1XA0A

Crystal structure of mcsg target apc35536 from bacillus stearothermophilus
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
328
structure length
318
Chain Sequence
MSAFQAFVVNKTETEFTAGVQTISMDDLPEGDVLVRVHYSSVNYKDGLASIPDGKIVKTPFVPGIDLAGVVVSSQHPRFREGDEVIATGYEIGVTHFGGYSEYARLHGEWLVPLPKGLTLKEAMAIGTAGFTAALSIHRLEEHGLTPERGPVLVTGATGGVGSLAVSMLAKRGYTVEASTGKAAEHDYLRVLGAKEVLARELDKQRWAAAVDPVGGRTLATVLSRMRYGGAVAVSGLTGGAEVPTTVHPFILRGVSLLGIDSVYCPMDLRLRIWERLAGDLKPDLERIAQEISLAELPQALKRILRGELRGRTVVRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative NADPH Dependent oxidoreductases
publication title Crystal Structure of MCSG Target APC35536 from Bacillus stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
total genus 88
structure length 318
sequence length 328
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xa0A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1xa0A01
1EK6A 3DBRA 5JY6A 1AXEA 4WJZA 5C3MA 3VTFA 4II2A 2AW5A 3OP4A 1PL7A 2A9FA 1JDJA 5GZ3A 3FD8A 3I9KA 4OIMA 1MFZA 3UUWA 1ZSYA 3MJCA 1ZH8A 4OXYA 2V6BA 3F3SA 2FP4A 2ZTUA 4N5LA 3KETA 1E3WA 1T25A 3L4BA 4LK3A 4J4HA 5T67A 4JXKA 4FGWA 1UH5A 4WKGA 4FIZA 4FC6A 4CLOA 3HWRA 1EUCA 1OMOA 3QP9A 1OC4A 5JO9A 3KLMX 4IJKA 1R66A 4HNHA 2VT2A 4YJDA 5FI5A 4D41A 2NVUB 4BNJA 1NHWA 1DB3A 2ZJ0A 1PL8A 5AOVA 1N5DA 1L7DA 3RUAA 3GN2A 1ISFA 2PD3A 3FBGA 3W8DA 3FNHA 4GSKA 4KQXA 2VYNA 3GNSA 1E3JA 1MXHA 4TZTA 3BMQA 4W7IA 1ZW1A 1AHHA 2C29D 4CM3A 2JFHA 5GZ1A 3IAHA 2AEFA 2W8ZA 1GQ2A 3EVNA 2HLPA 2ZYGA 1ENYA 4CR8A 3RASA 4MO2A 4F46A 5L7TA 4YQYA 1XQ6A 4I1IA 3UW3A 4MIOA 5BSHA 3LC1O 2DKNA 4CUJA 5JMPA 2Q4BA 4MP6A 3JQ8A 4CM9A 1ONPA 4PIVA 3QA9A 4DGSA 1T24A 2BKAA 4G65A 4PLGA 4RCVA 2IZ1A 4AJEA 1NAIA 2DU8A 5EIOA 1KEWA 2VUTA 1Q7BA 3DMYA 2NU9A 4O1MA 1D4FA 3OEWA 4L4SA 4UEOA 3ENKA 2GDZA 1DIBA 4GWGA 3ZU4A 3VTZA 2O3QA 1Z7BA 2Q1TA 1EE2A 2AQHA 5GZ6A 3SVTA 1E7WA 3PJEA 1Z7EA 4NJOA 4AJ2A 3S55A 2NVBA 5IAAA 3BMCA 4QTZA 2QZZA 4KTVE 1SPXA 4BNVA 2ZATA 2H5LA 3AU9A 4F6LA 4XGIA 3IJRA 3CMCO 2B4TO 4B8ZA 4D0SA 5MGBA 1KC3A 3EW7A 2DPHA 4J49A 3O03A 4NFSA 3VPFA 3VVBA 1B8UA 1UXKA 3ZDFA 1NYTA 4JJGA 3UCEA 3VHRA 4CQLA 2QQ5A 5KCZA 4WE3A 3D4PA 3DO5A 1LSOA 4PGFA 4OJNA 4JJIA 4D0RA 4YT8A 1T2EA 2X0NA 4RLHA 3UCXA 3IP3A 3LLSA 2WE8A 3E8XA 1K6JA 1X0VA 4IGEA 1U7HA 5BNTA 4YPOA 4RJTA 3D4OA 1NR7A 2VHWA 5JY1A 1XCBA 5LCXA 4BHTA 1X7HA 1LTHR 1VJTA 1W0CA 1YBMA 4LRSB 1LDYA 3F47A 2HSDA 3JQFA 1E92A 2RCYA 5EERA 1G0OA 4J7UA 2X0JA 3JYNA 2X9NA 1I2CA 4CQMA 1GPJA 3UCFA 5DNAA 1IUKA 1EQ2A 2NVUA 3ZWAA 3S1LA 1HDCA 3NUGA 3RFXA 4BO0A 2OL4A 4WECA 4CV2A 1N1GA 3Q1LA 2IEDA 3QW2A 3EVTA 4QUKA 1MGOA 4RF4A 5A3JA 5JSFA 4FC7A 4CMBA 4E5YA 1IHYA 2IXAA 3WR5A 3LT2A 4U0JA 3GOHA 4UUOA 3RUIA 2HUNA 4XD2A 1GZ6A 5DP1A 1PQUA 4HBGA 4A26A 1ML3A 1EVZA 3VVCA 4NIMA 1GQQA 3IOYA 3WXBA 2C59A 5LDHA 2IYPA 2WWRA 2Y68A 2CMDA 2OORA 2VUSA 4KZPA 5BNIA 3KHUA 1LQUA 4R5HA 4WLOA 5IDXA 1Y81A 4BNMA 3AY3A 2X23A 1MB4A 3GG9A 1EDOA 4TRNA 3GMSA 5KJ1A 4BO3A 2HDHA 1J6UA 5A1TA 2BELA 1LDEA 3T4XA 3TPCA 4F6CA 3D3WA 4CMKA 2PGDA 3CKYA 1RJWA 3W4KA 3M1LA 3VC7A 4RV9A 2QRKA 1GU7A 4ZJUA 3Q6IA 4BNKA 1Z82A 4BMSA 4AJPA 2EKPA 3RWBA 4DRYA 1PZEA 5KJEA 5CHEA 3D64A 3DBLA 1D3AA 3VPXA 2GZ1A 4H7PA 3OQ1A 2VQ3A 3PGXA 3D3WB 5L53A 2YW9A 4ID9A 4BNYA 1Q0HA 1QLHA 4P4NA 2CDCA 3E9NA 4BUCA 3ZU3A 3ADPA 4Z9YA 1X7DA 1VI2A 2YJZA 3X2FA 5IF3A 4OOFA 4PLHA 3AJRA 1YJQA 4NBUA 3ENNA 4BKPA 1SB8A 3PIDA 1E5LA 3DQPA 5H83A 1DIAA 2WD7A 4JNKA 2ZKLA 4BQRA 1N8KA 4OQZA 1Y9AA 3AK4A 1DAPA 1PS8A 1ZMOA 3WYEA 2PZLA 1FDUA 3KTDA 5L95A 4R9RA 3TDKA 3TZCA 4G5HA 5MDHA 4BIIA 2EHDA 2V6GA 1ZK4A 3T4EA 2EW8A 3KYCA 3JQEA 4P4LA 1ORRA 1A72A 2PR2A 4IY1A 4CODB 2QYTA 3KRTA 3V2HA 4D79A 2P68A 4CM1A 4HKTA 5G4LA 2FWMX 1KOLA 4WLFA 1L7EA 5AYVA 1K5HA 2PH3A 4ILKA 2GGSA 4UREA 2C2YA 4J2HA 1PL6A 1RPNA 2D59A 3I23A 1V8BA 1U2DA 3A1NA 4NFHA 2AG5A 5F21A 1K3TA 3EMKA 4QO8A 2GN6A 2XPCA 1J5PA 5TT1A 2EKLA 2OP1A 1QORA 1TEHA 1ISHA 5CDYA 3RBZA 2B35A 4CL8A 2GPTA 5FF9A 5COQA 1R12A 3IL2A 4IQ0A 1N2SA 3EY4A 5I8ZA 1I32A 4PG6A 1HYEA 2NQTA 1PQWA 2FY8A 3ROQA 1JAXA 3UGKA 3KYCB 2PH5A 5HBRA 3RI3A 1GUZA 3VH3A 2DBZA 2Q2WA 3BHIA 5DCWA 1YVEI 2UDPA 4UUMA 4PG8A 2VOEA 4TKLA 1T4DA 1ZEJA 3NTOA 4DC1A 1JVBA 4K6CA 4DIOA 1KVUA 3ZHBA 4WLEA 2PFGA 3NTQA 4FFMA 3SXPA 3TNLA 5A9TA 3JQGA 3DBHB 1XEAA 1DEHA 4IMRA 1QYWA 3P2OA 3VOSA 2EWMA 1HE3A 1U9JA 1NVTA 2X58A 4RVSA 4PZCA 2OO5A 1DHRA 5L45A 4C7KA 3W4IA 4QECA 4AJHA 1D1TA 4B7XA 3OSUA 3DMTC 5AXBA 2B4QA 4R41A 1IL0A 1I3LA 3C1OA 1PGJA 4LGVA 3E5MA 4ND2A 4ND3A 3D3EA 3INRA 5EJ2A 2EGHA 5G0VA 4E6PA 1Z6ZA 5G0SA 3SJUA 3B1FA 3HSKA 5A9SA 1WAMA 4Z0TA 4AFNA 5HS4A 4BO4A 1IULA 2PKRA 1ENPA 4BOYA 2VHYA 1UP7A 4GH5A 1H9AA 1E5QA 2NTVA 4CMJA 1LDNA 3KEQA 2BHLA 2IYOA 2NVWA 3QHAA 1XQ1A 2C5AA 2JD2A 2PZKA 1O8CA 1GTMA 4U8GA 1ZUD1 1DHTA 5K9ZA 3I9NA 5TGDA 5IDWA 4OYRA 4WPGA 3K30A 3Q2KA 5I9MA 4BMVA 1YBVA 3RC2A 2JL1A 1QMGA 3WIDA 3L4BC 4IQGA 1H9BA 1F8FA 1I5RA 1U5AA 1RM5A 4GBJA 4GKVA 1X14A 3DTYA 4Y6RA 1HF3A 2QG4A 1F12A 2DFDA 3AI1A 4MOWA 5TQVA 1GYPA 4GX2A 2BH9A 2X22A 5L4SA 4E5MA 1IB6A 4FFPA 4BNGA 1E77A 2H6EA 4BO9A 5IZCA 3C1TA 4B8WA 2VTEA 5A02A 3MJ4A 1HZZA 4Z0HO 2VHZA 2YFHA 3GA0A 3B20A 3K31A 3PFWO 1QYXA 2H63A 3EZLA 2FR0A 2HMUA 3MTGA 2G82A 5JW6A 2X9GA 2AEJA 2P5UA 5BT9A 2GZ3A 4BKRA 5G0TA 5JPIA 5LDGA 4QX6A 1G1AA 4Q9NA 2J3KA 3JQ6A 2J8ZA 3FPLA 4M54A 1D1SA 2BGMA 3GC6A 3P2YA 2VYND 1HE2A 9LDBA 3PHJA 4XDZA 2HQ1A 3FRJA 1T2AA 4R9SA 4RPLA 5B4VA 1E3LA 2YZ7A 1ZVMA 3NX4A 1YE3A 4O59O 1E3EA 5L7YA 3MJEA 3OH8A 1LC3A 1IPFA 3DBRB 4XDYA 1EDZA 3BMNA 5LC1A 1NPYA 5I7VA 2X6TA 4I8XA 5CG1A 4IIVA 4N5MA 3RU7A 4BNFA 4EUFA 3EGOA 5EQDA 4DLBA 1U2GA 2JFGA 4A27A 1NVGA 1YQDA 4E13A 4IDGA 3JD3A 5K6AA 2X9VA 1ENZA 4G81A 1CQIA 1NQ5A 3LC2O 2GN4A 1HETA 4URFA 4CMCA 2WMDA 5KJCA 1DC4A 3JTMA 4PVCA 4P22A 3Q2IA 3F5QA 3L6EA 4FFNA 2YFQA 4B7CA 1LLUA 1ZBQA 4JP2A 2V65A 2A94A 1ZXLA 3WDSA 3GUYA 1E7YA 4J90A 4R3NA 3PP8A 5JDIA 4LN1A 1I8TA 3RKUA 1ZSVA 3GPIA 4JBIA 4UVEA 1Z45A 3JQ8B 3KVOA 4XYGA 3QSGA 4L75A 5CFZA 1J49A 3QY9A 4M8SA 4OQYA 2TMDA 4EZBA 5TJ9A 2BFOA 2BRUA 4BO1A 3ORFA 4JK3A 2G17A 1BSVA 4TVBA 4P38A 3BMQB 3JQ7A 1EVYA 2QZ9A 3F46A 5IDQA 1A4UA 2YHIB 4Y98A 4ZICA 1PGOA 1LU9A 2BD0A 2BGLA 3DZKA 1CDOA 3K73O 4GWKA 4UUNA 4DREA 1XDWA 2Q2QA 4DLLA 1FF9A 4XX0A 4BKUA 5A5EA 1A7KA 4IJWA 4YT2A 1WDMA 2PGJA 1IYZA 3VKVA 4W9NC 3E5RA 2A35A 3B1JA 4PFJA 2CVQA 2AE1A 3WYCA 1WNTA 3W4JA 2O23A 3G17A 4IQ8A 4OGWA 8ADHA 3UH1A 5IZ4A 3N7UA 4HP8A 4IDBA 3FWZA 2HK7A 4D3FA 1D8AA 1AE1A 1Q7GA 2C07A 4Q3AA 3GHYA 7ADHA 3CZMA 1TT5A 3ZV4A 2C2XA 4J0EA 3WBFA 3JD2A 5U9CA 3ADOA 1H6AA 1V9LA 4QXMA 4GGPA 4RVUA 3A4VA 3FWNA 3JQ7B 4RQUA 1ZJYA 3BHMA 1LX6A 1MG5A 2VN8A 3INGA 1Y8QB 5HTOA 1PS9A 3DXFA 3TN7A 1GL3A 3WLEA 3ETEA 2EERA 4DBVO 1PX0A 3ZV3A 3OFSA 3OA2A 4L73A 7MDHA 1BRMA 4ZHSA 1LRKA 1E7SA 1B3BA 1NM5A 1OAAA 3DWFA 3TRIA 4YB8A 4BKOA 3LU1A 4LCJA 1C1XB 3GGPA 3WMXA 2ZB3A 5IFLA 1KC1A 1X13A 1UUFA 3RFVA 4Z6KA 5TC4A 4CLRA 4ITUA 8LDHA 1R4NA 2H9IA 4AG3A 1M76A 4HFRA 5B12A 2D8AA 3LT1A 2D5CA 3UXYA 1GCOA 1R6DA 5AVOA 5JAZA 3COSA 4UAGA 1LI4A 2O50A 3BMNB 4YDRA 2UYYA 1S7CA 3OMLA 5HA5A 4E31A 4F3YA 3PDUA 3KXDA 4XQ9A 4GGOA 1ADBA 5CPBA 4W82A 4Q3BA 5IN4A 4I5EA 3ZWOA 4OL9A 3ZV6A 1ZIDA 2E37A 3JYLA 1HYHA 3KB6A 4ALMA 1KVSA 2V6FA 1BXKA 1XGKA 4WLUA 1PJ4A 3HZZA 4JJFA 4W7HA 4EGFA 1JA9A 4CLDA 5A05A 1B26A 1HTBA 3I52A 2PZMA 4E2ZA 1ZCJA 1QYDA 2EP5A 1UXIA 2OXIA 3WBBA 3DOCA 4U5QA 2JKVA 4RL6A 4EBFA 4AICA 3DFUA 4BS9A 5L7WA 1UDBA 3U4CA 5KJFA 1NBOA 4BMNA 5GY7A 1ZZEA 5TIIA 1TB4A 2DUUA 2CDAA 2HRBA 4NU5A 5B4TA 2JJYA 2Z1MA 4NMHA 3GVPA 1BGVA 1NAHA 3C24A 3TL3A 3VAZA 1FDSA 3AM4A 1HDZA 1P1FA 3R0IA 1KVTA 2YHIA 1BW9A 1OC2A 1NR1A 4B3IA 1JTVA 2FHSA 4MVJI 2WYUA 4DPKA 3AM5A 1LBEA 3H6KA 2OBYA 1UDCA 3FHLA 3DZBA 3SEFA 4DIBA 5ER9A 4HUJA 3F5SA 4Z3DA 5FEUA 1R0SA 3MZ0A 3OEYA 4XA8A 3F4BA 3LDHA 3ROKA 3ETDA 3PTZA 1HLPA 4NBTA 3TSCA 1MUUA 1A9ZA 4W6ZA 5DP2A 1VKOA 2E4AA 1UP4A 3I83A 4OOEA 5DULA 1ONOA 4GI2A 4IDFA 3JV7A 1M75A 3KZVA 4PLTA 1YQGA 4Q3NA 1R4MA 1JQBA 4HX5A 1PIWA 4GMGA 3JQAB 4MVJA 3U3XA 3ONEA 1RYEA 4KDFA 3NDIA 4A03A 2PD4A 4AVYA 5TS3A 3AM3A 4PLCA 4YCAA 2E82A 4JGBA 4MVJP 2CZCA 3IJPA 4YJGA 4BO7A 3ANMA 1SOWA 2P4QA 1ZK2A 4UVGA 2GASA 2NSDA 1K89A 1N9GB 1SZJG 3ASVA 3D1LA 2WJPA 3IUSA 3IKTA 1HDGO 3H5NA 2JHFA 2C5EA 2I6TA 3F1LA 4J9UE 1JKIA 5A3VA 4PLZA 4E33A 1QLJA 5JDIC 4I9NA 2HJSA 3V8BA 4AJOA 2FN7A 4ZQEA 4BB5A 2GN8A 3HHPA 4NDNE 1E1LA 1K2WA 1Q1NA 4E5NA 4NR0A 4R01A 5JC1A 4NNJA 5JXWA 1MC5A 1P1KA 1JW9B 4RF3A 4ZQBA 5H81A 1YRLA 3RU9A 4YTEA 3WFIA 3KSDO 3GNTA 4Z9XA 1HSOA 4BKQA 3CXRA 1GUFA 1H2HA 2DTXA 3NYWA 3X2EA 4FOSA 4A5OA 5C7IO 3QRWA 3TFQA 3PLRA 5EN4A 2DPGA 3TZQA 3MJVA 1OZAA 1C14A 3ZNNA 2FR8A 4DA9A 1ADFA 1Y1PA 2VYVA 4CUZA 2OGUA 1P9LA 1XYGA 4NBVA 5JCJD 4J4TA 3BXXA 3GFBA 3DHNA 4Z0PA 3WFJA 4FQ8A 2X5OA 3ZWVA 4J16A 2AG8A 3GUCA 1U4SA 1NVMB 2P5YA 1D7OA 1H6CA 1UZLA 2J5QA 2Y1CA 4O6VA 1KEVA 3OF2A 3H2ZA 1LRLA 2GZ2A 2ET6A 3P7MA 5ENDA 3ZW8A 3ROPA 3CH6A 5KIAA 3U9LA 3SBOA 2HJRA 5L3ZA 1B0AA 4C7JA 5IXSA 3ONFA 4XEHA 3ZNQA 3A06A 4JIGA 5C7LO 1YH3A 4L4XA 3A14A 1DJNA 1JWBB 4DLAA 4IDAA 3W8FA 4E2XA 2CNBA 4JBHA 3RUCA 2W90A 3RBXA 5EQFA 3DZIA 1KBZA 4CL3A 3DR3A 2Y1OA 5IZCC 2XF8A 2VRCA 3DFZA 4U0KA 4TRRA 1JAYA 4B79A 5ES3A 1I30A 1VPDA 1U5CA 3EC7A 4BNWA 2JCXA 2FSVA 3Q9NA 3PPIA 1DRUA 3S8MA 4N54A 4CLEA 2PWZA 3ZWMA 3BMOA 4YAGA 4R1UA 2OOSA 4L9RA 1LQTA 1P3DA 4LSMA 2X1HA 4IINA 3IDSA 3WG9A 3TQHA 1MXFA 3PI7A 3VDRA 5DBFA 1Y5RA 2TMGA 5EINA 4M55A 3QVTA 4YJHB 1H2BA 2P91A 4YJHA 4M86A 2O3TA 4JCOA 3E9MA 3ZGYA 4EJ0A 4RF2A 1HT0A 2UVDA 1LDBA 1VKNA 4K9DA 4ALIA 3JCZA 3I6IA 2CF5A 3B70A 5DZSA 5C5IA 4UEKA 5ICSA 1YDEA 4ZU3A 5JAMA 2JFFA 4KMSA 3UKOA 1VRWA 2VHVA 3DZGA 3AWDA 2X7HA 1TLTA 3EYWA 5DN9A 2RH8A 4PLVA 2C7VA 3VPSA 3OJOA 2P9CA 1QYCA 2NACA 4RPGA 2DLDA 3K8ZA 3BMCB 2GD1O 2LDXA 4NBWA 1KEPA 3O8QA 1DDOA 4GMFA 3PHLA 4O5OA 1SAYA 1HXHA 5CDGA 5TNXA 4NJMB 4IJVA 2Q46A 1I33A 2DT5A 4PG4A 2V7PA 3CZRA 4YYZA 4PLFA 1ZJZA 1AXGA 1E6WA 3NGXA 4I5FA 1U4OA 3ZNPA 4MIEA 3GMDA 3QVXA 2WYWA 3DC2A 4IM7A 4NG5A 5KTKA 4GVLA 1PJSA 1Y5MA 2J5KA 3WLFA 1TVEA 2D4AA 1GUYA 3NRCA 4N5NA 1KY4A 3C7DB 4YJGB 2RH4A 5BNFA 3GEGA 4LMRA 3GDFA 3WB9A 3CTMA 4GLLA 1LSJA 2CVOA 3ZN2A 3WGIA 1P0CA 3HE3A 3U49A 2R6JA 4R1SA 4D45A 3PHGA 1I36A 3H9EO 2DUWA 1ZXBA 5ICMA 2DBVO 5JCJA 1WVGA 4YR9A 2PNFA 4YEDA 2YUTA 1DLIA 1LEHA 2VRBA 5JE8A 5JCXA 4OKIA 1EFLA 1TT7A 1HDXA 3KUXA 3ZHXA 1MG0A 2D1YA 2ZIZA 3DZJA 3NJ8A 4Q3CA 4H3VA 2WSBA 3WGQA 4A2CA 1WPQA 2ZTLA 2PLAA 2VNAA 1LSUA 5DBGA 1R16A 4WOJA 4QSMA 4CQMB 4FFRA 2HU2A 3T7EA 4XYMA 4WASA 3ST7A 3ZW9A 3RUDA 1YQXA 4LCEA 3NGLA 2NWQA 3SLGA 1GDHA 1JN0A 1U3VA 1ZEMA 2F00A 1C0LA 1NQAO 3KSZO 2GERA 1DLJA 4ZD6A 4AJIA 1B16A 3M2TA 3W6UA 5C37A 1YS4A 3WSWA 2Y1GA 1U3UA 3ZZNA 2C20A 1G0NA 2O2SA 2X5KO 1UXHA 4S3MA 2I66A 2Q99A 4J4BA 1UZMA 3ITKA 4RPJA 4QQRA 4CV0A 2I99A 1PJ3A 4XJTA 1A9YA 4HFJA 5A04A 2QYSA 1YOVB 4MKZA 1NQOA 2DBQA 2IDZA 1MA0A 4FJ0A 2HCTA 1NNUA 5F1PA 3GDGA 3O9ZA 3OM9A 1M2WA 3TZKA 4OM8A 1TI7A 4FFOA 4FN4A 5I9LA 1J0XO 4MVJD 1NFQA 3JD1A 1PJQA 2YHUA 1Q0LA 1CETA 3JQAA 1GYQA 4YJFB 1R0LA 1PSDA 1DIGA 1PU2A 4J1QA 3K6JA 3AUTA 3FNGA 4NPCA 3GN1A 4BQPA 1W8DA 4I9UA 5EPOA 3ZWYA 2CUKA 2O3SA 1E7RA 4XGNA 1ZMTA 4IXTA 4UVDA 3LC7O 3CPSA 4EUHA 1F14A 1QP8A 2DAPA 4GL4A 3JQCA 3K92A 4EW6A 4WEOA 4CR7A 1EZ4A 5DCYA 1K6XA 3C1AA 1J4AA 1WDKA 2FSSA 2I65A 3E03A 3WS7A 2IEBA 2YV2A 1EQUA 4HY3A 3UHAA 4UUPA 1BHSA 2VT3A 3L9WA 2O48X 4CM4A 1UJMA 1HRDA 4CM8A 3SX2A 4CM8B 3QVWA 4BVAA 5KVQA 3ZHZA 4WCFC 4CM6A 3LVFO 3TL2A 5FI3A 1PJCA 3AUUA 3PHIA 1EVJA 3WTBA 4BNUA 2EJVA 1RM0A 3WMWA 3QE3A 5ILGA 2JD0A 1DFIA 1EE9A 1P44A 4S1VA 3KO8A 3KBOA 4R69A 1NFFA 2ZYAA 3RFTA 1KS9A 3GRPA 3IQDB 2ZQZA 2I67A 2O3JA 3H3JA 4AJJA 4CQMD 1P74A 1KETA 3HDJA 3V2GA 3NTRA 4WNIA 3HADA 2WD8A 3BYZA 2G1UA 5JMWA 3Q3CA 2A4KA 5L4LA 1E0DA 4MVJF 4BGEA 1YXMA 4Y67A 3WICA 1DRVA 4NK5A 3UFXA 1GR0A 1DJQA 2XXBA 2YYYA 1QSGA 4J1TA 1P31A 3S2EA 3F9IA 5JAIA 3TZHA 4A7PA 5A06A 4GX5A 1NTOA 3BZUA 4TWRA 3I9MA 2PK3A 1V3UA 4Q39A 1M6WA 1K6IA 3VH4A 4C4OA 3BTSA 1PEDA 4RLSA 5CAEA 4B4VA 4ESOA 4CM5A 2VHXA 1NPTO 2HMWA 4XYEA 2HK9A 1UXJA 4WK6A 1E7MA 1EBUA 2Q1WA 3WSVA 3H2SA 5IXYA 3PFFA 3RD5A 3RBVA 3PYXA 5IN5A 2IODA 3DOOA 1DIHA 1B7GO 5ITWA 5A4DA 1U3TA 1LUAA 3HN2A 3M1AA 3JD0A 1WP4A 2EF1A 3IC5A 4XB2A 1H6DA 5F5NA 4ND1A 1F0YA 3WQQA 4KOAA 1O9BA 4J2OA 4O0LA 3JYQA 1WDLA 1ZK0A 1XA0A 3PK0A 3T7CA 3WQRA 4CMHA 1LLQA 3G79A 3AI3A 5FYDA 3V1TC 3C7CB 2CF6A 4CM7A 2E49A 3RJ9A 4O63O 3L77A 4ALLA 1QV7A 1YGYA 2W2KB 1FJHA 4ZN6A 4YJFA 5JFOA 5T5QA 1I0ZA 1YWGO 4KP7A 4CM9D 2J5RA 1K0UA 4FS3A 1V3VA 4CMAA 4KDEA 1YB5A 3AUAA 4OSOA 3L4SO 4J1SA 2WDZA 5KJ6A 1C0PA 1HDYA 3NEPX 3NV9A 4E32A 3R3JA 4JP3A 4D43A 4RZIA 1DO8A 1I3KA 2Z5LA 3DAFA 4K6FA 3OIDA 2Q49A 3DL2A 5JAQA 4EEXA 1UP6A 3GVHA 1RYDA 4GX0A 2VRCD 2ZCVA 4IDCA 1BTOA 1DSSG 5JLAA 5U1PA 1BG6A 1LNQA 2DFVA 3ZV5A 3OIFA 3RC1A 3I5MA 3FBTA 2E6UX 2UUPA 1HDRA 1ZFNA 4BNNA 3E48A 1NX6A 3OETA 5DOZA 4YAIA 3NAQA 4I08A 4R51A 1CJCA 1VJ1A 4B4UA 1Z75A 1PJ2A 3MCVA 4MP8A 1EK5A 5HS6A 3CUKA 5ITVA 1R37A 2W4QA 4MVJE 3GHHA 3WGOA 3UVEA 1VSVA 1SO8A 1LDGA 4XIJA 4DQXA 1KYQA 4L0QA 3WWZA 3HG7A 2R00A 2VWQA 2BGKA 3AI2A 4DL9A 4DIFA 3G0OA 2ZB8A 1KVQA 3SC4A 1I2BA 1KERA 2F1KA 1ONNA 3RQSA 4A0SA 5U4QA 3GNQA 4L4RA 3GZNA 2JCYA 2QX7A 4MKRA 2VOJA 3I9JA 4PZDA 3CMMA 3GZ4A 3OA0A 1JLLA 1PR3A 1NP3A 2OUIA 2JD1A 3BA1A 2EXXA 4E0BA 3EHEA 3LQFA 1E6UA 3LT4A 2Y0EA 3KYDA 1BXZA 5A9RA 2XXJA 1FMCA 2NNLD 1W73A 4MINA 3JQGB 1NHGA 2O2YA 2DM6A 4DVJA 2VZ9A 4BV8A 1ZK1A 1B15A 4FCCA 4R3WA 3KSUA 1NWCA 1DC3A 4YAJA 4K28A 4BO5A 3IUPA 3TF5A 1I01A 4OXNA 2I3AA 1MV8A 4E30A 4IUYA 4XZ3A 2ZYDA 2AHRA 4EJ6A 3PQEA 2P9GA 2DTEA 5HWSA 3ICCA 4YXFA 3FI9A 3RUEA 1B14A 1GFSA 1YBAA 2C54A 4W9NA 1XIVA 1DIRA 4PZEA 1N9GA 3B6ZA 4E2YA 3R1IA 4QFDA 3LZ6A 4BO2A 3HDHA 3WGGA 4A10A 3DDNA 4KUEA 4ND5A 1NWHA 4EYEA 3OJFA 1ISMA 2OBNA 4XCVA 1GADO 1OOEA 6LDHA 1YB4A 2J3IA 3JYOA 3MEQA 3TZ6A 4DYDA 5JYEA 4XYBA 4UEJA 2PGLA 3EUWA 4R1TA 1E1MA 3ZU5A 3FR7A 2Q45A 4TVOA 1P45A 3ZI0A 5KKCA 4LVCA 4A73A 1V0JA 5I7FA 4HADA 4EJMA 3PLNA 4XIYA 4YBZA 1SBYA 1FDTA 3RSHA 1T1SA 3JQFC 1TXGA 2FZWA 1Z74A 2LDBA 2DBRA 4CR6A 5JDCC 1H0KA 3CE6A 3M6IA 4RVHA 2FPPA 1VM6A 1IZ9A 2O4UX 5KOIA 4YT4A 3H3FA 4LW8A 4MPDA 1F06A 1ZK3A 4RZHA 3WJAA 3NT2A 5JS6A 1DC6A 2OMEA 1Q2XA 3CIFA 4OSPA 4CLHA 1LDMA 2I3GA 3ZCXA 4BNTA 2NQ8A 3FCOA 2VCYA 3RC7A 2NV6A 4Z3KA 1P1IA 3DONA 5G2OA 1E3SA 2ZK7A 3OHSX 1IE3A 4XGKA 3WOHA 2NTJA 3BHJA 4GSLA 1U1IA 2QHXA 3ZWCA 3ZH2A 3ULKA 4EI2A 1U8FO 3K2BA 2CSUA 2EJWA 3EAGA 3QWHA 3I1JA 1T2CA 1EUZA 4OAQA 3ZHYA 1AGNA 3DMTA 4TQGA 2PV7A 1U28A 3HB5X 1YO6A 2ZCUA 1I2ZA 4N7RA 3DBLB 4JROA 3NDJA 4NU6A 1H94A 4WCDA 1UAGA 2Q50A 4OKNA 3K5PA 3S2FA 1ISIA 1H93A 1SMKA 4QEDA 1O5IA 2ZQYA 3OQ6A 5BSFA 3GAZA 5CEEA 4TRMA 3GVIA 4HNGA 1VL0A 2WEKA 2Q1UA 1CF2O 1Y6JA 3DZFA 2J6IA 3R3SA 4GPD1 3AOEC 4CMEC 2FR1A 4NI5A 2G5CA 1A7AA 4F45A 4FJ1A 4BNHA 4TMFA 1EVIA 1QRRA 3JQBA 4GLOA 1WZEA 1PGQA 3ANNA 1KEUA 5CG2A 1DRWA 3FTPA 1PGPA 4Y6SA 4Y9DA 4D42A 5L51A 1XELA 2FMUA 4DWVA 5CEJA 5T57A 3WGYA 2O3RA 4QO7A 3RVDA 2Y1EA 1R0KA 1CQJA 1C0IA 3GAFA 5FWNA 5DT9A 9LDTA 3INTA 3ON5A 5K6AC 5BSEA 3KOUA 4BGVA 1YKFA 3LYLA 1EFKA 1I24A 3I4FA 4AJ4A 4YAEA 4ZA2A 1LLCA 4UVHA 5ADHA 1KY5A 3S2IA 3QWIA 4NQZA 3NKLA 5L4NA 3ITDA 4NK4A 1Q7CA 3AY7A 2B83A 1A5ZA 4AJNA 3PIIA 4GAEA 4INAA 4NBRA 3GT0A 3UICA 3H4VA 4CJXA 4IZHA 2AQKA 2NADA 1QG6A 3ZWPA 4ZGWA 3R6DA 3NDRA 1M66A 2EW2A 2D3TA 1VL8A 2GCGA 4XRGA 4PLWA 1E3WB 5T64A 1CRWG 4L76A 3OQBA 3EDMA 3OICA 2VNSA 1DXYA 4BL5A 1Z73A 2BMAA 4EUEA 3QLJA 3NJ4A 2VUUA 2I9PA 5T8KC 5DDIP 4D44A 3F4LA 1GPDG 2Y1FA 3VZQA 2B5WA 2W2KA 3B1KA 2EGGA 2P4HX 1RM3A 3TJRA 5TX7A 4RVDA 2VYVD 1CWUA 1LC0A 1IZ0A 1PQPA 1EBFA 2GO1A 4JX8A 3FNEA 5BQFA 3WGHA 3MOIA 4YT5A 4G2NA 3GQVA 3QWBA 5AXDA 5A5FA 3ZWBA 5DBIA 3QQPA 1UXGA 3UOGA 3D4NA 1B8VA 1VE9A 3IKVA 3DOJA 3GK3A 2X86A 3AW9A 3AUSA 1HE4A 2BFMA 3RCBA 2DQ4A 3WNVA 4BB6A 4E5KA 2NU8A 1SC6A 1A27A 3PGJA 1ISGA 2Y66A 1YL6A 1Y8RB 2BF7A 3DHEA 4PRLA 1C3VA 3G3EA 4R4JA 4RVFA 4RVGA 3BTVA 4Q3DA 1QYVA 3FF4A 2O7QA 4J0FA 4MDHA 1BVRA 4TKMA 2EKQA 2HRZA 4RO0A 4GVXA 4OO3A 1WMBA 5ENVA 3V5NA 3VH1A 2NU6A 1HE5A 2WTBA 2B36A 3V1YA 1ZNQO 2Y1DA 3E1KA 3Q0EA 2HKIA 1E3IA 5JNLA 4BNIA 2OFPA 3GRKA 1DFGA 1EMDA 4DYVA 4K1LA 4Y6PA 4BGIA 4ALJA 1W6UA 2Y05A 1RKXA 4P4GA 4XRRA 2HO5A 5H82A 5CEFA 3WX0A 5B4UA 4LRTB 2C7GA 3D5QA 1PJLA 2WD7B 1H5QA 1T2DA 1H6BA 1OFGA 2BFAA 2QRLA 3JQ9C 3Q9UA 4YACA 1TT5B 1AHIA 3KYDB 1B2LA 1CIVA 2IZ0A 4ZQFA 1P33A 2UAGA 4M1QA 4WCFB 1FK8A 2R2GA 1BDBA 1V35A 4PLYA 1R4MB 5EESA 2IRWA 4WOKA 3PHHA 1IPEA 4FR5A 1N7HA 3L6OO 3H5RA 4IDDA 3HQ4O 3FSRA 2GF2A 2PA3A 3U4IA 1OBFO 3C7AA 3WTCA 2EEZA 4OH1A 3I4CA 4PN3A 4HXYA 2W98A 4RGBA 1PJTA 1NQTA 2OP0A 1QXSA 2OHXA 3C8MA 4JQCA 1YDWA 1SCUA 1BXGB 1ZO8A 3I3OA 1KIFA 4ZVVA 4CLXA 5AXCA 4NFYA 1N92A 3AOGA 4ALKA 5IG2A 4ZRNA 4CMIA 1O89A 4IS3A 3VZRA 3HN7A 3U4DA 3A28A 3ASUA 3K9QO 3RC9A 3DZHA 4RQTA 3OECA 1XHLA 2O7SA 4RF5A 3EK2A 1O95A 5L9AA 2AE2A 1C0KA 4XB1A 5IDYA 3I9LA 4HV4A 3GPDG 3K96A 4U6SA 4NJMA 5CDSA 5G0WA 2FPIA 3RKRA 3PJGA 1X1TA 1LLDA 1V3TA 1GZ3A 4YAKA 4IBOA 1UZNA 5B1YA 1HKUA 3IMFA 3L07A 4XJSA 2BFPA 4R1NA 4U7WA 4WLNA 3G1UA 1HZJA 2O3UA 3WGTA 1ZSNA 2HMTA 5CP8A 1X7GA 4KWIA 3ICPA 1ID1A 1O0SA 4WGGA 2D0IA 4DPMA 1CERA 1GY8A 2GN9A 1XKQA 2YQ5A 4CMGA 3MWDB 4Q3EA 1PZFA 3SLKA 3M2PA 1BMDA 3TOXA 1XR3A 4IXWA 4B7UA 3ZWNA 3VH2A 1YONA 1I3MA 1PWXA 3TWOA 4YQZA 3KM0A 2EV9A 4CLOB 5JDCA 3CINA 4RPKA 4YA6A 1RWBA 1JWAB 2B0JA 4FSHA 4PLPA 3OJEA 3VZPA 3FTNA 4EEZA 3D0OA 1HL3A 4OMUA 4DMMA 3H7AA 4AJKA 4W99A 4E2WA 5L40A 1O6ZA 4ZQHA 1SEPA 1GQYA 2WYVA 1C1DB 2PTGA 5DF1A 3VPHA 4NH4A 4X54A 4BNZA 4EDFA 1LJ8A 1F8GA 2QRJA 1DC5A 2DC1A 1T2FA 2I76A 3TOZA 5A9SB 3OJLA 5IJZA 3QWAA 1NASA 1IHXA 1X15A 1X1EA 2YDXA 3E6AA 4FDAA 4XKJA 1HWYA 1YL5A 5I7SA 2BI8A 1YOVA 4CM4B 1HSZA 1EUDA 1GEEA 4IS2A 3JQ9A 4XR4A 4CUKA 4D3SA 2X5JO 3F6YA 1AN9A 3GF4A 4KUGA 1BXGA 4JN6B 1A4IA 2B5VA 2YV1A 2VWHA 3HFGA 1CEQA 3N58A 1VJ0A 4PRKA 1MP0A 1PTJA 1LA2A 3PQFA 5T6BA 3DHYA 5TSDA 2G0TA 1FDWA 1HYGA 4WEQA 4BNLA 4MJLA 3WNQA 3FR8A 4M87A 2A92A 1SOVA 5T8KA 2X4GA 1BWSA 2C82A 3HDYA 4J6FA 3I6QA 1XLTA 2WE7A 4YRBA 3L6DA 3UF0A 3PYLA 2UUOA 4RPHA 3G1TA 5EMHA 1XSEA 3RUFA 1X0XA 3PWZA 4J7XA 1FXSA 3LK7A 4J1NA 4UVIA 3V1UA 4L74A 1JKFA 3VPGA 5KVSA 3PDJA 2XAAA 2HMSA 4JBGA 5TLSA 2GYYA 4CLRB 3ZWXA 3MJSA 2FZEA 5BR7A 5K1SA 4YRDA 4RDIA 3H65A 2UV8A 1VC2A 3W1VA 1GAEO 2CD9A 5THQA 4E3ZA 1M67A 4W4TA 1Y9EA 4QT0A 2V6MA 1PJBA 2PZJA 3O26A 3RAJA 5KWEA 4OXKA 4YVFA 2AQ8A 3O8QB 1P77A 4BO6A 4H16A 2CFCA 2DTDA 1Y8QA 3GEMA 4LSWA 4FW8A 3OIGA 4B4OA 3GGGA 2WM3A 2FOIA 5DCUA 2AQIA 3OJ0A 3L0DA 4TRJA 2W2LD 1BVUA 4CMIB 4MVJG 1N1EA 4FFLA 2QW8A 4PG5A 3ZU2A 4DC0A 3UN1A 4IMPA 2J3JA 3OBBA 3AOEA 5COBA 3UAGA 4CMEA 3MTJA 1P1RA 3IIEA 2IE0A 3RJ5A 2NUAA 2JHGA 2B4RO 3BAZA 3PZBA 1U7TA 3H9JA 5JYDA 4FB5A 3BIOA 3HFSA 4OHUA 3H5AA 3JQAD 4M49A 5C7OO 3IS3A 5K0ZA 5CDTA 4CV3A 4II3A 1XU7A 1UDAA 2Q4EA 1MLDA 2VTDA 3BTOA 3PWKA 2X8LA 2YQ4A 4Y8VA 1M6HA 3FPCA 4MIYA 3GFGA 5GMOA 5I7EA 5KVCA 3L9XA 4BGUA 3H9QA 3HB4X 3GZNB 2CVZA 3U4HA 3E9QA 4AJ1A 1N7GA 4FJ2A 1JU9A 4H15A 3WIEA 5TF4A 1XG5A 1SEVA 4FPXA 1KVRA 5F3RA 4B3HA 2E48A 4FD3A 1JVSA 5G4KA 4DMLA 1MFPA 2D2IA 4TROA 3JQDA 2EG9A 4D46A 2J3HA 2Y67A 4ZQGA 5TJHA 3RROA 2ZTMA 1T1RA 3DAPA 4J7CA 5HRUA 3DBHA 3BMOB 4TZKA 3GH3A 1UR5A 3PWSA 3U5TA 3E18A 1BW9B 3DB2A 3O38A 1GD1O 3I9OA 1B8PA 5A03A 1W4ZA 1ISJA 4M89A 3ZNOA 3DTTA 2AXQA 1QR6A 2PD6A 3CSDA 3PZRA 4WCFA 4YRAA 4Z9FA 1GV1A 2AEMA 4D3DA 5ILOA 2RBEA 4GQAA 3KV3O 4J91A 3S2GA 2Y0DA 1P0FA 4IJUA 2P2SA 2YV3A 3BTUA 3DAGA 5DOVA 3P5SA 1S6YA 4NHEA 3VDQA 4FGSA 4AL4A 4ZRMA 3ANLA 3HUDA 3MWEB 1ULSA 1NPDA 3PXXA 3VZSA 3RIHA 4XR9A 5F1OA 5TRTA 4ONEA 4YWJA 4E5PA 4IDEA 2FPGA 1ADCA 2JAHA 5TT0A 2OZPA 2ZTVA 5KNLA 1Q0QA 2O4CA 3DBVO 4NZ9A 2B37A 2D5AA 5J23A 1NFRA 2VWPA 1FDVA 1G6KA 2RHRA 3JD4A 1E1NA 2IXBA 4QFCA 3WYBA 2JAPA 4PVDA 2X0IA 2Y99A 4K26A 1PZHA 1XWFA 2P9EA 1DPGA 2Z1NA 2Q2VA 6ADHA 3GLQA 5FFFA 3FN4A 3GDOA 1MC4A 3P19A 4CQLB 1DOHA 2SCUA 2CDBA 2VZ0A 5COAA 2EIHA 4WUVA 4DQUA 4HFNA 3AU8A 3TFOA 3ETGA 3H8VA 1TA4A 1YB1A 1AUPA 3C85A 3CEAA 1C1XA 1PWZA 1Y7TA 2IZZA 4D7AA 1VLLA 1IY8A 2AMFA 2CY0A 2Z95A 2W2LA 1LXCA 3AY6A 3W8EA 2HMVA 3H9GA 3PQDA 3QV1A 4XQEA 3PVZA 3W6ZA 2POQX 4MVJH 1R15A 3G49A 1YL7A 2HAEA 4J43A 1C1DA 4AJLA 1YJ8A 3U0BA 1ZKMA 2VWGA 5B37A 4KTTE 2DVMA 1I3NA 3EZYA 4IPTA 1GCUA 5JBIA 5KKAA 5G0UA 4R54A 2GUGA 4I5GA 5CPFA 3KYBA 5CDUA 2R00C 2NTNA 1E1KA 1NXQA 1PR9A 3JSAA 3IP1A 3RUHA 1QV6A 4WLVA 5ER6A 3PYMA 1WW8A 3N74A 3NT4A 2Q3EA 3GVXA 1R4NB 2AA3A 4DPLA 2B69A 4HWKA 3ROMA 1SB9A 4PG7A 3PJDA 1ADGA 1IOLA 1WWKA 4RDHA 4PCVA 1CYDA 1F17A 2JCVA 4RORA 3H9UA 4FBGA 4J9VA 4R16A 4CPDA 3GEDA 4BNXA 3PEFA 2RHCA 2BI7A 2C0CA 3GGOA 2VZ8A 3JYPA 4CV1A 2BLLA 4IIUA 2FRDA 1ARZA 3QJ5A 2YY7A 4LISA 4MP3A 1U8XX 3ZWWA 3C3XA 3PJFA 4I5DA 1ULUA 4E12A 2GR9A 3PRJA 1LRJA 4EITA 4J3FA 4DXHA 5KVVA 3GG2A 3WGZA 5G4KB 4BV9A 1A71A 3WJ7A 1QKIA 4P8RA 1PS0A 1HLDA 1JKJA 3V2UA 3D5TA 3NT5A 2ZB7A 1L1FA 4R5MA 4KQWA 2RIRA 2XOXA 4HFMA 1E7QA 3QIVA 4XWYA 5F5LA 2NU7A 3HDQA 1GEGA 2G76A 4I9HA 1MX3A 4L8VA 2X0RA 2Y0CA 4KUHA 4MVJM 4IZIA 4DQVA 5I9NA 2Q1SA 1XU9A 4BO8A 3STHA 4GX1A 2I5PO 3F1KA 4ROSA 2RAFA 3JQBC 1U3WA 1DFHA 3LT0A 4DBZA 3LSYA 4B4WA 3LF1A 3O4RA 1HDOA 4XQCA 4DTIA 5BSGA 4FOOA 1V6AA 2QIOA 1RM4A 2PY6A 4IGFA 1VL6A 3HJAA 3SJ7A 3Q11A 2PKQO 3QWFA 1WMAA 1WZIA 3K2EA 3WQSB 4UULA 1GV0A 3QVSA 4R68A 4E4YA 4E21A 1E6EA 3MOGA 5AQ1A 3HNPA 3FNFA 4DUPA 1PZGA 1HEUA 1GZ4A 5I8WA 5AXAA 3KLPX 5HM8A 3E82A 3GR6A 4LMPA 1UAYA 2ZJ1A 5THKA 1P1JA 2EP7A 2ZB4A 1T26A 1P1HA 2YDYA 2Y93A 1SNYA 2NM0A 3GVCA 3SC6A 2GRAA 3LLVA 4XYLA 2NLOA 4MKXA 1GYRA 2ILTA 5F1KA 3ONDA 1WXDA 4U6QA 3KEOA 1T4BA 2PKQP 1O94A 4ND4A 1Y8RA 2HK8A 3WWYA 1DBVO 1VSUA 1ENOA 3DEYX 2GLXA 4GKBA 4JLWA 3U09A 3AFMA 3D7LA 1PGNA 2GSDA 1WLYA 1I10A 1LSSA 5EL0A 4KWHA 1OI7A 3A9WA 3LF2A 2H1SA 3MJTA 3QVOA 3VKUA 4WNCA 4B3JA 4ALNA 3U62A 2GNAA 1DAOA 3GY0A 4TSKA 3ABIA 4XQGA 3AFNA 1BDMA 1EEHA 4LVUA 5JO0A 5JC8A 1B3RA 4N18A
chains in the Genus database with same CATH superfamily
1IHUA 1KFJB 1IJFA 5C3MA 5K3FB 1ZJ6A 3PNMA 3VTFA 5KQMA 4O4JB 3JARA 4S0XA 2Z56A 1Y63A 2H1OA 1KYVA 1PL7A 1T8RA 3HY6A 4YMHA 3FD8A 3I9KA 1OE0A 2QDXA 4G2TA 4W1QA 2NZYA 3V1KA 1POWA 2ZRAA 3BJZA 3ESBA 3KBBA 3MJCA 5EMMA 4YP9A 1G21A 3AR3A 3E61A 4ZI2A 1M0EA 4JI1B 2VJNA 1T34A 4LYGA 3V9PA 2V7WA 1EESA 5CLGA 1E3WA 2BFBB 2IF0A 5DM0A 3AESA 5BXYA 2Y1KA 2Q7OE 1MO4A 3BXHA 1BRTA 4JVNA 1E3TA 1NZFA 4FGWA 1GZVA 4OMDA 1ODCA 1QOZA 4KVAA 5JRZA 8AT1A 2RHMA 3HWRA 5FA6A 3C5VA 1ZM7A 4INZA 1FE8A 3U81A 1G4AE 1I6LA 1UBHS 1M5TA 1NW8A 5FUQA 2GAOA 2BPOA 1GNQA 3Q12A 4IJKA 1R66A 3S5JA 5FI5A 4AZVA 4IL5A 2NVUB 5J43A 2HWKA 2YCBA 2FQYA 3Q8WA 1VKZA 3UB4A 1YK1A 1N5DA 2B21A 2PT9A 2CT8A 4NLLA 1IG3A 4RE5A 1HC7A 1NOJA 2GB4A 2ZANA 4LJ6A 1RLJA 3V7WA 3W8DA 3HWWA 4TWJA 5I51A 5B5SA 1FTYA 2VKQA 2RK6A 4GSKA 2BM0A 4UNSA 2VYNA 2ZUTA 1UOEA 2ZDQA 2C29D 2SKCA 4CM3A 1XT6A 4KBYA 1GQ2A 4US0R 1T1GA 2ZYGA 1JQ3A 2G3YA 4MO2A 4YQYA 3UW3A 4I1IA 4NWIA 1BGXT 4BNUA 4DWWA 5JMPA 4MW1A 4ESEA 4P0TA 5C8VA 5F12A 4CM9A 1ONPA 4YRMA 1E5VA 3QA9A 4PIVA 2BKAA 4B6GA 3K0SA 2CW5A 2HCRA 2IZ1A 4RCVA 4E03A 1M7GA 2ZXFA 3HKCA 4AJEA 3TMKA 3BC1A 4WOCA 1Q7BA 2FP3A 4FT2A 4JB2A 2IF2A 3OEWA 1ODLA 2BGTA 4WACA 2HSGA 2A59A 2DY1A 2MYPA 3SGLA 2MR6A 2ZXEA 4HHEA 3ZU4A 1MN6A 2ZUCA 2IZ5A 1PUIA 1Z7BA 4KH0A 2AQHA 1PLJA 1KQGA 2ONJA 4HRAA 2Q5QA 2Q3MA 1Z7EA 4NJOA 4RULA 3MM4A 3S55A 2BJWA 1W46A 2NVBA 2JPDA 1NMQA 5IAAA 2ECFA 1OZGA 2F9FA 4UXHA 5JQGA 3A6EA 4G8CA 2HSZA 4BNVA 4YAWA 2VHCA 2QSUA 3AU9A 4MB0A 3NXKA 3ESZA 1XBTA 3OZDA 1VPLA 3B5JA 4OPMA 2PRSA 2B1JA 2W37A 3V42A 4B8ZA 2Q3LA 3L18A 3QMVA 5MGBA 3P2IA 4LY0A 2ZWAA 4BE7B 4ZCTA 2GJSA 2HLHA 3DOHA 1G8JA 3K35A 4NFSA 3VPFA 3HBMA 1UXKA 1U2ZA 4YUVA 2JJMA 4JJGA 3MA0A 3T9CA 3VHRA 2FKAA 4ZI7B 5KCZA 1M1YE 4PSCA 1L4LA 3GV0A 3UNXA 1KAHA 1M2GA 1NW6A 3A9CA 2V9CA 2YWGA 3R9WA 3GFPA 3TDNA 5JD5A 4DVGA 5EEGA 3Q1KA 4N8DA 5AW1A 3EGDB 3EJ6A 3HBJA 6CHYA 3ADBA 1U8YA 3H2BA 3V4PB 3IBTA 3VR5H 5M2QA 4D0RA 1TAUA 4Q02A 3I5YA 4Y2VA 1Z7YA 4YJ3A 1MGPA 5BNTA 2V96A 4YPOA 2D1SA 1NR7A 3CZCA 4YJ3F 5JY1A 5LCXA 2VDWA 2BGUA 1VJTA 4DSTA 3D81A 1BCRB 2ERXA 2HBQA 3TH5A 3F47A 4GYYA 1FFEA 2B1RA 4C05A 5FV4A 2A6PA 1N3BA 1Z36A 1NRWA 1Z0KA 2ISQA 4X8HA 4R8KA 3N28A 1E92A 1RBMA 1G0OA 1O6GA 2GPBA 1IUNA 3JYNA 2HB6A 2VSOA 5EE3A 3RGGA 3RHZA 3SF8A 3TL6A 3T9DA 3U40A 1MDBA 3OWHA 1GPJA 4UU8A 3BFJA 1P7YA 1TK9A 4BATA 2DFPA 3FFXA 1IUKA 2UZ0A 5DNAA 1C9DB 1EQ2A 3FRHA 1G9XA 2Q1XA 3ZWAA 1BYIA 1CJUC 1ZOOA 7REQA 4WECA 1PJZA 1YZHA 2W48A 4DWOA 4E1BA 2DR0A 2GXUA 3OPNA 2O1EA 3BCSA 2IEDA 4K6OA 1E0SA 2PO7A 4YIHA 3L4KA 1UC5B 3S6JA 2O8DB 2ZUVA 1Q1BA 3FMFA 2ZUFA 1GTVA 1QS0B 5GADl 3KNZA 2XNCA 4Z51A 4NENB 1RD4A 4LYYA 2CN1A 5JSFA 2QQFA 4CMBA 3NIGB 3OU6A 3CJRA 5A4FS 1QANA 4P0QB 2RAPA 2GAAA 3WWPA 4JLJA 3LT2A 4EWLA 1Y6GA 2NO4A 3GOHA 1R6TA 1UADA 4UUOA 1XVUA 3IERA 3G5LA 4X1KA 5IFKA 1C3EA 1MTZA 1R8XA 5JI3E 4LZLA 2RHWA 1PQUA 3I2JA 1LJLA 2DQYA 3FSGA 4MV1A 5CLFA 1ZAYA 1OU0A 2CLHB 1XROA 3TS1A 2OSBA 2IUEA 3GRYA 3OY2A 3PNQA 2XUAA 3IOYA 5MHTA 4D8XA 4K9MA 1CD5A 5FTKA 2IYPA 2CMDA 3RSOA 3GBPA 1QP4A 3OT1B 3AR7A 4V1CA 1KI9A 1Y1TA 4FFBB 3I2YX 4KZPA 3KHUA 5BNIA 1K08A 1XL1A 2QL5A 4ZDKA 2WVGA 4ZK6A 4O2BF 2YN0A 3DW3X 2VDPB 3FUUA 5JWRA 3LBAA 1ZUWA 2ZBDA 5LNK1 4CKBA 4EKNB 5KJ1A 4BO3A 2HOQA 3SR3A 2HDHA 3SNHA 2C5LA 5A1TA 2BELA 5A4JA 3PEWA 1LDEA 1A7JA 3GJ6A 3D3WA 4MLCA 1X7YB 5DRYA 3LPNA 1UINA 2GM3A 1RJWA 1Y9JA 3C3JA 4OB7A 4X60A 5E6RB 5FULA 3VC7A 2PKXA 3NBKA 2P9BA 2QRKA 3UHPA 1CHNA 4BZQA 4ECEA 1GU7A 4NARA 5G1OA 2WICA 3Q6IA 1P2UA 3KQKA 4D57A 5EFOA 1G4HA 3I72A 1G9TA 2PUEA 3MC1A 1ZN8A 4AJPA 2EKPA 3K4PA 5C8YF 2RB5A 3RWBA 5JAOA 4OHVA 2P77A 1PZEA 3GJ0A 4XQ0A 5H3CA 3D64A 4WDQA 3UATA 3D6HA 4H7PA 3OQ1A 4W1RA 3JY6A 3PQ8A 3QEOA 1UODA 2MIIA 3U7HB 3DT8A 4XIGS 1NKSA 3SM3A 1TTPB 1Q0HA 1QLHA 5LQUA 1LVGA 1S5PA 4BUCA 3NETA 3ZU3A 1Z0AA 5K8LA 2FWPA 2FZ5A 3P0FA 1VI2A 2ZSJA 2B5OA 3ZWDA 2QLNA 4OOFA 3ER9A 3AJRA 3VR4A 4F84A 2HHCA 2D13A 2LVBA 4LNHA 1SB8A 4JUCA 2O7NA 1KAMA 2PUHA 4DA7A 3K70D 5H83A 1DIAA 1JAHA 1N2CE 2J87A 1HO3A 2V7XA 3PPXA 4BQRA 2HA7A 1AKWA 2D2VA 4DFDA 1NC1A 4RH3A 5AJUA 3TG2A 4DB4A 3GFQA 2EJUA 2GD6A 4OQZA 4ZAVA 1I80A 1JQEA 1PKXA 2ZBVA 5EMKA 3BJRA 3VV2A 1BC5A 3AIIA 2I6XA 2PKWA 1IM5A 4D26A 2Q3CA 1JE0A 2XWSA 1JHOA 2RE8A 3TW8B 3ZE7A 4BIIA 2V4MA 2CJXA 2V6GA 1K5PA 3H5LA 1T9ZA 4R31A 3ND9A 4CKZA 5AJHA 2FHPA 3JQEA 4L72A 1ORRA 1A72A 4PGAA 3TPFA 4QULA 2QX6A 2NT4A 2VDQB 4CODB 4NENA 4L3WA 1NJ8A 1SRQA 3GB9A 1ZD8A 2ZUUA 4CM1A 2PZBA 2R8OA 2C5HA 3KB1A 4EB6A 5ALPA 5BV8A 4NCNA 1GKLA 3CZ9A 1T5HX 3L7LA 2ACWA 1C41A 1AB5A 2C8JA 2RG1A 5AYVA 5KYNA 3WWCA 3NWEA 3B1VA 4DCTA 4UREA 3T38A 4BECA 4ZRDA 1RIIA 2YXDA 4X7BA 1U2DA 4L15A 1W6RA 4AIRA 4K46A 3STWA 3T0FA 4AP5A 3EMKA 4QO8A 2B8WA 2OQIA 4JSRA 2AMJA 4WH0A 2C4KA 2OP1A 3AINA 3C2QA 3CO0S 4OLHA 4RD3A 4RTJA 3N0RA 3RBZA 4AYTA 1EP3B 2H57A 1WR8A 4IGAA 3MJFA 4MROA 2YICA 4S35A 3IP7A 1EX9A 3IL2A 1IVNA 3EY4A 2FAXA 4FUQA 5ALTA 1HYEA 3ZDYB 4AKHA 1PQWA 2FY8A 2I8AA 1JAXA 1U7PA 1NBAA 2IIBA 2PH5A 4IV8A 5FXMA 4C7OB 3M5WA 1GUZA 1N5IA 1PWHA 1TCBA 5IHXA 2OR3A 2RHOA 2ZKIA 3DFKA 2IQIA 4BP3A 1DKLA 4UUMA 5KOJB 5EOVA 5ELXA 4ARIA 4MW6A 2VOEA 3QU5A 4DC1A 4K6CA 1KVUA 2PUWA 1H2EA 2PFGA 1KY2A 3K0FA 2APJA 4ZOLA 3SXPA 3TNLA 1THZA 1SXJE 3DBHB 1DEHA 3GRRA 3SSAA 1DTWA 3ZLJA 4JAVC 4WFKA 4ZOLF 5ALZA 3FPAA 1P0QA 1YZVA 2R1TA 2ZW9A 1U9JA 1UCFA 4X1KB 3VM6A 3IP9A 3BE4A 4PZCA 2OO5A 1ZI8A 2FMHA 4C6TA 3W4IA 4PRYA 1D2RA 4M1TA 1FVFA 3NBXX 4B7XA 1USGA 4C20A 2XT9A 2PLNA 1PGJA 4UCWA 1H2XA 4H08A 4LGVA 3RWMB 1B6TA 1ZU4A 3PSAA 2DJ5A 4MCHA 4ND3A 4US1R 3K1ZA 4E6PA 3P9CA 3QIAA 1XTSA 5G0SA 2ODQA 3TRDA 5IUNC 3FMGA 1C7JA 4KSCA 1Z5PA 4P84A 4RMGA 2P7IA 1WAMA 5DMHA 4Z0TA 2IH2A 2OORC 3DMRA 1MT0A 1ENPA 3HDVA 4BOYA 1DJMA 3JRNA 4GH5A 3BAFA 2DBYA 4P5EA 1HG0A 2YMMA 3H0KA 4QIHA 2AB0A 2PS9A 2ODWA 3N3BC 2CNKA 2O5CA 2V7TA 3ZGZA 2BHLA 2ZWMA 1K4KA 2XMQA 2C5AA 4X6LA 2JD2A 5EE0A 3JQRA 4IUDS 5FB3A 4ZVRA 3DLBA 3ODGA 2ZAGA 4UMEA 3BL5A 4WPGA 1QGOA 1EE1A 5FTMA 3RC2A 1P5HA 1A76A 1ZD1A 2ACVA 2VJYA 3KX2A 4O4IB 1ZA1A 4P4UA 1GTJ1 3Q15C 1U7OA 3WIDA 2FU5C 3QOWA 1HT3A 4LRYA 5AHOA 1ZM4A 4CBVA 1PR6A 1I5RA 1U5AA 2BKXA 4OA8A 1ZA2A 4AK9A 3PXDA 3TNJA 1SXPA 2ZRKA 2NP6A 5JH7A 1TKCA 2ZSFA 1NQWA 3KWJA 4JA0A 4HBZA 5EXSA 4M1EA 3HXTA 3NKFA 1O4WA 1WCIA 4PGMA 2I54A 4YNBA 2QRZA 4QD3A 3UAXA 4LZNA 3TSYA 4N7MA 4E5MA 1IB6A 2I7DA 2C31A 4A6DA 3CRZA 3NUZA 2OO3A 1E77A 3EIXA 3PC7A 4WADA 1IC6A 4BO9A 4G9GA 4BNGA 1S2NA 4LV8B 5A02A 3IA2A 1HZZA 4MI3A 5KQSA 2I9KA 2YFHA 3GA0A 5EXDA 3EMDA 1GTSA 3D0RA 4CKXA 1F2UB 3AIMA 4FDUA 5BSWA 2FSFA 2HMUA 3D3NA 2G82A 1SCIA 2HSEA 2Z04A 3E81A 3VVLA 2P5UA 1SCDA 2V6JA 3W1EA 4EABA 2KPOA 3QEJA 1YR3A 2IA5A 3ZQ4A 3JAMA 3UAVA 3SF8B 3V8MA 2VR1A 1E9RA 4MULA 2B8NA 4NICA 5G0TA 5JPIA 5LDGA 4PC1A 4F9FA 4DV0B 1EJ2A 3N2KA 4OBEA 3CFYA 2ZVQX 1E6CA 2C1EA 2HWUA 2IP1A 1D1SA 2JRLA 1B43A 2Q4OA 3FKSD 3OQIB 2QAGA 4WL0A 1RXYA 2GPWA 3DZDA 4IIYA 3W05A 4RPLA 1ZHFA 3UPDA 3NX4A 4OHBA 4UMFA 2ZJFA 4O59O 1VTKA 3K9CA 1E3EA 2BLNA 4OB6A 2R4UA 1TQ2A 3HV0A 3DKPA 1Z5WA 3Q3IA 3QXCA 1IPFA 3HZHA 3ELBA 1J23A 3GP5A 3LYHA 1EDZA 3FYUC 4I66A 5LC1A 1NPYA 5I7VA 1HNNA 2Q9UA 5ESRA 1C9NA 2QV7A 3BG5A 2D8MA 4E11A 4YV0A 4N5MA 5IJ9B 5INTA 1L9XA 1OH6A 4H7JA 5LBTA 6GPBA 2M6SA 5CNJA 4QU8A 2JFGA 1VIDA 1P80A 2P5TB 3MJRA 1KMHB 4IDGA 3JD3A 4E13A 2M1XA 1ENZA 4GSYA 4BX3A 1XMOB 3REFA 4YUXA 1OPRA 3PL1A 2BF4A 1C9MA 1TJ5A 2F1JA 2GN4A 3OTIA 2OQ2A 4URFA 1FLNA 2WMDA 1THMA 3KQOA 2GCPA 2WKQA 3FWPA 2COEA 1FW6A 4J07A 2VDOB 4OJYA 1UFKA 4KQ6A 5IJ0A 4HYQA 1BA3A 3BCRA 5IDVA 4L0DA 1ZXLA 2XT0A 4J90A 3WLHA 4B4DA 2VJAA 3S27A 3HJCA 2DQZA 2PMDA 1VCNA 2GYUA 4JHXA 5EY5B 3PFGA 4QG3A 2VPTA 4JBIA 3U17A 4UVEA 3ZTYA 3KVOA 3KEMA 5JZ9A 1JLHA 3COPA 5LBUA 2AJDA 2VJMB 4R40A 3CZ4A 1VGRA 1CQWA 1E5DA 2G88A 4EZBA 4Z4GA 5TJ9A 4R8SA 4YMTA 1SXQA 1UAAA 2VBCA 3ORFA 3RRBA 2WT4A 3R4VA 3UANA 3CHYA 3MBIA 2XB4A 4FYIA 4KQGA 1MO6A 4ZICA 4NBSA 1DTEA 1PGOA 3M33A 3DZKA 1CDOA 3C8ZA 2XUZA 3K73O 4LHVA 5NLLA 4UXJA 3V46A 3FOAA 3K9BA 1XDWA 2C03A 3X2SA 4CTNA 4DLLA 2JIZD 2BZ1A 1PW7A 3FTEA 4JUAA 1RCTE 3TD2A 1JMYA 4BKUA 5A5EA 4Q7MB 1A7KA 4IJWA 1E0JA 2GK7A 3VJMA 3NNDA 4ZKEA 1U65A 2QENA 4W9NC 4RTPA 3R7WA 2CVQA 4ZCIA 1RQXA 3C43A 1TAQA 1Z17A 2QRPA 3LFUA 2GUWA 2I4NA 2V7VA 4PHTA 3JVEA 1NMXA 2C88A 3GGSA 3B13B 2CSXA 1NYRA 1VE1A 1VSQA 3BREA 4FQ5A 5CVDA 3UH1A 5BNZA 4LE1A 4NJEB 5IZ4A 1VHTA 1VXRA 1F0KA 2IZOA 3FWZA 2HK7A 3MWYW 4KWEA 1X7ZB 3I3SR 5DK4A 4CEHA 1Q7GA 2OLJA 3DLHA 3GHYA 4RANA 3CZMA 4IVRA 4TMTA 5ARCA 2JLSA 4NDAA 2B8JA 1YMQA 3JD2A 4YMWA 1E3DA 3WDKA 4U7DA 3R0QA 2XNDD 3TM4A 1XHFA 1X8KA 4X3PA 4GGPA 1NY5A 4RYLA 1NVUQ 2YWJA 4O4HF 4G0WA 1KRWA 4QYIA 1ZJYA 2BZ0A 2B1GA 1LX6A 3SHOA 2GFIA 1OI4A 2ECQA 4EEKA 2QG6A 2MOKA 2P0YA 3DXFA 5T6MA 1XQYA 2OZLB 2QSJA 1QYRA 3SSOA 3HKEA 3WLLA 4DILA 2MINA 4EG7A 3QPCA 4L73A 4LHEA 1EFRD 1I0IA 2C97A 5HFNA 2BFNA 3CISA 1Q0UA 4KGVA 4REQA 4ARUA 1LRKA 1E2FA 1QZ3A 1B3BA 1WF3A 2I03A 3OCCA 1YFJA 1W49A 3DWFA 5HJ2A 2CXTA 1VYUA 3K5IA 4BKOA 4AWXA 2FW6A 4ZODA 1M2VA 3EBLA 4AB1A 1ZGZA 1Z4NA 3GGPA 4MQLA 1JUDA 4CF6A 5FTNA 4KYUA 5IFLA 3Q6MA 1KC1A 1X13A 1UUFA 3WHPA 4P3PA 3OD1A 3ISTA 4CLRA 3H6HA 2KBEA 2QL6A 5DWQA 3AUFA 2XZOA 4KFRA 1MJHA 4KFSA 5TE9A 4PX9A 2QY9A 1R4NA 1U1DA 1M76A 4AG6A 3HXOA 2D8AA 1K5DA 2D5CA 4KMRA 1BCSA 3QFRA 2IX9A 3UXYA 3U3JA 4BQOA 5F2EA 5JCOA 1NBMA 2HR1A 4QQ8A 1R6DA 2QRNA 3B78A 2DHQA 5TF0A 2FEPA 1Z4MA 3COSA 2O50A 4MHTA 4IHJA 3KYJB 4UNPA 4JYBA 3KQWA 4PYRA 1ZRHA 4K9QA 2GDJA 4ZOQI 5E95A 5HA5A 4E31A 1XLVA 2GA8A 2PL5A 1D2GA 3KXDA 4RFVA 2HA6A 3RC8A 4IH1A 4CDMA 5EHGA 1ILWA 1S4QA 3D4BA 3ZV6A 4BYGA 4F56A 5IU6A 2FWAA 1H0RA 2H7YA 4NZZA 1FA9A 4HR7A 2YV5A 3R8XA 1HM5A 2ZU0C 2B6HA 4JJFA 4KI0A 4RESA 1AUOA 3ZLUA 4EGFA 5CGZA 2UUCB 1LK0A 1M5UA 3PCTA 3BXZA 3I52A 3CF4A 2X19A 3LO8A 3TRFA 4MQUA 3TBKA 3C4VA 3MS4A 1HTTA 4COKA 3Q7IA 5HF9A 3BRWA 3HMKA 5LLSA 2H85A 4AP6A 2MU1A 1YU9A 3C3BA 2WQ6A 1D03A 3WLSA 2BGNA 2P6NA 2MDTA 2WHPA 3DFUA 3PXEA 2CNWA 5BW5A 4ZJYA 4G9BA 3GROA 4L07A 4A8TA 1I6WA 2Q5HA 2Z83A 3EOBI 5HOQA 4YLEA 4M9UA 3UPTA 2PUVA 1U8CB 3D8BA 1OFVA 1RFLA 2Z1MA 1YNSA 1JSXA 3GVPA 1NAHA 2Q4DA 4NMHA 2FETA 3OLVA 4Q82A 3TR5A 1HDZA 1FVOA 2XODA 4BNDA 1BW9A 1HFJA 1OC2A 1ESCA 2R8ZA 1N32B 1NR1A 3N59A 1JTVA 4RA9A 5HKKA 3I28A 3OLCX 3AM5A 4BLQA 3OFKA 2Y8EA 2GAFA 1LBEA 1RJEA 1WKBA 3IR6A 4JUBA 4DM3A 3MLEA 5LZ2A 2ZAYA 3I04M 3QVKA 3MG9A 1XTVA 4CIBA 3D6FA 3LM8A 3TTXA 5CA1F 1R0SA 2W6ZA 3KKPA 4UFOA 1D09A 3ZGOA 3LDHA 3G7NA 4NCKA 3ETDA 3A7EA 1IY9A 1V8PA 1HLPA 3KLBA 3TSCA 4D9BA 5CD1A 3PDIA 3DL0A 4PZAA 3PJRA 1ND6A 3ECCA 3ZW7A 5LU8A 1T5SA 3I83A 2EX4A 1O0CA 2QXYA 5ECYA 1G8AA 2BJHA 4IDFA 1NRXA 4ZVNA 3JV7A 3KZVA 4PLTA 4Y30A 4EGAA 2NMVA 1R4MA 1WSWA 5B53A 5KAPA 2O05A 1UK7A 4HX5A 3WIOA 3ONEA 1PR4A 4KDFA 1G8SA 4DCOA 2IK8A 4AVYA 4YRTA 2WJVA 4CU2A 4DMGA 3Q7TA 5A4KA 5DHUA 3IJPA 5P8WA 4POOA 3SZMA 1FP2A 5IEJA 1AZWA 1WUJS 5I4KA 2E5FA 1JG1A 4QJIA 2A84A 2HJGA 3CH7A 2DF8A 3EWNA 5B57C 3LGAA 5BNWA 2I6TA 4LS3A 4E33A 3OZIA 4IKEA 5ITSA 5IVHA 1QLJA 1CUFA 1ZMRA 4NZNA 5I9IA 5KSOA 3OFND 3EH2A 5AKZA 4BB5A 2ECKA 3WQHA 4PAWA 3ZVNA 1XVTA 5U4XA 3EEFA 4LZZA 4F8EA 3A4LA 2BC9A 1JW9B 2WJWA 3FOWA 4NPHA 5FOVA 2Z1DA 5B1EA 2X8WA 3LKZA 2FCRA 2ZSUA 4B2LA 1S8FA 2RSLA 4D81A 4MWDA 4G5GA 2BBTA 4AZWA 4J0QA 3RU9A 4A2QA 2VNKA 4G0XA 3UJBA 3UK7A 2A5DA 3WC4A 1RYHA 4F2WA 4UUQA 4KG7A 4WZ6A 1KZ7B 3CXRA 3D02A 2DTXA 1ZGBA 3DMDA 4FOSA 4A5OA 3UJ9A 1PHRA 2DPYA 3N7TA 3JZFA 4G0ZA 2CCKA 1C30B 1FRNA 1N7IA 1OLUB 1QG2A 1SC4A 1SVKA 2GVZC 3HSYA 3C5EA 2FF7A 2CMGA 1OZAA 3N0TA 3PCRB 4PYMA 4CF3A 2FR8A 4BWGA 1TCCA 4NMMA 2Q0XA 4EI8A 1E8DA 5TQ2B 1PJAA 3Q7PA 2Z08A 3GFBA 5AWFC 1MORA 3W90A 2X5OA 4J16A 1DEOA 2AG8A 1U4SA 3O8DA 1OXMA 1NVMB 2P5YA 1H6CA 2GBGA 3GJ5A 1PT9A 3M5PA 2C92A 3KIPA 4O6VA 3UOAB 4OQLA 4F2DA 3H2ZA 4NP6A 3T7JA 3O1HB 3PKJA 3ZW8A 5FWXB 4ZYTA 3CH6A 5KIAA 4G5YA 5CB4F 2JDIA 3PGVA 4IHJB 4OP1A 4U2EA 4K2AA 3DYVA 1TW2A 3SQWA 3FSJX 1QUFA 1N6LA 4XEHA 2RONA 5CX4A 1GCGA 4U2KA 3IUBA 5LOVF 3NIBA 2R85A 4WZAA 2G8NA 1YH3A 5DW3A 5LYJF 1T10A 3PEUA 3A14A 2GFHA 1BFUA 4L0MA 1P2SA 1P2TA 3W8FA 2Q5LA 3DE6X 3KJQA 2WWGA 2IC5A 1JFRA 3IQIX 2B4YA 1NLFA 1LLFA 4NCXA 3RRZA 2DQSA 4U0KA 1AF7A 2M1ZA 5SY4A 3QVJA 3LC0A 4BNWA 3MS7A 4DY4A 3SOPA 4B43A 3TOSA 4IGKA 1Z2DA 3HVIA 4R2XA 3CF6R 4TL7A 2FN8A 4OI2A 1OHHA 2QRMA 3ZVMA 1N8NA 2OHHA 5EQTA 1E4YA 1LQTA 2WFZA 3I34X 1Z29A 4PSDA 2H0QA 4HLUA 4LSMA 4BU1A 2PBLA 3GLGE 1H8HD 4HPXB 2YNMC 3AERA 1NBEA 3K09C 3E7FA 3HBLA 2ECPA 3ZE8A 4X45A 3IDSA 4BFCA 2XBLA 3VDRA 3PI7A 3T54A 3WG9A 1VLZA 4EKEA 2XB2A 4M55A 1CDDA 1W581 4JCOA 1EK1A 4XLZA 4BFZA 3H9BA 3GEPA 3T34A 4GS5A 3WNDA 1VKNA 1N0HA 2JLCA 2ORWA 2YNMA 4OYHA 1MA3A 4TS9A 2R6R1 2WIFA 3JCZA 4ALIA 1ORIA 2X6RA 3ASYA 3U3MA 1MOPA 5FUWA 4AMVA 1G6HA 2CXUA 3W3AD 5ICSA 4FNOA 1PG0A 5EXPA 3IQFA 4WKNA 1XZIA 3U4GA 2AGVA 5LR6A 4RDXA 1NV8A 1A69A 3CVWA 4P4SB 5DLQC 1A9RA 1JDUA 3SHWA 3EYWA 4IF6A 3KPJA 2H1IA 2XBUA 3KAQA 1ZL2A 2NNWB 3OJOA 4Y2JA 1QYCA 2NACA 2ZBGA 3HNRA 4D4MA 3DXXA 3S70A 3BMCB 4NBWA 1EXNA 2LDXA 5GONA 3RBAA 5DWDA 2DERA 4X6UA 5LU9A 5TNXA 3O4VA 4GVPA 4NJMB 1WZCA 4JOBA 3WMGA 1WLSA 3VJLA 5HEKA 2QMHA 3CZRA 3KWFA 4YYZA 4D9GA 2CLEB 1CJMA 4AMBA 3U61B 1BMTA 1E6WA 2DHRA 1LTQA 4I5FA 1XZCA 1FS4A 2X0KA 3NQ41 3QVXA 3DC2A 3LL4A 4NG5A 4HRXA 4LI0A 5HCNA 5LYYA 4YRKA 4BDSA 4CL2A 4MYCA 4UE6A 4QBIA 3ROEA 5KS2A 3RRMA 4WNYA 1UEIA 1CY7A 3NOQA 3R0VA 3TO5A 2PH7A 5IKPA 1GRNA 1N6OA 2WBLC 2A3RA 1CUXA 5EJFA 1FQOA 2AG6A 2JAQA 4YJGB 1CZLA 1YK0A 3QUQA 5JNSA 5I9SA 3A6PC 3K9GA 3WB9A 3CTMA 3ZN2A 1KOJA 1NQUA 1Q16A 1XL0A 2ONZA 3I8OA 3IV7A 1P0CA 3OUZA 3U49A 2R6JA 4R1SA 5AK0A 4ER0A 3FTFA 3JRWA 3BB3A 3J7TA 5JCJA 4B3GA 4MLZA 2PNFA 3ZC3A 1JG7A 2YUTA 3IOEA 3NO4A 2XUFA 1REQA 5LQSA 3O91A 2QVCA 1CR0A 1G42A 3DF9A 3I61A 4K2HA 4MYRA 1TT7A 2JVJA 4R0VA 4QGBA 3DZJA 4Q3CA 4BWFB 2DWPA 2JIZA 5MFZA 3G5AA 1WPQA 2OFOA 2XCLA 1JU4A 1LSUA 1NATA 3HPQA 5D85A 1ICEA 4CQMB 1EZZA 2IEYA 3BEOA 4X94A 4XYMA 5EUBA 1ZM9A 4DLYA 2FPMA 4G0NA 4GI1A 2NWQA 1J8QA 1ESEA 4NEHB 4MUAA 1R5JA 2QYOA 1XA3A 1AIPA 2P6PA 4PIMA 5IULC 4BMXA 2F00A 1SVNA 1NQAO 2HEGA 2GERA 1DLJA 3CSUA 3KSZO 2BMFA 1CUWA 3NCHA 4XW2A 5J59A 4AJIA 4EECA 3A3OA 5C37A 2PKEA 4DV4B 1E2LA 4KV7A 5GV8A 3WSWA 1PDOA 4UUAA 3L6UA 2WTXA 3ZZNA 1GDTA 4R7TA 5HZKA 4HRYA 4F5WA 2X5KO 1N6NA 3E4DA 1KDTA 1OI2A 2I66A 2Q99A 4J4BA 1QHHA 3N6XA 4EPYA 2AKYA 3PSHA 1H22A 1KEEB 1W4CA 2I99A 1A9PA 1PJ3A 2JNWA 3UJPA 1KI7A 4CV0A 4PNEA 2OB2A 4MS1B 5EPEA 1TK3A 2H8KA 2QYSA 1YOVB 4G37A 4XVRA 1MA0A 2YX1A 1R9JA 1AV6A 1D2MA 1Y8AA 1QHXA 3S0JA 4V1CI 4X3OA 4ZYYA 5KTOA 1NX9A 1QV9A 5CITA 5I9LA 1ADYA 1J0XO 1NFQA 1C3OA 2C2HA 3JD1A 4QATA 5AW4A 5TVGA 1FFHA 2W6NA 1CUGA 5ARBA 1UKBA 2FCAA 2GD0A 3NU1A 1KTVA 1PSDA 4KOEC 5JXGA 5HM6A 3MBOA 1XCJA 2VZLA 3O5AA 4IDNA 4QNNA 1FS5A 3TLBA 2HCFA 2O14A 4Y2PA 1EX7A 4Y9UA 3HCCA 3UAYA 1KWKA 4DKJA 2JJ1D 1L4NA 2JKZA 2CUKA 1V2HE 2XA1A 3GFVA 1OGYA 3DAHA 1P5FA 5KC8A 3GRZA 5P21A 4HG2A 4X0EA 1QP8A 1ISRA 5KQPA 3D1VA 4Q9HA 1I6KA 3WL4A 5T7BA 1YKGA 3EXIA 4B40A 3AYXB 1EZ4A 1TIBA 3HDTA 3C1AA 2I65A 3COYA 3E03A 4HAOA 3QKSB 2OYRA 1EQUA 3PQCA 4IEEA 3OCXA 1I3CA 2EZ9A 1H1TA 3B89A 1BHSA 3CCBA 3O3MB 3D7RA 2IHYA 3IJEB 5CK5A 1QIFA 2RCNA 4E4TA 4EK9A 3QVWA 1L7OA 5KVQA 1O87A 1U0LA 5GOTA 1PJCA 1Y8CA 3AUUA 4TZ0A 3FJ1A 5LKAA 4ZO6A 2QR5A 4Y18A 3OCWA 1KU6A 2EJVA 2PZGA 4CL0A 5I6DA 4QBFA 5A6SA 1P19A 1WY7A 2VBIA 4TTTS 3V1NA 1EE9A 3P5BA 1SVSA 4LYDA 2WLSA 3BQMB 4O2BB 1NFFA 2ZYAA 1A8IA 1M83A 3RFTA 1CY6A 2C9CA 1UJ6A 2O5VA 2ZQZA 3IQDB 1N2XA 2I67A 2N3ZA 3M5CA 3M6FA 3QVLA 1MAHA 1V1JA 2F3RA 3UXMA 1P74A 2FZCA 1KETA 2NPIA 3SIXA 3GW8A 1ZP6A 3BYZA 3RSFA 1EWTA 1PD1A 3EDOA 4BVHA 2A4KA 4DG8A 5BSVA 1E0DA 5JMWA 4ESVA 5F33A 2VPWA 1XRNA 3DVLA 1DRVA 3JWJA 5LZ4A 4NK5A 3FTDA 5GJCA 1Z6YA 3UFXA 2ZT7A 4DNXA 5J1SB 3R5KA 4D9FA 5FP0A 2O0HA 2VF8A 1DCMA 2XQIA 2YYYA 1QSGA 2PSJA 3LRPA 3UK1A 2CMHA 2I6SA 3S2EA 3T52A 3DW1X 3TZHA 2HGZA 2YRWA 2YZKA 4XCXA 4TUYF 4CZ2A 3FNBA 2QZPA 4A5SA 1NTOA 2Y4OA 1JLKA 4LOKA 4EAAA 2PK3A 1CF4A 4PU0A 4TXJA 1M6WA 1U8UA 2WG1A 4W5HA 3OAAD 1K6IA 2FG6C 3T41A 3BTSA 1PEDA 5CAEA 1T9GR 1M34E 4ESOA 1YRWA 1YR6A 4Z5XA 4CM5A 3N0XA 1GDDA 4G4SO 2VJKA 1X9GA 2HPVA 4DAOA 3G89A 3BH6A 1KYYA 1UXJA 5AOAA 5JFGA 4JB8A 4RK0A 1X19A 2EU8A 2EG5A 3EXG2 3WSVA 4B9EA 4D6YA 3I05A 5IXYA 5IVKA 4CFZA 2V97A 4M6WB 4UTVA 2QL9A 1QE3A 1X2EA 5ALLA 5IN5A 4AJ9A 4LXQA 5BMVF 1UBEA 5CHYA 4G97A 3H1EA 5A4DA 3BSWA 3PQ7A 3OKPA 3JD0A 2PU5A 3IC5A 4QOFA 2JANA 4AKIA 1O9HA 5F5NA 4ND1A 1F0YA 3MXTA 1MAUA 1E9DA 3U19A 3JYQA 3V4SA 1WEHA 3STVA 3OPXA 1CQIB 4KZKA 1XA0A 4BE4A 3PK0A 2ZREA 4L5CA 1P8AA 2FWIA 3AJ9A 3NI2A 1ESNA 1QOPB 1V41E 3AI3A 1R0XA 3M70A 4I8IA 5FYDA 4F97A 2V3WA 4N3AA 2EZTA 4MVWA 4FFDA 3OSZA 1P9RA 2CXHA 3IDFA 1CRLA 1HI9A 1KI1A 2XLBA 1ZD3A 2J0QA 3AEYA 4YXWD 2ORIA 2REXB 2AZDA 1FJHA 2FWNA 1REQB 3DLAA 4YJFA 5T5QA 1JFLA 1VYTA 2ZE5A 5JFOA 1RLIA 2RD2A 3QEMA 4ZO4A 1YWGO 3H2YA 5IBQA 5I5GA 5KNBA 1SN7A 5HSGA 2OCAA 1V3VA 4RMJA 2XZLA 2Q5JA 4GMXA 5FQOA 1RLMA 3L8CA 4V0QA 4YPFA 5WRFA 3FUCA 3T1VA 4QDKA 3NEPX 3DMHA 3LS2A 4E32A 4FCVA 4P82A 4D43A 3HFJA 2R8XA 1DO8A 2Z5LA 2PLFA 3EXEB 1EVEA 4YGXB 4K6FA 4DEVA 3DL2A 5K3OA 4E08A 1UP6A 2XDAA 4UMVA 4LDZA 4GMDA 4GX0A 2VRCD 2WKWA 4IDCA 1OAKA 5U1PA 4HX9A 1BG6A 1WVIA 3KK0A 1JA0A 2QI9F 4HXEB 4QFMA 4Z1OA 3EVEA 4FXPA 1OFHA 4QNRA 5KREA 3HU2A 1NW4A 1J0AA 3I5MA 4G89A 1TW3A 3RAPR 2UUPA 4B34A 3KZOA 1Q6ZA 1ZJ5A 4L4YA 2H0RA 4MPJA 3RYHB 4BNNA 1ZJJA 5BWBA 1R8QA 3E8MA 3DTVA 5H9WA 3SR4A 1Z75A 4CG2A 1C7ZA 5HS6A 4V0MA 2VH2A 1F1JA 1OX4B 4ZCPA 2W4QA 4CKEB 4MVJE 2OV3A 3LMKA 4PO3X 5AK3A 3WGOA 4KHPB 5EJAA 4L1KA 3E9YA 5HKLA 5T4EA 3SSNA 4CCYB 4I4LA 3TNDA 4B46A 2C2MA 3ZLBA 5KTPA 4YCLA 3T4PA 1DIOB 2BGKA 2DKOA 1ZQ1A 1ZWKA 1JJBA 4GUAA 2W83A 3RVNA 4DIFA 3SE0A 3ZY3A 1XTJA 1KI6A 2Q27A 4NX2A 3SC4A 5JCZA 1KERA 3O31A 4EPTA 5BVGB 3WYNA 4A0SA 2C4UA 3OO0A 3W7AA 2J32A 2AYZA 1C3JA 2PBRA 1KPHA 3GZNA 3KP1A 3N8HA 5E4FA 2R6AA 2JCGA 1VYVA 4ME6A 2QX7A 3IO3A 4H7IA 4OQMA 4MKRA 4L78A 3SM9A 2VOJA 2CBXA 3I9JA 4N40A 2OEPA 4PPQA 1RFGE 3M6MD 1JLLB 1PDVA 2HN9A 2CB9A 4RNCA 3EHEA 4ZC1A 1WHTA 2PCJA 2Y0EA 3VU1A 4C01A 4RM3A 3ZQJA 5A9RA 2UUAB 4TSRA 2JLAA 3ESDA 4L5JA 4ARCA 4MINA 1NHGA 2O2YA 4G0OA 1FP4A 3C3MA 3OHMA 4P80A 1NWCA 1DC3A 2P4SA 4K28A 2RG7A 5MN4A 2Y76A 2J9RA 4X65B 1D8TA 1I9GA 1VMAA 2PWAA 3C6XA 4KWTA 3SSMA 2XMGA 4ZTZB 3T7AA 4TVKA 3CVXA 3PQEA 2OCLA 5G41A 3LTEA 3ICCA 1TEZA 9MHTA 3FI9A 5CVUA 4NS1A 1RHJA 3HB0A 1S4MA 1XIVA 3I2KA 1RKVA 5A71A 4HWTA 4KQ9A 4HUQA 1DBWA 1RNLA 4GIBA 4RX1A 3RGWS 4E2YA 5GJVC 3EBPA 5IEBA 1EB9A 3ISJA 3HUFA 3WDLA 2X8JA 1ZU5A 1VG8A 3DDNA 5SZKB 3HCBA 2WAOA 1JFFB 3MCUA 3SVZA 1L8QA 4BLPA 1HG1A 5AO9A 2N1BA 4L2IA 4JLBA 1XKXA 4PNHA 2O8BB 1ISMA 4H27A 4B32A 3LKVA 1GADO 2PM8A 4Q21A 4DYDA 2R7KA 4R1TA 3E2PA 4MWTA 4Q0MA 3FR7A 5FJJA 2Q45A 5K6TA 4MHSA 4PF1A 4TVOA 2GS9A 3IUJA 4UPDA 3ZI0A 5KKCA 5EP4A 2FB9A 1FTGA 3DT6A 3VR6D 2B98A 2JKYA 1YS1X 3K94A 5DI3A 3E7DA 5DK6A 4XIYA 4UUBA 1BX3A 1SBYA 1FDTA 3AR5A 1HFWA 1L4BA 2OXFA 4EVRA 4JU9A 1ZNZA 1Z74A 4DCSA 1SC1A 1KSFX 2NQ2C 5AQEA 2XDQB 5ITZB 4Z4FA 4TZ6A 1FIUA 3AIOA 3NH6A 3E22B 3ZR4B 2WIJA 5BWLA 4OJTA 1QIGA 3OLZA 5GPBA 1ZK3A 2Q9AA 3WJAA 2C9YA 4Y1RA 3B7GA 5JS6A 3D2BA 2OMEA 1RABA 2DFLA 1CR2A 2AOTB 3II6X 1R27A 4YPVA 2IYQA 4LTDA 5IYZB 3BE5A 1LDMA 2CJPA 4AU1A 1K7EB 1FS6A 2HDNB 3FCOA 1JALA 4JVMA 4FHEA 2NV6A 3G6KA 4YDQA 1LVHA 4WFJA 1A0OA 4CKCB 4WHMA 1V95A 3TINA 3N2ZB 4JDPA 3QKTA 3NEJA 4C3OB 2IS2A 1CULC 2QAJA 3B7WA 2JFQA 3UJ8A 1EXDA 3OHSX 2NTJA 1OA1A 3D9QX 3QNWA 1AV7A