2ZA 1VHWA 5HF8A 2PGDA 1C1XA 4Q7JB 3NWPA 3RASA 4V0ME 1WHSB 2HUNA 1MC4A 3WKDA 4BO2A 3V7NA 1Y81A 3K4HA 2AJBA 4IXTA 1N4DA 2QVBA 4UPVA 2VLBA 3ZS9A 2CXHA 2AN4A 3FY4A 2X9LA 3CM0A 3GEIA 4Y2RA 3TKLA 4G6ZA 5DNAA 4WXPA 1VJDA 2PUGA 3L8HA 2VBCA 4M9SA 1W4CA 3IDQA 3QMPA 4US2R 1MHTA 1IHXA 1KJ9A 3AP3A 1FU4A 4JJ4A 3QWHA 3P9PA 3IQXA 4CTKA 3IT1A 5IJWA 3IHWA 1RYFA 3OJCA 3HS3A 1WXIA 3RFVA 4PCUA 4YRTA 2HPZA 3EAFA 2NVOA 1EE2A 2ZB4A 1L4FA 3PC8A 1X92A 3SIXA 3ESRA 1AB5A 4IS2A 3RFTA 3RTCA 5HJEA 4BO4A 5LZ9A 4QTUB 1MIOA 3MYRA 2OWDA 1O95D 4L76A 1JJFA 1JLKA 2H4JA 4ZHQF 1KOGA 3DTNA 5DK4A 1JA0A 3PTAA 2VP0A 4W5NA 2CL0X 3I1YA 2XODA 2M1XA 5HZKA 1VL5A 4IWNA 4KN5A 4D41A 3NMUF 2HQSA 2VDVE 1DPGA 3O8QB 4RJLA 5LU9A 1ZAKA 4LXYA 3CZ5A 1VECA 1WUIS 1E3WB 1GKUB 4C30A 4EY4A 2QG6A 2YHUA 5DNEA 2XOXA 1DTSA 1WUTA 5FORA 2VA9A 1MB2A 1IM2A 1P7CA 3FKQA 3A2LA 3JQ9C 3N75A 2W00A 4MEJA 4KBGA 4NTZA 3TZQA 3UJDA 5AK3A 3TZEA 4L2IA 1YVPA 3NTXA 5IAEA 2RAPA 3CX6A 4LK3A 2FQYA 1LPSA 1YULA 4BGEA 3IEMA 1EQ2A 4DCSA 1UBMS 2BKVA 1QG4A 2AMYA 2J7KA 4PLFA 4O4HB 4X7PA 3ABOB 4D57A 2DEUA 5DHTA 1CNEA 5G53C 1J2TA 1KZ9A 1SELA 1TIPA 4B4VA 4EB6A 3VH2A 3QW4B 5AT1A 4UCFA 4NX2A 2VCYA 2A86A 4MDHA 4IXNA 4KXFB 4OFXA 1NXQA 2R6R1 3D4NA 4JC0A 1QHYA 3D3NA 1AZSC 2P68A 3I2IA 5BNIA 4EG8A 4UBKA 1CVIA 1JJ7A 2NTJA 4BX8A 4TGLA 1XXHA 3GJ5A 5SZHB 4IGFA 1UEXC 5JVDF 4PLZA 4DR7B 1R5JA 2HIMA 5CDYA 4EW6A 4GNKA 2XECA 4Y98A 3U1VA 1K7FB 2ECPA 2X14A 2FEWB 3IJ5A 2AMLA 3MTGA 3N53A 1T9ZA 1EVJA 5AIAA 3AO0B 4OBBA 2K7FA 2PXXA 1QIDA 1ELOA 3VR0A 5B37A 1X74A 2G7ZA 1FEZA 1PEYA 1GPLA 2P5YA 2JAOA 2YXPX 5FXMA 3Q3GE 1C29B 4KR6A 3HDVA 4X8HA 2BTQA 2BMDA 1EIWA 2GS9A 4EKEA 1BH6A 1KTVA 5IKOA 2Z2XA 3WGZA 2FPSA 2MSKA 4LOAA 3U3OA 1R9MA 4TL9A 2GN6A 2I2DA 2O5RA 1A3CA 1T10A 4A9AA 1GFWA 1IJEA 4PGMA 1JBKA 4IW3B 1U65A 4TYMA 2Z6QA 1BS1A 3QMVA 3DEKA 2A0KA 2R6DA 3OPYB 2QOEA 4RFVA 4C3VA 1X7YB 4NG4A 2X7XA 2Y0BA 3W3ZB 3WIDA 5MGNA 3Q10A 3A6JA 3N0WA 4L3VA 4AP9A 3N6XA 4HYEA 4MIKA 4GZ3A 1LBIA 1M1ZA 1YVUA 1T1JA 1EK5A 4F5WA 3E8XA 1EFUA 3I2JA 5FI0B 3C6QA 5FRDA 2VUSA 1QX4A 2XKJE 4Q1DA 1PHRA 3VPGA 4I1RA 2GZRA 5JSKA 4JVOA 1EZ1A 4II7A 3W6ZA 1PYGA 3GOHA 3NNDA 3GFRA 4NNPA 1ZZGA 2PM8A 4YI5A 4FFMA 4TMZA 2J4FA 3OQIB 3ESXA 1KOFA 5TF0A 1M2EA 5AJYA 4C2TA 2VSQA 4ITVA 3EEQA 1S8NA 2P9JA 2PGXA 2OCKA 2YTZA 3QM1A 1MNAA 4Q00A 3WV4A 3LNCA 5LZ2A 3Q3VA 4TL6A 2IKSA 2NAPA 2W2PA 3CKMA 4HX5A 1K5GA 2XDWA 4LBWA 5HRUA 4IF6A 4FEAA 3U16A 5BVHA 2XMBA 4WJZA 4HB4A 4DZZA 3T5AA 1K6IA 3BTVA 3IKTA 2XDAA 3LL7A 4ZGGA 4C03A 2XVMA 1KH2A 2XYPA 1TQHA 1BMDA 2OAEA 3H0CA 4HK4A 4CKWA 4BGUA 3RI3A 4YIHA 2X9QA 4LMRA 1IIRA 3QUQA 3B8EA 3ROQA 4O4HF 3O5AA 4BEWA 2ONJA 3W8EA 1VHDA 1G5HA 1NLZA 3I9V6 4IHQA 2GM9A 5CUQA 4YJDA 3WGYA 2VUIB 2XUFA 2Y68A 2NTEA 3K0HA 8LDHA 1ULTA 3NM4A 2ZRFA 4Q3KA 4EEXA 3LO5A 3WGJA 1RFLA 1LDNA 4PLGA 5B3LA 2JGKA 2PR2A 1IVNA 1P4JA 2X3UA 3CXUA 2RHWA 2IXEA 1N5MA 1X7ZA 2WWYA 2GKGA 3KHKA 3ADOA 3NYRA 5FI3A 3S1AA 1S4QA 3EDYA 2X41A 5ED0A 3SC4A 1DINA 3RSLA 1JQ3A 3HFGA 4JBXA 2E3JA 3AI2A 3ID6C 3X1MA 2FLKA 2NSDA 3DA8A 3NTVA 3HY4A 3PRKE 4P38A 1T8SA 4NNOA 5BSUA 3T9BA 5CFNA 3IPRA 3DHWC 3NBMA 4UBIA 1VJCA 3QE0A 5K0FA 3O8QA 3ER9A 3R7WA 2BIFA 3AF1A 3Q0EA 3COVA 2WJGA 3CR8A 4JJZA 3C3YA 3PFKA 2OZPA 3I1IA 4FHEA 4RY8A 3U3DA 2A9PA 4D26A 1DKNA 1PL0A 3L6RA 1USGA 1ADGA 5HZGA 1RQRA 1MW8X 2O8FB 1OWOA 1XQ1A 4U7PB 1W5SA 1H2XA 1ZS9A 3NFYA 4Q93A 9MHTA 3TSAA 1U7OA 1Y42X 2G67A 4DPLA 1SKBA 1IOVA 2ZK7A 4CR7A 2JEOA 5BV1A 2H11A 5BN1A 4XJSA 1VPWA 4EA9A 5G02A 1RBYA 2E9SA 1TZ2A 3HFRA 4WY2A 2W42A 1M3SA 4GZLA 4F85A 1DBSA 2WM3A 2OHGA 2I2CA 1I0LA 3NBFA 3PX7A 1P6UA 3MJ4A 5IAJA 4EG4A 3KEOA 3C15C 3LVBA 1VLQA 1TKBA 4I7EA 3ZNNA 2H4FA 4U3JA 2FHPA 5IEBA 3BHIA 1ADJA 3TAHA 1VLJA 3FPLA 4PVCA 3EBLA 4D92A 4FMDB 2YY5A 4H0CA 4JQYA 1Y8QB 1I7SB 3DLCA 4OHXA 3O1JC 3UWMA 1UKEA 3HKDB 2J30A 1CJCA 1HK7A 3KG2A 5I7SA 1H2HA 1OH6A 2WA2A 4Q18A 1EYZA 4FR5A 4OHUA 2NUTB 1VP9A 2XA9A 3NHUA 4PX3A 4RWEA 2GD2A 1JH9A 5A0TA 3A10A 3P2IA 4B7ZA 3JQ6A 1NXOA 3ECAA 2FZLA 3VISA 5DGXA 3H1TA 5ULLA 3VH1A 1JTFA 2A9VA 3ESAA 4FOTA 2R0QC 2QTLA 3PNMA 5KVAA 3P5SA 3ZX4A 1LFAA 1VFPA 2ZI5A 1RHUA 4LJSA 3L01A 1XEXA 4EJ2A 3IALA 4ZMRA 4LXQA 2VTKA 2WUWE 2JGNA 1CR2A 4ROSA 3J80A 1IWOA 4AG3A 4YV0A 3DAOA 2GPWA 2C96A 3NHKA 4CN9A 1YIOA 2VUUA 3EZ6A 1RQ7A 1Z3IX 2EATA 1X7YA 4PBTA 4E5NA 3WGTA 3ZDCA 1EXNA 1LY1A 4RK5A 3K0FB 1EH5A 5AJTA 1GZ7A 1WUHS 5FL3A 1ISFA 1T3SA 1CR0A 3FPHA 3LA8A 1C7JA 4Q34A 5C4MA 2ZVQX 5C52B 3G02A 1J8DA 3OEYA 2CK3A 1TZMA 4KUHA 4HFMA 3RVDA 2QSZA 4K86A 3WKCA 3OURA 4DDHA 4GW3A 2PSFA 4JYMA 1VHQA 3U62A 3S4YA 1GGHA 1I6WA 4GSLA 5JS1A 2C0CA 3I73A 2J08A 5T6BA 5I9LA 4KAXA 4QL3A 5EJ8A 2WR8A 4WEQA 4YRFA 3AR5A 1QP0A 1AF7A 2JFHA 3K1AA 4KO1S 1ZSVA 5ES4B 3AL0C 1B8VA 1A04A 3GYGA 2QTZA 1MX3A 2ECFA 1DG3A 1Z4PX 1CYDA 1E1QD 3FHJA 3VMMA 4ETNA 2YMMA 5KAMA 1ADFA 2AD5A 5F7ZA 3U7FB 3NIGB 2G63A 3S2IA 1E9FA 2EEZA 4V0SA 5AW0A 4IMRA 1OYYA 5G4KA 3M1YA 4G1EB 1TB4A 4FWBA 4G0PA 1XQWA 3B89A 3QFCA 4J0KA 1AGPA 2DP4E 3GQBB 2I99A 3IDZA 4OO3A 5FNVA 4D8TA 2PXAA 4YT2A 2IA5A 2YMQA 4Q3EA 4Q1AA 3F8TA 3NX4A 4AKSA 5I45A 3FFBA 2BFWA 1XD8A 4I9NA 1A4RA 2OV6A 1PZFA 3IVGA 4QO7A 5DN6A 2WIGA 3ZIAA 1B0UA 5DZSA 2HNKA 4U7HA 3VPBA 4P0QB 4EMBA 3CLRC 3DV0A 1NFFA 4GD3Q 4RJ2A 3WMFA 1Y6FA 3P9SA 1MJGA 3SHTA 1F0PA 3RSFA 1E9CA 2BZ0A 4H4EA 4O2LA 1U2DC 3I2FA 3UUGA 2MMGA 3QEOA 3NRJA 4NV1A 4PTYA 5CEJA 4HWGA 4KMMA 1XTTA 5FTWA 5K4GA 4MMZB 5BOVA 4YP1A 3SLRA 1L6RA 1ZNZA 3FHCB 2NXEA 5FPKA 1NBOA 2P2NA 3IKJA 3ND6A 4V0OA 4FKBA 1IAQA 5JLAA 4J9VA 4PO1A 1B42A 4KXXA 1TM1E 1Y4DE 3K6KA 5E6UB 4GE0A 4N03A 4JI0B 1F51E 2R7LA 2OSBA 5D86A 5IW8A 5KTRA 1NVWQ 4IUDS 4G0WA 1N7IA 2Q6VA 5EJEA 4QHYA 4QGAA 4UUNA 3O1LA 4KPUB 4YRZA 3ENKA 3C24A 2C61A 4QRHA 4LECA 3A4LA 1J0AA 5KOIA 1VTKA 3LDGA 1W8DA 3DAFA 3HCRA 1GAEO 1OFIA 3T7DA 3KQKA 5DK6A 5CA1F 2GWHA 4W7HA 2IU3A 3HZRA 4QGFA 2CF5A 2JLBA 3C16C 3R6TA 2DULA 2H4WA 3MMSA 4QYIA 1SU7A 4RXMA 4YJ3A 5FV4A 4A8TA 4LFBB 5BORA 5K0SA 4M99A 3DMHA 1ACLA 3DGFC 5LA6F 3V1UA 2IZ0A 4PPNA 2QJWA 4HB3A 2CLKB 4R81A 1LPOA 1WO8A 3V32A 1PGQA 3QPBA 1GDTA 2ROQA 1JG6A 1U0BB 3OFND 3PEFA 1YZNA 3U0BA 4BMSA 1CXZA 5FAXA 3UXEA 2ORYA 1WUYA 3ET4A 5BQXA 5KBYA 1XNRB 1I7PA 3OJLA 3IL2A 1TTPB 3TL6A 2IYOA 4KV7A 3IEVA 4OH1A 3FVQA 1U63A 2FG6C 3D1LA 4LNHA 3GG9A 5K03A 2RHHA 1KR2A 4HJRA 5HCIA 4QNMA 5DM2A 1PJ4A 4XR4A 1JHQA 4AO8A 2UYOA 3O8OB 2QM7A 4TV9F 1J7JA 2QYHA 2VPXA 2QW0X 2HLPA 1H8HA 3TI7A 3UTCA 4L4XA 4F04A 4D8YA 1MAAA 4MYDA 1ULHA 3CX3A 3GZNA 3PEYA 1RBMA 4PYNA 4DLXA 2CC2A 3QEAZ 3CRW1 3S2ZA 1ZK0A 1H22A 2COEA 1XFAA 3NONA 5G3ZA 4Q21A 3U3KA 3W6OA 1Q74A 1UDXA 3GFBA 1P7PA 3WFIA 4ZDIA 3U5ZB 1OJLA 1RJDA 2I3AA 3AP2A 3OQJA 3VNQA 4MARA 3A8TA 3NYIA 4IHJB 3R5XA 2QD3A 1A50B 4LHSA 4BJ3A 1W36D 1PSZA 4BU0A 2VHZA 2B69A 4K05A 4YUWA 1O8BA 5JXJA 3HV0A 1CJTC 1DRUA 1NRIA 4B3FX 1CHNA 1IHYA 3BGDA 1HY3A 4DV0B 2P1RA 2Z5VA 1TIKA 3BCHA 3MLAA 1P5HA 2PKYX 3PEWA 3K70B 1UJ4A 2OQRA 1HQDA 3QE4A 4LRYA 4ARZA 2ERXA 2I71A 3JWJA 3H86A 2VHEA 4NBWA 4XEHA 3C8DA 4YJ2B 1J2EA 1OT3A 1Q17A 3FG9A 4MJLA 1VL2A 1T26A 3RIMA 3HN6A 1HGXA 3CLSD 4E0BA 2AOTA 4KRFA 3STYA 2D5BA 1UMBB 3DTTA 3WZMA 1A69A 4ZHQA 3OCYA 2DVMA 4HAIA 3BD9A 3E9MA 4ZVTA 5F1KA 4XGNA 4MCIA 5DNVA 5G41A 2J31A 1E0JA 5EP3A 5IUNC 3U1TA 1Z8HA 3JU3A 4YLEA 3ZY4A 4Q39A 4LZAA 2VS1A 4PTLA 1RLTA 4LI3X 4F1JA 2CY0A 3B2EA 3KJHA 1NXTA 1X6VA 2BDUA 1OZAA 3VJMA 5KNDD 2VP9A 1JMYA 3AUUA 3CNHA 3R4CA 3DZKA 3SXUB 2P3QA 2SICE 4RF5A 4CGZA 1T15A 2A9FA 4QFDA 4QFCA 2NV2B 4PV7A 1QE3A 2CDAA 4I9FA 4ME6A 5SYNA 3Q8WA 3PXEA 3URKA 3HP4A 2FFRA 1MZPA 4C43A 4FEYA 3V9AA 2RGCA 5BR8B 4IP0A 3M3HA 3ZJUA 2F6RA 5EWJB 4DLZA 1T9HA 4NAUA 1I1QB 1FSFA 3EWSA 4DSAA 3A3YA 1ATZA 1ADYA 1E4VA 3JD4A 3MINB 1I30A 4JR2A 1I13A 1FBTA 1D07A 2NO7A 3F7MA 2ACWA 3NB0A 4D9NA 4R5HA 5IK2A 1T3LA 2N42A 3GFOA 1TVKB 2WUDA 3I28A 2R48A 1MHPA 1Z83A 2QR3A 1SOWA 2C9OA 4IXDA 4P7FA 2D7DA 2C2KA 3Q88A 1E2UA 2PIAA 3G8BA 3OQVA 3N5KA 3RRNA 3IJRA 3IUEA 3FCYA 3IO5A 3QBVA 1GGMA 1S5PA 3O82A 4ER6A 3KT0A 1SGWA 4GAEA 4Y2XA 1OB2A 2GAOA 4PAWA 4U2CA 3IVAA 1XD2A 2IQ5A 2OXCA 1PFWA 4IFEA 3B8HA 1J2YA 3F47A 1M8GA 3BFVA 1IM8A 2WBLC 1P44A 1Z2PX 2OGTA 2J9GA 3HKCA 3KQWA 3CE9A 3ZHCA 1B26A 3CX7A 4IDPA 4IQ8A 4JNKA 1GG8A 1YR7A 1ENZA 1C1DA 1GA6A 1XBTA 2EHDA 1CUEA 1M2NA 3EISA 3OM1A 3QVJA 3WFJA 4X64B 1EVYA 2YDYA 5EPEA 3RSGA 1N5KA 2FWJA 3GP5A 4WLEA 1M5TA 2EDCA 1H5QA 4Q3DA 2BE9A 1V8DA 4PO8A 1Z2AA 4P6VF 2JARA 3K0CA 1BO6A 2CXSA 1I36A 1PW5A 4BZPA 5SV2A 5C8ZA 5D85A 1GTJ1 4LMAA 3BAFA 3TZCA 3T3GA 1TOAA 2PFKA 5EZQA 5C18A 1U2TA 1UIRA 5IHPA 1A8SA 1PKEA 1SKUA 1P31A 4OL9A 4ESHA 4K88A 4M37A 3T99A 4PXYA 1UDCA 3EOZA 1ZHHA 1ZK2A 3B9RA 4XVHA 3H3XA 4MTCA 2GM4A 2XWPA 2H5EA 1UC8A 2TRSB 2AG1A 4MUNA 3VPDA 1SOMA 1ZOOA 2CEKA 1C8VB 1J1ZA 1CJKC 1R6DA 4AQ7A 3GNSA 3JRWA 4KQ1A 4O4IA 3ZNPA 1C0PA 4UEKA 3O8OA 2A0FA 2NWQA 4RY2A 5GV7A 1AHHA 4PC6A 1N7GA 2HV9A 1YQXA 2KYRA 2QTMA 1L4NA 1QTNA 2Q3DA 3GEMA 4UTVA 1SXPA 2VVTA 2JD2A 1VI5A 2QRLA 3DD5A 3JD0A 3LUAA 4OI4A 1DC7A 4FGSA 1K86A 1NZFA 1DDIA 2XYHA 4FMBB 1XQ9A 1U6KA 3MTDA 4AS3A 3DTYA 2PR7A 1TM2A 2PYZA 3WMWA 3SR0A 2JLQA 5B5SA 1F7UA 1M2KA 1TYZA 1DOHA 4BXOA 4OHYA 2RHMA 4CMEC 4ZVMA 1CE8B 2XUPA 4TSFA 3U49A 1X39A 2BJHA 4BMXA 5CMLA 3E1GA 2KX7A 3PE4A 1V9CA 5ENZA 5DI9A 1P61B 3THRA 2G71A 4FZ3A 2RI1A 3CEMA 3L0PA 1PLKA 3UPDA 3N86A 2NTYC 3O4GA 4C5AA 3T52A 4UMVA 3NEJA 3KU1A 3UATA 2HTFA 1LH0A 1TX4B 4ESEA 1NG9A 5J9FA 3RAEC 3QW2A 1H2FA 3MTIA 5D7BA 1ZGZA 4LF8B 5IH3A 3QSGA 2YYYA 4JQZA 1XVVA 1MFZA 3KVVA 3TO5A 4EHHA 4BQNA 2VCEA 3U17A 1E7YA 1BS2A 4FTWA 1P2TA 3FSGD 1H9BA 4QUHA 2H1OA 5L4LA 5HIJA 3T1OA 3GAZA 4PNEA 1FBNA 1MPXA 1WVMA 1BXGB 1T5IA 2EWWA 2MTBA 1U4NA 5KC9A 4EKDA 5AVQA 2BT4A 2OZLB 4RHCA 1A1SA 1CD5A 3WQBA 3Q8MA 1C9DB 3A3KA 2NYVA 1JQJC 1W4LA 1XQ6A 3LZDA 1GP2A 4A2QA 4XFJA 5H3HA 3S40A 4DR2B 1CR1A 3MCUA 1IJBA 1F1BA 1Z12A 1ZSNA 2G1KA 3MLEA 1OFVA 1EVIA 1VXRA 4KG7A 4OJQA 3Q41A 2VJAA 4WZ6A 5BQ5A 1SCNE 1E6MA 2PT9A 5JD4A 2AR7A 1NU6A 3HRHA 4DDKA 4U7WA 3KUCA 3HBJA 4MP3A 3TMAA 4BMPB 2YINC 3H65A 3WIEA 4AMVA 4D43A 3ZZ0A 2HF9A 1QJ4A 5MFZA 1XZGA 4P08A 2IH2A 4NDZA 1L7BA 1AN9A 1MIOB 4RSGA 4WZAE 3EC7A 5AH0A 3LUCA 3IVXA 1CS0A 5CTJA 1E3IA 4BCCA 2WB4A 3EE6A 1KFEB 2OP1A 1C3OA 2I4NA 2M9MA 3EZ2A 5ERGB 4BWYA 1RC0A 1GUDA 1KJ8A 4WFQA 3OLCX 3F3SA 2WB2A 5KSZA 3OA2A 1G9SA 4OXKA 5B53A 1RPTA 5BSTA 3TPZA 1EDDA 2BM1A 1YL7A 2XUAA 3MMPA 4UATA 3TM5A 3HI6A 3VUFA 4TRJA 5KS2A 4B5LA 2ZTSA 3F4KA 3NI2A 4QUJA 2AHOA 3EA4A 2RMKA 4XSGA 1O2DA 1G5TA 1E2HA 3T3PB 4QUIA 1GL3A 2VK2A 3MRVA 1E6EA 3I39X 3FFAA 4GFDA 4D0SA 5ALQA 2L2QA 4L2IB 4D4KA 3OVMA 1SHKA 4DMCA 4I5GA 3O2JA 2CCGA 1QOQB 4V02A 2QBYA 5AHRA 2TMDA 4ETWA 5EVCA 1RTKA 1T9AA 3AZQA 5J5AA 1T2VA 2E18A 4B2YA 2JJ2D 2NV6A 3ECSA 2RHGB 4M9ZA 5C8YB 1R16A 2W11A 3RYIA 1D04A 3DTVB 3O2QB 1J1UA 2Q5CA 4IINA 4WKCA 1C2YA 2Q4TA 2QTNA 1O4VA 4N0MA 1ID8A 1JXAA 1RSZA 4P54A 4ZCLA 3KUKA 3S8MA 1FFHA 1TJNA 1I5EA 1XZMA 3D6NB 3F1KA 4YMSA 1JVNA 4XB6B 1PT7A 4C6TB 4ZZ2A 3DCNA 3FOBA 3JWPA 4OK5A 1NVUQ 1Z38A 2QK4A 4Z9XA 1MXHA 1EX1A 1Y33E 2OCAA 2PRSA 3B5IA 3K15A 4EL0A 2V4UA 3UWOA 1SG9A 4EUEA 2OV3A 3FUTA 4I2NA 1UXOA 4W6ZA 1X7WA 4IUBS 1NGSA 3HN7A 2AC2A 3TX2A 3DL4A 3UJCA 2WWRA 1ZJJA 3DYBA 4HWRA 1T3ZA 1LZKA 2YHIB 3CNLA 3NUQA 4J4BA 4AWBA 1KKMA 4TXHA 2IUTA 2BHTA 4OUKX 1LNQA 5ALIA 2J4CA 3I52A 4GOLD 8ATCA 1PFGA 1ONSA 5TF4A 5TQ2B 4B3XA 2DHDA 1V8PA 1U2SA 3ZTTA 4MKRA 3CG0A 3TQFA 1E9RA 1ILWA 1AB6A 1O6GA 1ZLXA 4RESA 2ZJFA 3FDZA 5BPHA 1UEJA 3AEQA 5F5LA 5SZJA 2BMVA 1ZWLA 2GARA 3QUBA 4C0SA 2JBAA 3PUXA 2YXBA 4JROA 4DLLA 5CJ2A 1Z56C 4KEAA 5F4ZA 2BRUA 2RJOA 1IQUA 2YICA 5F2KA 2QAIA 3V1NA 2JKZA 4RPGA 4A7PA 2WFZA 4E46A 4JBWA 4C9BA 3QUSA 1JQKA 4K6OA 3VU9A 4M7PA 3ULKA 4JKYA 1GCIA 3U7RA 1JLSA 1VLZA 5ALOA 2Y4NA 4CM5A 2XUHA 1WBDA 5JDCA 2IEIA 1P9LA 2V7PA 1KRXA 4JT4A 3I5MA 2YV4A 4RETA 4XYMA 4EI2A 5K5EA 1J49A 2YJ5A 5CLQA 3CX8A 3MSCA 4H7FA 1DRVA 3ZLBA 2BKLA 4ZVOA 1G64A 1SH7A 1Q0PA 2J3IA 3ZV7A 4CIDA 5JD3A 1GIAA 4YYEA 4CLHA 2FRDC 3FLBA 5TGDA 5CEFA 1K6MA 2UVPB 2Z30A 4QOFA 5DCLA 4QBTA 2XMSA 2QWXA 1RAEA 1M2GA 2I29A 4O2RA 3ZN2A 1TUBB 2FB9A 4O2BF 3GT7A 2XCLA 1N1MA 1GDHA 1W4BA 4TM7A 5BVHB 1O9HA 3TFQA 2Q9AA 1RM4A 2R2AA 4Q12A 1GXSA 2FGJA 3D7SA 1GL9B 1CJVC 2IT1A 3FCCA 3TLAA 3QNUA 2PWAA 5EUQB 4ARVA 5J2UA 3O90A 1V43A 2GHRA 4KREA 3DM9B 1QX3A 4HH3C 4PONA 1P80A 1NI4A 2CUTA 1AMNA 1ZH4A 4MW1A 1F48A 4XWWA 2IBMA 3ZHVA 3WGKA 2VYVD 1X2BA 2KWIA 3ILSA 3V8EA 3NWEA 3SJAA 4TL7A 4A0GA 2GN4A 4P35A 3TTUA 4GR4A 1GNRA 5FCDA 1YS6A 4MUAA 3W79A 5KTKA 1ZNQO 1DXOA 3TGPA 1Z9BA 5I7FA 3F6EX 5IJ9A 3KT6A 1W44A 5M04A 4UBMA 2V59A 3M5DA 1V7PC 5DNDA 2XWSA 3M9XA 4A36A 3A1VA 2VNJA 1E18A 2QD1A 3DFZA 2GN9A 2VG8A 3NEYA 4PY2A 1KYYA 2H4ZA 2JA2A 3I3OA 3IAUA 4G8BA 3J81k 3QVVA 5FOTA 1H6DA 3MTEA 2PXHA 2O2YA 5CA1A 4PYIA 1Y6RA 3SX0A 4EHAA 1OFTA 4HUJA 4FX5A 4LJ7A 4FQ5A 4JLSA 1XAJA 3ZLUA 2EGUA 5L53A 1RXCA 4AX8A 3CS3A 3I9JA 4OJYA 1NASA 5M2QA 3EEFA 1M8PA 4WNCA 4PWYA 2JI8A 4NDAA 3QPAA 2QNBA 2XTMA 1C9NA 1IK4A 3I2KA 4TWBA 4MYTA 2CV1A 4MP6A 5CVDA 1QGUA 2ZUBA 1ZNWA 1JIIA 1QWOA 1BRTA 4ARBA 4CW7A 1Q0HA 3DTVA 1ZKMA 3NT4A 4RDHA 1SBHA 3MAAC 4M87A 1GKYA 5REQB 2QD5A 2XKKA 2LV8A 4UMEA 4K6GA 2ZYDA 1DELA 3LQ1A 4H60A 3DCJA 2BFCB 3ZTWA 1J22A 4J6EA 4PPYA 3EMVA 3FLEA 3HABA 5PGMA 1SCKA 2V0CA 3PQEA 3ZQ6A 4BNZA 3AXSA 3QX3A 1ESZA 4O3FA 3FKSD 1B1AA 4CCAA 4AMBA 3KKLA 1P5RA 1BG6A 1YCGA 3DEHA 3W5SA 5U4XA 3C3JA 2QAGB 1MU0A 3G0BA 4O5AA 3B3JA 1U8AA 4HGPA 4G0VA 1H9CA 3W5CA 4I3HA 1KE1A 1U0JA 1FW8A 2ZDGA 3W4KA 1M75A 5AM0A 1WPXA 4TV8F 2VZ9A 1WLSA 2QMYA 3IEUA 4J03A 5KYTA 5GMOA 5AO9A 1HH4A 2VEDA 1P1KA 5DBGA 2XT9A 2IHUA 3UWKA 2B2CA 4B82A 1XJCA 4DBVO 4DLPA 4BX2A 3NO4A 4L16A 3E15A 2CHQA 3HVHA 3JR7A 4GLLA 1WS6A 2K2WA 4PHGA 3K96A 3T7KA 3U31A 4DL9A 5KX5F 2WWHA 4UOQA 2BJVA 4N3AA 4ZQEA 5DHFA 5EC8A 8AT1A 3HJUA 3I9LA 2IXAA 2R79A 4H3HB 4ZOAA 3M4YA 5T4EA 4JGGA 1XEXB 3AR6A 4E4YA 5ARBA 5HGJA 1UMKA 2HX1A 4OBEA 1WSDA 1W1WA 1JYFA 3TJZA 1UCFA 4QHTA 2C9YA 1XC7A 1NMXA 4FN5A 2WQ6A 1N5DA 2XMRA 1D2RA 3BWXA 3RKSA 3K9LA 4ILKA 4UZFA 2GAJA 3K09A 5BNFA 2Y1GA 3Q5GA 5J58A 4ZICA 3FSEA 4D9KA 5KB3A 2R7KA 4ZO4A 1BA2A 3N70A 4KACA 3H2ZA 5G4KB 4DGQA 3HL4A 1ISGA 4B0PA 1W5FA 2YY6A 2ZTUA 4MA0A 4Y2PA 4TYPA 3B20A 3D31A 2GRJA 3D3KA 4X85A 3UUEA 3ZLJA 4FYHA 3GA5A 5LLTA 2AG8A 3BQMB 5MHTA 4TV8B 1PBTA 1V26A 4BQSA 3O1HB 2EKBA 5J23A 2AEFA 5FYDA 2DQSA 1GQFA 4QJBA 1R5OA 2WSBA 3IOEA 5K0ZA 4L8GA 5DX0A 3C85A 4FHFA 3AHHA 2WT9A 1Z5WA 2JIZA 2FPGB 1UWLA 1WZNA 1ONNA 3I5AA 3PJFA 4M1KA 4NWIA 2VQFB 2VHXA 3ZE0B 1BJTA 5CT6A 2R60A 1EJ2A 3D6AA 3DCYA 4JDUA 2B21A 2JFGA 2V6BA 1LS6A 4MRVA 5LP1A 2PGNA 3U4AA 1A9SA 1HSZA 2BWJA 2PU5A 4C4ZA 3BMNB 2AX4A 9GPBA 1G19A 4RLQA 4LJ8A 3ZH9B 4BFZA 3PPXA 4BKRA 2Y1WA 1N6NA 3N7TA 3ZZMA 4RIGA 2ZCUA 1TFRA 1ZNXA 3HLYA 4YCSA 2HXSA 1GPJA 3ZCUA 4CKXA 3BJIC 3CW8X 3QY0A 4MO9A 2O0KA 5FNVB 2GBLA 1CKEA 2XKAA 1BA3A 2HJGA 3USCS 1DIOB 2A5FA 4MWBA 2PLFA 2VT7A 1M1NB 4BUCA 3VSCA 4B76A 5HGXA 4DV2B 5JH7B 3OQNA 4DJFC 5DSTA 2R6AA 3ETEA 4JOSA 1XZCA 5IJ9B 4Q3CA 4QDTA 4DLTA 3SSNA 2XCOA 2WMDA 4GUDA 3WO0A 3BICA 4QUKA 4BVJA 1LI4A 4NJMB 1VGRA 2LUOA 1OU0A 4G4SP 3TSWA 4BFCA 3PGVA 2J85A 3D0RA 4G8CA 3D6HA 1T0HB 4NP6A 4DYVA 5JAOA 1K92A 4RTOA 4MHTA 3VNUA 1KSJA 1RZVA 3KB1A 1NN0A 4L0QA 4MYSA 2B4YA 1XG5A 3CNEA 1WMEA 5D3KA 5FUWA 4NFSA 3H1AA 1JGTA 4NBRA 2QT1A 1JHXA 2R6FA 1MFPA 3OT5A 4JJ6A 4BC0A 4LWOA 1ZUNA 3HGTA 1A7AA 1ZVQA 2QNIA 3OKAA 4OGWA 4QE3A 4C2UA 2P9EA 3RM3A 1YWGO 2ZSIA 3OETA 3KSRA 2WSSA 2FYTA 2QN7A 2CXRA 2I87A 1ZJ4A 3BWEA 3LC2O 5JCXA 5KEIA 2R7NA 4PLYA 2GCOA 4M0PA 2QL9A 3WLEA 5L7TA 4QA9A 3P2EA 4NMXB 3ORYA 1R0CA 2JH8A 1P0IA 2IS1A 1DL5A 3O8NA 5KHAA 1WP9A 5EIOA 4Q48A 1JW9B 1TW3A 4NYIR 4HAUA 3BIJA 3OE5A 3TMKA 4JB0A 4I55A 1J07A 4G0YA 3UK7A 3P9IA 1R6UA 4Y1RA 2EIHA 3L7BA 1JECA 3ZGVA 3O47A 2CFTA 1AQ6A 4L8FA 2X8LA 1ORTA 3ESCA 4FHDA 1AXEA 1BGVA 1JNXX 1JR3A 1W49A 2AG5A 3N8NA 5EJAA 4N39A 3NUZA 1YMUA 2CVQA 2FWIA 5DFAA 1PSDA 3ZE9A 1TLFA 5KVVA 1U7PA 5I9MA 3E4DA 3ICPA 1FJHA 1PV2A 1YMQA 2CDRA 2G9QA 2OCYC 4MV8A 1PGOA 4DLYA 4P3YA 4L9SA 5K0LA 3HXLA 1Z35A 3OZVA 2BHSA 1C7QA 3O1IC 3HDJA 1JHAA 3RC3A 4JIMA 5IHXA 2QR5A 3JW8A 5JWRA 3OWHA 4PN3A 3QKUA 1RRPA 3BERA 4LGVA 1V3TA 2WG2A 4EG0A 5IUKC 3UAWA 5BN4A 2IZ6A 4OLFA 2PRJA 2RHTA 4UXIA 1QFZA 1T0UA 5KYVA 3E48A 2QVZX 3KB8A 3PFBA 2Y05A 4NOKA 5JMTA 3L7OA 5KINB 5KMGA 3OMWA 5LXTF 2H0AA 1RKQA 2XVXA 4GF5A 2BSXA 2XNSA 3AERA 5EMNA 2JEYA 4ED9A 3HCNA 1GPDG 4S05A 2NTVA 4HDSB 3S0JA 1S2GA 4NMHA 4FNMA 3EBOA 4NH4A 2OUKA 3WYAA 2ZFUA 4GKBA 1Q0TA 3K0KA 2FV8A 2P1DA 2W2QA 4ENPA 1FDVA 4TPKA 3DAHA 5FBVB 2ZT5A 4KAAA 4TSRA 4F60A 4BQIA 4TYQA 4WOBA 3SEFA 1Y34E 5ARCA 4YRMA 3Q8KA 5BW6B 3Q7IA 1KOLA 1J5XA 4C88A 4CJXA 1JV2B 2DSNA 3CUUA 1T6BY 5A04A 3KQSA 5EAIA 1LV7A 4TM8A 4R1MA 4DWJA 1PNRA 1ZAYA 1U5BA 2BFFB 3OFJA 3K0AA 1UKBA 3G7NA 4WGFA 1AT1A 5AI0A 2OFFA 1FK8A 1Y5MA 3R3ZA 3ZGYA 2DT8A 1W7AA 1X1SA 1C30B 3IV6A 2RGUA 4W9NC 4FLMA 3VO1A 1UXGA 3IAM6 4Y2YA 3KQOA 1SKAA 2W2OA 1ZCJA 4RVSA 2BTOA 2ZJBA 4XIYA 1GTRA 2ZUEA 4XVCA 2VXYA 3BMNA 5HSGA 4MP8A 3U7JA 1XPOA 2NO4A 3KE9A 4EH1A 3G5AA 3G7SA 3NWBA 4RVHA 3OZGA 4FEEA 3RFCA 3NP9A 1UMDB 2WD7B 1GAWA 2XOKD 1A8PA 4LXTA 1ZM2A 2VOEA 2O3TA 3W05A 1IN6A 3UBTA 3JQEA 4I3GA 4AYWA 3EPHA 3FPFA 2FZKA 3ZV6A 3V55A 1QGDA 3IUQA 2WT8A 1LBTA 3PXXA 1BHJA 1LLCA 1S3FA 3IAEA 3PVZA 2C7GA 4OKNA 2FKNA 3DTVD 1JIQA 2IZ7A 4IIGA 3P2MA 4QSHA 4ETMA 4ANFA 5TY0A 1Y1TA 4YMIA 1ZH2A 3E5MA 3EGOA 2Z43A 3LBIA 3LHKA 2YFKA 5KVCA 4DW8A 2BF4A 2EZTA 3GFSA 3GLUA 3QWAA 4W6QA 1KSGA 4DY4A 1ZO8A 3WWDA 4F06A 3HUEA 5TPWA 1GG5A </