1XRJA

Rapid structure determination of human uridine-cytidine kinase 2 using a conventional laboratory x-ray source and a single samarium derivative
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
211
structure length
211
Chain Sequence
PFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine-cytidine kinase 2
publication title Structure of human uridine-cytidine kinase 2 determined by SIRAS using a rotating-anode X-ray generator and a single samarium derivative.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xrjA00
3WRYC 3D31A 4MYUA 5CJ2A 3ZS8A 3R9IA 1NY6A 3AP3A 4G5RA 1T3LA 1OFIA 4A0HA 5LPNA 3RANA 2VF7A 3EG5A 4KLZA 3ZIAD 1ZD9A 4B33A 2RKOA 2BBSA 4LHZA 5EQTA 1S9HA 2IWHA 1HTWA 3GJ8A 4W7SA 5D3MA 3GLHE 5J5CA 3VKHA 2HDNB 1G8HA 4EPTA 1SKQA 5FOVA 3FTQA 1ONBA 4A2PA 1P75A 1ZYUA 3LH5A 1ZU4A 1BMFA 1GAJA 1F6BA 2ASEA 3BFKA 5LD2B 1DAIA 4KVAA 4I1OA 3KTAA 3CNOA 2CNWD 3WMEA 4BECA 2ZRBA 4DUGA 1AS2A 5C4MA 1UM8A 3THXA 1S1CA 2OO7A 1U0HC 2ZITA 2W2TA 1Q57A 2ZU0C 3BRWD 2P0EA 1G8PA 3JVVA 4ZKEA 3R9XA 3ADBA 3J81k 2QP4A 1TQDA 4D0NA 1XPRA 3A1SA 3FKSD 3K0CA 2FGKA 4TMZA 1LV7A 2J5XA 3MD0A 2IS1A 3C7KA 4LYAA 2HLDA 4KFSA 2WICA 3BJIC 4OQMA 4PPNA 1VCIA 2WIAA 1E9BA 2B7CA 3TQCA 1R5OA 2PLFA 1G19A 2VP4A 2H8KA 4JLDA 1DAFA 1OJLA 1CEEA 4PHTA 2DR3A 4V0LA 3VAAA 4YQFA 2NQ2C 1TQ6A 2JLXA 1UBEA 1R8SA 4M1WA 3N70A 2QAGB 2UKDA 3IQXA 1AGRA 4FXPA 1RJ9B 1XD8A 4NZYA 4PQFA 1E9EA 4V0ME 2GJ9A 2IF2A 4E09A 1BKDR 2HF9A 2GJKA 1Q22A 1AQYA 1AM4D 2QMOA 3QKUA 3T1OA 121PA 2YJTD 5G41A 3IEVA 1LY1A 4WVFA 1VYTA 4DLVA 2ZAOA 4U02A 3F8TA 4EPWA 1EFCA 1CR2A 3IDQA 4HB2A 3W6NA 4HZIA 1DAHA 5G53C 1D9ZA 2RHMA 1JB1A 4TYQA 1NVUQ 3B9PA 1ZU5A 2AXPA 2MSDB 5JS7A 4RVCA 3M4YA 4GZMA 1V43A 5JEDA 5EZ6B 2EYQA 4R7ZA 1Q20A 2WMOB 3S1AB 3MLEA 4RZ3A 2WM9B 2QT0A 4V02A 4KV9A 1DO2A 1N6OA 3ETLA 3GJ3A 4HEJA 5F3WB 3H84A 4V0NA 1KSHA 3QJYA 4D0GA 2BKEA 1ZW6A 3OE7A 4IVQA 1RE0A 2OM2A 4BFTA 3BK7A 4EFNA 3I5YA 3N2EA 1WA5A 2ZREA 4KFRA 4MGIR 4L15A 3TIFA 4CDGA 3QXJA 3B7GA 1OHHD 2Q6TA 1FP6A 3ND9A 4AG5A 4RCYA 2PL3A 2VP5A 2DPXA 2O8FA 3OIVA 4GDFA 2NO0A 3CRVA 2XSZA 3X1YA 2VP9A 1DADA 2O8FB 2OLKA 5GVRA 5JLJA 4P4SA 1P3JA 2ZE7A 3G0HA 4ASUA 5JJKA 2OZEA 1P2VA 2DFTA 3C5HA 4KFTA 4W5WA 3K0FA 1AS0A 4NHOA 1SVIA 1ZIPA 4DLZA 1ELOA 1K5DA 1OKKA 4JVSB 5CK5A 1G7CA 3MWLA 4DLSA 3CR8A 3DDCA 3A6PC 1GNRA 3UPUA 1WMSA 3P4XA 1XZPA 3LX5A 1CP2A 3U6BA 1VG0B 4OQLA 4Y0VA 3F0TA 4Z8XA 1QG2A 1F60A 4PAQA 1C4OA 1OXSC 2HV8A 4N0EA 3ZVMA 1MT0A 1E79D 2OUKA 1VMAA 2OAQ1 4Q00A 4AURA 4D4LA 4M0LA 4LHVA 4MGKR 4Q21A 1YR6A 5EXPA 1QHGA 2LKCA 1E3MA 3TSZA 2JLYA 1CR0A 1ZUHA 2Q0HA 4G5QA 4B2PA 3A1VA 3ZLJA 1OB2A 4JBYA 2XB2A 3KKMA 2OESA 4IOMA 1P72A 1H8EA 2GA8A 1OPXA 3O8RA 1N0UA 1G7RA 1LB1B 4P3YA 5H70A 4PXAA 5C46F 4MRRA 2VA8A 2Z4RA 3EW9A 2BM1A 5LB2A 1H8HA 4NE2A 3GQBA 1Z6XA 2ZI5A 1WQ1R 2O0JA 2V7QD 2WVJA 4HAVA 4QBIA 3QPVA 3I3SR 1S3GA 2BBOA 4G01B 4MKFA 3M1IA 3LDAA 4QGAA 4BASA 1F2UB 2Q9AA 4Q19A 3EWAA 2ZYTX 5FTLA 2L0XA 4KAXA 1TAGA 4A6XA 2ZS9A 5BWMA 1G64A 4GPTA 1VPLA 1QHNA 4RD2A 4DSUA 3ZZUA 1Z0AA 3QXCA 5B64A 2ATVA 3AF1A 2ZYWX 2GHIA 5ANRB 1FW6A 3BIFA 4TSFA 2F6RA 4UNNA 4LYHA 2PCJA 1RVDA 1L2TA 1VDZA 1Z22A 4HSEA 4P4TA 4FCVA 4CZ2A 3OIYA 3NBZC 3FHTA 2IHBA 3I72A 4C0QC 2V6IA 1IOZA 3W5IA 2IK8A 5CB6A 2AD1A 3K8YA 1Q3TA 1W36C 1T0HB 1P2SA 4JBXA 4EPXA 2NO7A 2CCJA 3SU8A 3TR5A 3CLVA 4BWYA 4GSYA 3TE6A 1QBKC 4TLEA 1KI9A 2HYIC 1U2RA 1DS6A 4JL6A 4Q1EA 3Q8XB 3RS4A 1SZPA 1XTIA 2XOKA 3GFTA 1G17A 2GVZC 4I1VA 1FMJA 1KDTA 4ZI2A 1YR7A 2GTPA 2MMCA 1M1YE 2XITA 4PC7A 2HYDA 3CX6A 4YXWD 4U7DA 2DB3A 2VPPA 1RRPA 5GADl 3EXAA 4JKIA 1I4TD 2IS2A 3E5HA 3SDZA 3I62A 4HB3A 5JMTA 4DC9A 5FTMA 3IO3A 2CMKA 3ND8A 2I4IA 4PQRA 2RAPA 1S8FA 4FCWA 1DE0A 2A9KA 2Q9BA 2PZGA 2ZRFA 1VIAA 2VRWA 3GLHB 3GPLA 4TTPA 2EFCB 3BXZA 3DPUA 4HLUA 5IK2D 3KUCA 4IXMA 1E1RD 5FR2A 1TUIA 1SVOA 3CRRA 4OI1A 3U61B 2DY1A 2V7QA 4BFYA 1XTSA 4KBGA 4AIIA 5DNYB 4G5GA 2BMEA 3CX7A 1XZQA 1XDBA 3CRW1 2GCPA 1YQTA 621PA 3KB2A 1OSNA 3HP1A 4BRWA 4HB4A 4TYWA 2OFWA 1SKYB 4BEJA 3ICEA 3AKYA 4IDQA 1UKYA 1Z07A 5FPHA 4AD8A 5JZVA 2WPDD 1IQPA 1GKYA 4LV5B 1S0UA 2IW3A 3THYA 3KKNA 2MSEB 4B6EA 1KNXA 2MSCB 5A5GA 2X8AA 3O8CA 4IDHA 4YMTA 4LJYA 4QG7A 3QE0A 2B92A 2KBFA 4EDHA 1ZNWA 1G21E 3R7WB 4C9BA 3PEWA 4E5UA 1NLFA 4A0RA 5BN3A 1NMYA 2WSSA 2WOOA 1OH8A 4JLMA 3IIJA 4NONA 4W9MC 1Z5ZA 1XPOA 3RS7A 3ZH9B 4O0MA 1ZRHA 2XZOA 3BERA 4AC9A 2KWIA 2GK7A 3BS4A 5FPKA 3FHCB 2NPFA 3JZAA 2ZJ8A 4M22A 4DB2A 3EPKA 2WSSD 2VQSA 3WBKA 1U98A 3MG9A 3DMDA 3WMGA 4RY2A 4GOXA 1U0JA 3RWMB 4AK9A 1U9IC 2WHXA 3BFXA 3CZQA 5TXGA 2XGJA 3UMSA 3UATA 1IONA 2GAOA 3N2IA 2G83A 4TQUS 4BFWA 1E2FA 1KK0A 4M2LA 4R9UC 2O8BB 3VU9B 1E9FA 1YZKA 1U9IA 4LX0A 2NGRA 4OI4A 3QXXA 2ODEA 4G5OA 1E79A 3FOZA 1NBMA 1R0YA 2VHUA 2ONJA 3TK1A 1WBBA 1OF1A 2GJSA 1N5LA 1R4AA 5EE3A 1RYFA 3HR8A 1S9DA 5JEEA 3DEFA 2ANCA 4YMWA 3OESA 1DTSA 1B0UA 2IYYA 2NPIA 3U44A 2QMHA 2HUPA 1Z0IA 1SXJE 2O8CA 3FMFA 4P0TA 1NN1A 3TSWA 1I2MA 2XTZA 4Q9JA 1T3SA 1A1VA 5K8IA 2CXXA 2HXYA 3R8CA 1OB5A 4B6FA 1W4RA 4BFVA 4G1UC 4XIGS 1F2TB 3T5DA 4A8JA 3P32A 4BGDA 3I61A 1G8FA 5D3QA 2H17A 1AK2A 2HJGA 5KUTA 1M7HA 3MJHA 4FMDF 3WYAA 4AG6A 4EJSB 4B2IA 1I4LD 2QGNA 2QMEA 1OXVA 4DLXA 4JLOA 4HI0E 1QG4A 2IA5A 4KVGA 3W6PA 1Z29A 4I4LA 4M1SA 4W5JA 3UANA 4CGZA 3I32A 2B8TA 2PZFA 1WP9A 4C0AC 1TEVA 4Q1BA 1NI3A 3FE2A 4HAXA 2GBLC 3A36A 3SNHA 5K8TA 3AH8A 3U60B 1ZM9A 4EKDA 1R2QA 1WB9A 2W6JD 3DOEA 4FINA 3UK6A 1W36B 3HJNA 3EZ6A 2GBLA 3GMTA 5HKKD 3LX8A 4FMBB 1XTRA 3C14C 1XBTA 1VCOA 4JBWA 1G7TA 4D81A 2C96A 2FX3A 5J4LA 4D82A 2VSOA 4Q9HA 2HCJB 2NOAA 3QQ5A 4F4CA 1GL9B 4NCHA 1JI0A 2ZRJA 4OI2A 2ZU6A 5DI3B 5KSYA 2PLRA 5HPYB 1IHUA 4CVNA 1E32A 4NCKA 1TADA 2JLZA 2D06A 4WAUA 2JEOA 2C5LA 1N25A 2X2EA 1ZUNB 2A5DA 2ECKA 1N5KA 1TF2A 4PC6A 2J46A 1LTQA 2CLDX 2Z83A 3ADDA 4AKHA 4XTCS 4HLQB 2J87A 2GXUA 5KO2A 1NLZA 4BEBA 3RLFA 1D8TA 3AVXA 3S1AA 1CRQA 1MABB 2YOGA 2ZI4A 3IGFA 3MWYW 4Q1FA 1XJCA 2VBCA 1HT1E 4B48A 4XVUA 1EX7A 1XU4A 2IXFA 4IDNA 5GJCA 1XEXA 2J9RA 4QJ4A 3GJ6A 3Q9LA 4DCSA 2FMXA 5A0FA 4H9GA 1P5ZB 4UNSA 1OFUX 1E4YA 1CJKC 1E1QA 5AJVB 1U99A 1R10A 3SQXA 1NL3A 3FMIA 2ZUBA 5FBWB 3LY5A 3X2SA 4AYXA 1L8QA 1RRFA 3D3QA 2GF9A 3V00A 3EIQA 2OEPA 1DVRA 4DB4A 1UAAA 3SYKA 4G3XA 4YMVA 1KK1A 1XXHB 2WAYA 3ZJYA 821PA 1E0KA 1QHHA 2ZJAA 1G3UA 2G0NA 3PEUA 3BBPA 4LPSA 4EJSC 3PUVA 1Y63A 3EZ7A 4LDJA 3RHFA 4AI6A 3DVLA 2QQEA 2JLRA 5C18A 3B78A 2VSFA 4TMWA 4F4JA 2FWRA 1UBGA 2H5EA 1D5CA 2WPDA 3SC3A 4HUTA 1CR4A 2GZDA 2VYFA 2CBZA 3AP2A 4O2RA 1JXMA 1YU9A 4F7WA 4OHXA 1YVDA 2ZI3A 4BQSA 4TZ6A 4URXR 4LJ4A 2QI9C 1L4YA 4TLCA 5JECA 2X77A 4M4SA 4D4JA 1GZSA 4LV6A 4Q4HA 1DG3A 4PQYA 1XMIA 4JS0A 1NSTA 1X8LA 1HQCA 3TKLA 1KMQA 2Z43A 3MWJA 1AS3A 5TB5A 4C0LA 3WYGA 3U7EB 1J2JA 2PH1A 3QEOA 3GJ4A 4RD4A 4CEHB 2W6JA 3CF2A 4ACAA 1XCMA 5TARA 1NP6A 1F48A 3CPEA 5FI0B 5CITA 1DEKA 3MJRA 1CKEA 1SKYE 1E9RA 2QU8A 4ZCMA 3KKPA 1IJEA 5JJLA 1ZNYA 3A4LA 1OFHA 3M0EA 4DLUA 2YWGA 4DSTA 1K6MA 3CBQA 1JQLB 4G0NA 4IKEA 1BH2A 4LJ6A 4US0R 3V9PA 2J7PD 3T06B 1O3YA 1HQYE 4ZIRA 5EZ5A 2UZ3A 1GNPA 4LZZA 5HZHA 1LFDB 3ZGXA 4NYIR 4UXIA 5DGXA 3TBKA 3ICQB 2FFBA 4QRHA 4FN5A 3SJAA 1Z06A 4EFLA 2C9CA 2OILA 4A6PA 1AN0A 1FX0B 4LOAA 3RYTC 3BWDD 5BN5A 1CIPA 1SXJD 4S35A 4ERNA 4FMDB 2IC5A 4EPRA 3SJBA 2OE2A 1T8TA 5DH9A 2J0UA 4P32A 4KO8A 2CJWB 1KYIA 5AUPB 3RNLA 1U8YA 4R71A 4JJKA 2JCSA 4Q5IA 2D74A 3X1WA 2NZJA 2CL6X 1UKVY 4HDOB 3BC1A 4B43A 1E2JA 4XTRA 2BHRA 4LI0A 1G5TA 4UJ5A 1G9XA 1VG1A 4GMDA 1T5LA 3ZVRA 1XEFA 2BVNA 4OHYA 1TPZA 2F1HA 1TF5A 1IN6A 2QTVB 4BLRA 5FPSA 5CYPA 5DI9A 1VKJA 3FPAA 1CS4C 1A82A 3WHLA 1EK0A 1XMSA 4RD0A 1P2TA 2W6IA 3KTAB 3EC2A 1E6CA 3GLGE 3THXB 3X1XA 3KJIA 1FPMA 1S1MA 5M04A 2IXGA 3V4FA 3FYHA 2F43B 4M21A 1KOFA 1E2EA 4EJSA 3CWQA 2ANBA 2W0SA 4PC1A 5DHAA 2F43A 3CRMA 3KZ1E 4JLAA 4JYBA 1E2GA 4LHWA 1EWQA 4Q7JB 3H0KA 1QZXA 1OIWA 1SHZA 3K1JA 3SOPA 2YOHA 4Q03A 2XNSA 4UNPA 3CX8A 3RRYA 3OEEA 1KAOA 3WP1B 1E2DA 3C4JA 1KI7A 2GRJA 5JRZA 3KFVA 3VKWA 2YKGA 5DYIA 2AD5A 2OCBA 2H92A 2C99A 1JXOA 2REXB 3SQWA 2QL6A 5F9HA 2FA9A 3QKSB 3U3JA 2ZJ2A 1SHKA 3FDIA 1NVVQ 2AK2A 2PX3A 3TW4A 4UXJA 3ZQ6A 4UJ3A 5C4GB 3C16C 3AGQA 3MSXA 1OIVA 4Y0AA 5L3SA 4YC7A 2OT3B 3RS3A 2C77A 2QPOA 1GUAA 3GJXC 3KDSE 1EFHA 4HATA 3W3ZB 4B71A 5KDDA 2KSQA 1XXHE 1UJ2A 2WJYA 4PPGA 4H1UA 4C0SA 5TMPA 1WF3A 1NF3A 4MRVA 3REGA 4BFZA 4LC0A 4Q4JB 4Q1DA 3PIRA 5KNCA 4R98A 3W6OA 5BN4A 1HYQA 2IYWA 3THOA 2ZRLA 3RSLA 2AFHE 2TMKA 4C2UA 1XWIA 1JJVA 3W3AA 1CLUA 3K70B 4QL3A 5KOYA 2A5YB 2FJUA 2X19A 4TL9A 2C04A 1J8YF 2FFHA 3AB3A 1RC8A 4JLBA 1CR1A 1JECA 5FUWA 1R6BX 1KGDA 2FEOA 2PT5A 3DO6A 4NH0A 2ZRHA 4DWJA 3U6KA 3GJ0A 1IXZA 1NRJB 2YZ2A 3CW2A 3BD9A 2YC4C 5CDFE 4YXWA 1FNNA 2GF0A 3FHOA 1NIJA 3TH5A 2Y8EA 2A5GA 3PCRB 1MR3F 1BOFA 2B7BA 1ZJ6A 3QBVA 1KJYA 5E7MA 1UBFA 2C9OA 4XWKA 4HLCA 4M1OA 2YVUA 4PZLA 4XVQA 3AVWA 3WHKA 4NTZA 4Q4LA 5E3HA 4QBFA 4QGFA 2B21A 3W5JA 3VNUA 1FZQA 1TUEA 3EA0A 3WYFA 1II8B 3VFDA 3HPQA 3TMKA 2ZXUA 4BLPA 4BZPA 4AKGA 2HJVA 5FBVB 2ERYA 4RD1A 3A1WA 4TL6A 2CVHA 1Q44A 1IN7A 1LS1A 1Q21A 5CLQA 1P9NA 3AM1A 1COWD 1DPFA 3P1JA 1JQJC 2DHRA 3MUFA 3QUSA 4X8HA 3DKPA 4KFUA 2A7QA 2CHVA 3NH6A 1GG2A 5K8UA 3KL4A 1TEXA 1XD9A 3CNLA 4OK3A 4OQNA 3HPRA 5AR1A 2F9LA 3RRZA 1HH4A 1G7SA 3VHLB 5EE9A 3SYNA 4M8NE 5DSZA 2J0VA 2F7SA 2GCNA 2D7DA 1VHLA 2A3RA 3U44B 3OAAD 4P4UA 3KQHA 3U7HB 4NCIA 3VR6A 1PUIA 3A37A 5FL7A 3Q72A 5JCZA 4J0QA 1KI6A 1T3HA 1KO1A 3HU1A 1PV4A 1EG7A 2ZRPA 2ZVQX 1XCPA 5H1YA 1CTQA 2VHQA 2JJ1D 3SN6A 1Z0FA 1GL7A 4E22A 4A4DA 4ARZB 4JVLA 1W4CA 2IYSA 1NKSA 4HDQB 3P27A 3TVDA 4ARZA 1Z63A 4TMXA 2DBYA 1FTSA 1R7RA 2EQBA 5UKDA 6Q21A 1ZD8A 4KXFB 4B3CA 5HR5A 1BYIA 2ZRAA 2P2LA 1BO6A 1SXJB 1GL6A 1Q1ZA 1NMXA 4MITA 1G16A 2VF8A 4DLRA 5H8WA 1X6VA 4LJ5A 2W6ID 4CEIB 5FI1B 5SZKB 1YKSA 3ADKA 2VEDA 2O5VA 2XNDD 4RD6A 4NKRA 2G88A 1X3SA 2QENA 1VTKA 2K5UA 1R0WA 4YDSA 2ZRGA 2XNDA 1S2MA 3C15C 3DM9B 2YWEA 5JWHA 1FX0A 3UKDA 4Q18A 1IAQA 4AY2A 4M1YA 4M9SA 3LVQE 2H57A 1OHHA 3SJZA 5JSZA 1RZ3A 2CK3D 4KITB 2ZRCA 5CM8B 2ZSAA 3DL0A 3B5JA 4XSGA 3IBGA 3HYRA 4QOSA 1J99A 4B3DA 3AF2A 1OXXK 2WV9A 3FMPB 2QA5A 3IPYA 1DARA 1JAHA 2WWHA 3DZDA 3QSYA 3ZD7A 1ZP6A 3PXGA 3ZDQA 4MH0R 1QRAA 3RC8A 1MO6A 3SEAA 3NBXX 4R2IA 2YC2C 1Z3IX 2QROA 5GJWC 3AGPA 2BBWA 2QPAA 3THWA 4LK2A 3LWNA 4A1FA 5FH9A 5JJIA 5HCNA 2YHSA 5FL7D 3KJHA 2VP2A 1RPZA 1GKUB 2CL0X 1HE8B 2GZAA 3KUDA 3TNFA 4D80A 4XWOA 4NBSA 4B32A 5HE9A 2EWWA 4M53A 4HLDA 2OXRA 3GD7A 1IY2A 3LAWA 2JJ2D 2RGGA 3AF3A 3K9LA 3LW7A 4CF7A 1NG1A 1OW3B 2VLIA 1NN0A 1DELA 1DOAA 4B34A 1KI2A 1XXHA 5SZHB 1DO0A 3BORA 221PA 3E1SA 1HY3A 3GEHA 4ITRC 1QF9A 1Z6GA 3Q5EA 5FPYA 1DAGA 3EA5A 3MRSA 2I1VB 2OBNA 3UWKA 1SXJC 2RGDA 2EFHB 1DAMA 1JR3A 2BC9A 1N6LA 1MKYA 1MO5A 2WOJA 1K5GA 1P7CA 4ZDIA 2REBA 2XSZD 3DKVA 5TDHA 4A82A 2EWVA 1VCNA 5DIFA 4K46A 1W49A 4NP6A 2O8DA 4FMCF 4TLBA 4BLOA 4A92A 3EPJA 3T1QA 1OH7A 1D2EA 3IHWA 5E7IA 1PZNA 3TRFA 4URZR 2P65A 3A58B 5EE0A 4A8JC 5F98A 3RRMA 1AJEA 4NYMR 3GLIE 2ZI6A 4MKHA 2QEQA 3C8UA 4XD7D 1D6JA 1N0WA 2QTFA 5BYKA 5CDFA 4TYYA 4OK5A 1KTVA 1XEWY 1ZC3A 4HAYA 4Z54A 2PEYA 3WRXC 5B30A 1WDTA 2JLVA 2AN9A 3WBJA 3NBFA 4DXAA 1KI1A 2CL7X 1G41A 2QRNA 2FFAA 2IEYA 2REOA 2OAP1 3K53A 4LPKA 5AJWA 3ZZTA 4M1MA 4QJ3A 5J4KA 4LHYA 1NVXQ 4Z1MA 4ESVA 2QE7D 2WJIA 2GXQA 4O3MA 1GDDA 2BCGY 4QXAA 2V9PA 5TV2A 2D4HA 1FL9A 4B47A 2FPMA 4M9ZA 3HU2A 1NJFA 1YZLA 4MUAA 3P20A 5FTJA 4RFSB 2FDCA 3EWSA 5FBLB 2J41A 3NKVA 2HXSA 2WJGA 3BB4A 3KQUA 1ZAKA 2BBTA 1G3IA 2PMDA 2QG6A 2WWGA 1N5IA 2DWOA 2FPKA 4PO9A 5KSPA 3SBDA 4ASUD 4UKDA 2P67A 4PSVA 5EE1A 1P6XA 3GLGB 1VYVA 1GRRA 1OFTA 1OV4A 3OF5A 3GLFB 4D4MA 2RGEA 4GP6A 3VU9A 5EXSA 1KDRA 3A1TA 1U0LA 1Z83A 2C9YA 1RKBA 3CF6R 2O0KA 2IF0A 3D8BA 4Q1CA 1YJ5A 1N6HA 3QVVA 2G1KA 2FSGA 3EAQA 4LCBA 4PZYA 2F1RA 4FMCB 3I5XA 2AL7A 1Q3HA 3SHFA 3GFPA 3LO5A 4OQFA 4BFSA 2C8VA 4G5SA 4EFMA 1CJVC 2VSXA 2FGJA 2VH5R 2ZJOA 2IYQA 1Z2CA 2A2ZA 2SHKA 1P73A 4XWAA 2NMVA 4X8LA 3D6TB 2ZUCA 1DAEA 4IEEA 3TAHA 3TLXA 2LWIA 3PEVA 3E70C 1KI4A 4Z1MD 2Q9CA 2JJ1A 4Q4AA 3RAPR 2EFGA 3LRPA 4L9WA 2O8CB 1FFHA 4GI7A 2AR7A 3QXSA 1ZINA 1P9WA 2JDID 2ZEJA 5CM9C 5KU1A 1IY0A 3BGWA 3K70D 4LY6A 4DHEA 2DYKA 3R20A 3FGNA 5AUOB 4QGGA 3IPXA 3IEUA 1Z47A 2ORWA 4LYJA 3EIEA 4MRPA 3IILA 3LXXA 3BE4A 4V0MA 5IRCD 2IYLD 1Y3AA 2RH5A 4XD7A 1GP2A 5B2ZA 3GP8A 2HEIA 1VCMA 4JYCA 4OHVA 4F4IA 2J0SA 4XH9B 3GJ7A 4MGYR 4IJMA 4LBZA 4ZCLA 1OE0A 1NKTA 3TVTA 4GOJA 1Z0KA 1T4GA 4ZI3A 4B3FX 4F91B 1ZBDA 1G5RA 2BEKA 1ZNXA 2XJ9A 3LBHA 4QGHA 1XPUA 4B3XA 1PVOA 1VHTA 1UFQA 4HDCA 1UPTA 4IDOA 2CHQA 2WAXA 5L3VA 5GJBA 1LF0A 4TN1A 1SULA 2OV2A 4GL2A 3GLHA 4OJQA 4JLJA 4N1AA 4BFXA 2QSYA 3B85A 3H86A 4U5XA 2HLDD 2OBLA 2AKYA 5HZKA 3HWSA 1S3SA 1NMZA 2VO1A 2OXCA 1BIFA 2QAGA 2F3TA 4QKQA 2IBMA 3L8YA 1YRAA 1J7KA 2QORA 5FL3A 2CVFA 2F3RA 4NCJA 4GT1A 4HAUA 4DT1B 4C4PA 3FB4A 4CRWB 2D2FA 2KB0A 2R6DA 3CUEF 1ESMA 5JS8A 1W2HA 3A4NA 3ZVLA 1QVAA 3OEHA 1HEIA 4NL4H 3NHBA 5EP2A 5FUVA 3UWOA 3T61A 4B3BA 5FTNA 4PANA 4PPFA 2GNOA 4NYJQ 2ZE5A 5IHPA 3THYB 3CONA 1KI3A 1U90A 2ZUDA 4LBYA 1UEIA 1JBKA 3LA6A 2QNRA 1X8JA 2BIFA 2ZQ5A 5H68A 1NN3A 2QN6A 4ON9A 1KO7A 5JHHB 3BAFA 1AKEA 2P3SA 1W2GA 4RFVA 1GTVA 1G291 5ELXA 2QBYA 2OCYC 1XFAA 4KU4A 3ONWA 2ZJBA 1YR9A 2AWOA 1MO4A 1OLOA 1VYUA 3B13B 1E2NA 5SZJA 3ZIAA 4DLYA 1MRSA 2AHOA 5P21A 721PA 5JCPA 4QFMA 1G8GA 1Z8FA 3RDPA 1G18A 4DLWA 2YOFA 3WMFA 1DG1G 2XZPA 3CZPA 1W4BA 2Z6VA 4DIDA 4YMSA 4PR0A 4MKGA 1HUQA 2IYUA 1N6IA 3W90A 2BMFA 2EU8A 3ASYA 4QC2A 4HAZA 2D2EA 1QHHB 4DEYA 3T1VA 4S2EA 5CIWA 1N5JA 1PLJA 4BUJA 1KMHB 1NY5A 2ONKA 4BZXA 3I8SA 1JALA 3UIEA 3KQNA 3HU3A 2ZRIA 4NMMA 4X8OA 1UKEA 2DWQA 2ZM5A 1KMHA 2OFOA 1YE8A 3SJCA 5HE8A 3EZ2A 4JLVA 3BH6A 3ZZ0A 3AVTA 1CJUC 3NC0C 1KNQA 2E87A 2VL7A 4NPHA 3SYLA 4GOKA 5LBIA 5FUXA 2P5TB 3K09C 2IWRA 4BZQA 3IUYA 3IBYA 3QKRB 3TAUA 3VKGA 4LJ8A 1E9AA 2JIZA 1SVKA 4TLDA 2LKDA 4Q7KA 4TTQA 4ACBA 2I1QA 2IS6A 1KDOA 3BB1A 1TU3A 2P6NA 4NYMQ 5DHFA 4MRNA 1XD2A 3JZMA 4TMTA 4YMUA 1DAKA 2OFXA 2GK6A 4GBMA 4RJLA 3K70C 2V4ZA 2H7VA 3VTKA 4QBGB 1F5NA 5K8LA 1V5WA 5FFMA 1TTTA 2GAAA 2D3WA 1IJFA 5HKKA 2QM7A 4URYR 1XF9A 3B82A 1W4AA 3U3RA 4C7OA 1Z6YA 1KK2A 1GKIA 1WRBA 1LW7A 3KXIA 2ZSBA 3OAAA 4KHZA 1W5SA 4V03A 3I92A 4L16A 3U7FB 4US1R 3QIAA 4XOIA 2EFDB 3TQFA 3QOFA 1LF5A 1R5BA 1QVRA 2XJ4A 2AX4A 1C1YA 2CEAA 3BH7A 3EPLA 4PO8A 1IXRC 5LB4A 2ZAMA 3L8ZA 4D2IA 2BJVA 2ZJZA 5FTKA 3NDPA 3OIWA 4RFSA 2V1UA 1E0JA 3KXKA 4ZPXA 5IDVA 5BYJA 4BFUA 1WBDA 3LV8A 5HTKA 4L4UA 2C03A 3KJGA 1YRBA 2ZSDA 1E2PA 2A30A 3C5CA 5EE5B 4D0LB 1KO8A 2GJ8A 4ZIRB 5AK0A 2J45A 1OT3A 2IUSA 5HCIA 1XTQA 2V8OA 1F2UA 1E2MA 2WWWA 4IOLA 4Q7LA 3TW8B 2OHFA 3T12A 1HT2E 1MH1A 3VR2A 4GMXA 3SR0A 1EFRD 1B23P 3CPHA 3OFND 1M7GA 1KK3A 3B2EA 2ZE6A 1HA3A 1ZD1A 1AA9A 1Z08A 2J0UB 4EPYA 5B58C 5JSZB 3TUJC 4IHQA 4D25A 1JPJA 4TYPA 1NBMD 2EYUA 1P60A 1ZM3A 1UF9A 3DHWC 4ZKDA 2XEXA 1CF4A 3ZQJA 4DSNA 4BPBA 2A78A 1X1SA 4Q9KA 3A4MA 1RIFA 3LD9A 4MYCA 2IUUA 3SI7A 1VG8A 1JR6A 3LQRA 3TGPA 1EXMA 2ODBA 1ESNA 2C95A 2R6GA 2BKUA 2W2XA 2A5FA 4GP7A 5TVKA 2JLQA 2IL1A 4TWZA 3AKEA 1ZNZA 3UMRA 4MRSA 1ZMXA 5JWRA 1P9RA 1LNZA 3L82B 3MWKA 2BMJA 4JL5A 1Q1BA 1TNDA 2GEDA 3IQWA 4MQBA 1G5PA 1JPNA 3G82C 3OHMA 4QHSA 4WZBE 5JWOA 3KQKA 3QF4A 2ZJ5A 2KE5A 1KKMA 3O8BA 4RZXA 2RGCA 5CLLA 2V3CC 2QUZA 4D6PA 2JDIA 1A2KC 3ZD6A 4JZKA 3SFVA 1E0SA 4IRUB 3TUZC 2CLCX 3VR4A 3X1ZA 2R9VA 3VX4A 4F93B 1KSGA 3NBYC 2F9MA 1QHSA 1PLLA 4RKEA 2HF8A 1N3BA 2BWJA 2BM0A 3QXHA 1KZGB 3DM5A 4DT1A 5L3SB 1IN5A 1KSFX 4PPQA 5G3ZA 1GRQA 1W46A 1OKKD 4Q4HB 4URUR 1YZTA 3CH4B 3WNCA 2RCNA 3BB3A 4BRUA 3U3MA 4YONB 4ILEA 1XP8A 4PAOA 1OYYA 3CM0A 3RC3A 5JHGB 1OH5A 2D7CA 5KPJA 2VP6A 1EESA 1S96A 3PUZA 2JAQA 4M9XA 3DOFA 1OXTA 1E69A 421PA 4MYTA 3KXLA 2JASA 2PCLA 3U4QB 1JJ7A 3IIKA 4C0KA 1AIPA 1GOTA 1EX6A 4OKSA 1YR8A 3IO5A 4NU0A 1P62B 1E1QD 3MMPA 1CJMA 4N3NA 1VECA 1XB2A 5FOWA 4AWXA 4JSTA 5EXTA 1II9A 1T6NA 5TY0A 1E2LA 5KNBA 3MGCA 1R5NA 4Q47A 4P31A 1H8ED 4Q9LA 2R6AA 3L0OA 3GLFA 4OHWA 5G3YA 3BFVA 3QBTA 4DDTA 3K9HA 4WXPA 2EVWX 5FBRB 4Q1AA 2QZ4A 1HE1C 2RGXA 2ZRDA 4HZUB 2O8EB 2ZR7A 5E95A 1OIXA 5LDDC 4CEJB 5BQ5A 5SZIA 1MRNA 2G9NA 3REFA 4YLGA 1ODFA 2B8WA 4JVNA 3H2YA 2PBRA 3P26A 3WY9A 1U8AA 2QAJA 1Q0UA 2WWYA 4O25A 4WW0A 2VHTA 1E9SA 3H4MA 4MUBA 2GCOB 3SS8A 1NVWQ 4JLKA 4CT4B 3K0AA 5EP1A 1N6PA 2YWHA 4I99A 2JIZD 2O52A 1CXZA 4PHHA 1G20E 2Q3HA 1A4RA 1M7BA 3K0AB 4OYHA 4UQOA 4Q4AB 3PEYA 1MO3A 5D3MB 2W2VA 5L3QA 4DIEA 5J47A 1HV8A 5CIQA 3NTUA 5FPTA 2JA1A 3T5GA 2XOKD 3K0EA 3I8XA 1I4DD 2FE4A 4XJXA 1JR3E 2QRZA 2C98A 4C0BA 1KHTA 2NTYC 2ZYVX 3K9NA 5FOTA 2P5SA 3B1ZA 4DDVA 4WZAE 3DZ8A 3F3YA 3LQQA 4DEXA 1GITA 4RZUA 3SBEA 3WP0A 3L0PA 1XJQA 1E99A 2BMDA 1UDXA 2WBLC 1NBME 4IEIA 3AKDA 1R0XA 2BCJQ 4KI0A 5CB8A 2J59A 3IKJA 1KY3A 2DFNA 3QPUA 1XMJA 2CE7A 1XX6A 2AKAB 3ECCA 5JBQA 1QHYA 1GILA 5GVSA 5C1BA 2Q3FA 1EFRA 1OYWA 4JMPA 3KX2A 5A4JA 1SXJA 4M1TA 1XRJA 1YZUA 2ZANA 4L9SA 3NDBB 2UZIR 4US2R 2W0MA 5KDOA 4B74A 3CRQA 4FI3C 1M74A 3FMOB 2ZS7A 2A5JA 4HUQB 1NLYA 2H1LA 2WKPA 4PFSA 1GSIA 5F2EA 4AKIA 4WBSA 2FEMA 3O47A 4JIMA 4TT3D 1F3OA 1P4SA 2ODNA 2Z4SA 1ZIOA 3NHAA 3WNBA 2E1RA 3B1YA 2KI5A 4R2HA 1E96A 4DKXA 1J90A 2JJ2A 4HYYA 3K0CC 3ZVNA 4GZLA 4JJZA 1TX4B 2G6BA 1UDWA 3CO5A 3NXSA 2IYRA 4MGZR 3PITA 1XJ0A 1W7AA 5GJVC 2ZIAA 2QBYB 2DFLA 1E9DA 3KB1A 4IOKA 3L0IB 2N42A 1ZUIA 1D2NA 2NZ8A 3PUYA 1UKZA 4HAWA 4QNRA 3AUYA 4RKFA 3C41J 3PUWA 4ZDWA 5KNDA 5KPDA 4O2LA 4QHTA 1E2QA 3FFBA 3QPWA 1A2BA 5EP4A 5J4HA 3GFOA 4IFBA 4EAQA 2R62A 2HT1A 2GJAA 3ADCA 1H8HD 1IN8A 1ZM7A 4WXRA 4KLNA 4QJ5A 3X1DA 2ZROA 4EUNA 4DUGD 1TU4A 4Q9IA 4OHZA 1U94A 2QE7A 2RGBA 3B9QA 3EARA 4P33A 4BE7B 4B2LA 1Q12A 2R44A 2IYTA 3FKQA 1U81A 3SHWA 4C0JA 1NG9A 3OZXA 4D26A 4I1SA 1MV5A 1KAGA 2ZSEA 1NVVR 1JAIA 1W47A 1KDPA 3AF0A 4OJKA 1XNJA 5CK4A 5B57C 1KKLA 2O8DB 1E9CA 3L0SA 2ZI7A 4H1VA 2BEJA 3NVAA 4KSCA 2HT6A 4FIDA 5JI2E 2C78A 2UVQA 5G40A 4LJAA 1R0ZA 4DDWA 3D7MA 4A2WA 2ERXA 1W0KA 1JEDA 3OEHD 1FQJA 4LGMA 2WTUA 2VHJA 1BS1A 3RS5A 1AZTA 2J1LA 1Z28A 2F1IA 1SGWA 2FSHA 1WE2A 4WA7A 1N6RA 4V0KA 3UXMA 8OHMA 1COWA 1J8MF 4B44A 2F1JA 2ORIA 4B3GA 2G77B 3NH9A 4IFEA 5FOUA 3GJ5A 1X1RA 2QPTA 4POAA 4CEHA 1EGAA 3CH5A 4HB0A 1E2IA 1L7VC 4L8GA 4ABYA 2FU5C 1U8ZA 2OBMA 2H18A 5DLQC 1D2MA 2LCFA 3GLFE 2ODWA 2V55B 4IDPA 4A15A 5FUYA 1M34E 2QGZA 2ZRMA 3GEEA 4MA4A 4TQAA 3CF0A 4PHGA 4NYJR 3U7GA 4LYFA 4BLSA 2RHDA 4C0HA 2RB4A 3SZRA 1KO5A 5AJXA 3MFYA 1WCV1 3K9GA 3VHXA 4CIDA 1YZGA 5KHOC 2NO1A 4TMVA 3ASZA 4X8MA 1GRNA 3QNUA 1M6NA 4TSFD 4LBVA 4IXNA 2AWNA 3W8RA 2BV3A 3VX3A 2XXAB 2IS4A 2IUTA 2PT7A 4TL8A 4OI0A 1E94E 1FUKA 2WJVA 2ZR9A 3PVSA 3QVUA 5J4VA 1XMVA 1FP7A 1BMFD 2ZE8A 1HURA 4Z51A 5KDLA 3DMNA 2YINC 2VTKA 2HCBA 2WWXA 3GLGA 4RCZA 1FUUA 3EX7C 3CIOA 1GVNB 1G6OA 1LVGA 2PJZA 5EP3A 3V4RA 2CLSA 5EXXA 4FCTA 4CYMA 5CJPA 3H1TA 3Q5DA 4LUCA 5DE3A 1ZC4A 3B1XA 2GXSA 2J7PA 3KFXA 3PR1A 4KBFA 2QSZA 5AWFC 1KY2A 3T15A 4AKEA 2Q21A 3RS0A 1E2KA 1SVWA 1OXUA 3PV0A 5DN6D 4II7A 2J7KA 4LV8B 2GCOA 4PSKA 2OCPA 3RWOA 1W0KD 4N0DA 1UBCA 4BLQA 1VIYA 3BOSA 1JNYA 2R2AA 4FW9A 3VR5A 4KSBA 3OFNA 2ZRKA 2GETA 4KCGA 2CCGA 1AGPA 1TQ2A 1G4UR 4A2QA 2WWIA 3B60A 3AUXA 1II0A 4PTLA 2B6HA 4B73A 4WZ6A 2P6UA 2FV8A 1ETUA 3U2QA 2PZEA 1N2CE 4Q48A 2GZHA 4E07A 3I4LA 3K0SA 2PX0A 2QAGC 2O0HA 1Z2AA 1XTJA 1UADA 1N6KA 1IM2A 2GVDC 5J40A 3HDTA 5EJEA 2PJRA 2XAUA 1TL7C 1G3MA 3RRNA 1O87A 1RRGA 2DCUA 1FMLA 5DISB 4K81B 5LD2C 2CK3A 1E1RA 2MMGA 2R6CA 4FD2A 1ANKA 4OK6A 2QQ0A 1KJWA 4PAMA 4EQ6B 3HYTA 4WIAA 3RABA 4QBHA 4UNRA 3KKOA 1SVLA 4U00A 4DSOA 2EFEB 2RMKA 4ZDJA 4Q66C 1TQ4A 2GESA 1EFUA 4JKYA 3N5CA 4DCTA 2QT1A 2QM8A 3LBIA 1KO4A 1RJ9A 4FWTA 1AQUA 4PSAA 3Q85A 4C3ZA 2IYVA 4JVMA 4YDHB 5AUNB 5IT5A 4B76A 4OBEA 3ZS9A 4TMKA 3AEZA 3QG1A 4DCVA 3IIMA 4QHYA 1KSJA 2ORVA 3LBNA 1ZCAA 5E7JA 4A9AA 4RSGA 4F38A 2QP3A 3EC1A 2YYZA 3VNVA 5AJYA 1P2UA 5DN6A 2RGAA 1G8YA 3VQTA 2QMUA 3EZ9A 3WNDA 1EFTA 1NJGA 4AYWA 3M6AA 3P4YA 5KSZA 1IN4A 3QEJA 1W0JD 1Z6TA 5FBQB 2FN4A 5IK2A 1T0JB 3QENA 4Q4JA 2PEZA 3LFUA 2OCAA 3PQCA 1E4VA 2E9SA 5FOSA 2N46A 4PC3A 3B1VA 4Z8YA 3RVBA 2ATXA 1FNMA 1FTNA 2QY9A 2Z5FA 5C2JB 1AZSC 4CT5A 5JI3E 4KJZA 5KTYA 2P6RA 1XEXB 1L4UA 2NO9A 1YHNA 1T5IA 3JVUA 4LWZA 3HR7A 2BDTA 1NNEA 1M8PA 2KBEA 1KIMA 3U3OA 2YNMA 2ZVPX 3OE7D 1RFLA 3PENA 2FNAA 5FOXA 2KJQA 4DJTA 3Q3JB 4ZV4A 2I3BA 3NIBA 3BH0A 4D4KA 2FG5A 4JLPA 3TUIC 5KYKA 2YV5A 5F9FA 5IF9A 3AVOA 3TR0A 4PX9A 2X1VA 2OLJA 2QP9X 1OH6A 3QY0A 3CWZA 3OIUA 2BJWA 3W8NA 2G0TA 4A0FA 1JR3D 3AF4A 3QKTA 2JGNA 4DDUA 3AQ4A 4CEJA 4Q02A 4DBLC 4P4SB 1W1WA 3QF7A 2NO6A 1N6NA 2ZR0A 2WKQA 1II8A 3WXMA 3GEIA 2VHCA 1ZVQA 2XZLA 2IX3A 3R8FA 1TMKA 2IEZA 3U5ZB 4DLTA 1A5TA 1XD2B 2VP0A 3NC1C 4MYHA 4F92B 4QNMA 3QKRA 1JEEA 1IY1A 2Q3MA 2ZETA 2QTHA 4IOJA 1Z6AA 1SQ5A 2FFQA 521PA 5L3QB 2OG2A 2WMNB 3K09A 4GNKA 1T9HA 1WXQA 2NIPA 1I2DA 4LJ7A 3KKQA 2WZQA 2ZRNA 4PZZA 4HLUC 1XEWX 3NG1A 1KI6B 1LS6A 5KSOA 2R65A 3T35A 1Q1QA 1RW4A 4Q01A 2IYXA 2F55A 1CRPA 3TSOA 2FZLA 4IVPA 4I1UA 1X8KA 1IBRA 4DCNA 4DVGA 3AV0B 3G5UA 3PUXA 4C2TA 1KJZA 3L43A 1YZQA 2W83A 3PFIA 3U3KA 1F2TA 3FKSA 3TJZA 4A8JB 4BLTA 2GILA 2JLUA 1W5TA 4IVRA 4URWR 5BW8A 3LXRA 4TL7A 2V6JA 4IW3B 3VR1A 1Z0DA 2ZYUX 3NEYA 4E03A 1ZM4A 4JSYA 3W9YA 3LLUA 3AVPA 1KI8A 3CPJB 3LVRE 3EASA 1GNQA 3SE0A 2WIBA 4A0GA 5JRJA 4MDFA 4QM7A 4CEIA 2V1XA 1RYHA 2WWFA 3MAAC 5FR1A 1GM5A 3Q7QA 3SFZA 1H65A 1R8QA 3KQLA 3T1TA 1Z0JA 1VG9B 2G1JA 3EIHA 3L2OB 3RSOA 4HUQA 2CE2X 4LSGA 4KODA 5E4FA 1FQKA 2X2FA 3LLMA 4TYNA 3NEJA 4AYTA 1SVSA 1J70A 4UXHA 3IHLA 2G3YA 2CJWA 4LRWA 2Z0MA 1G6HA 2FSIA 5DI3A 5JFGA 1T8UA 3CNNA 1P61B 2GWHA 2WKRA 4GRAA 2JLSA 4PHFA 5DYGA 1CU1A 5EUMA 3UG6A 2OSBA 2D62A 4TT3A 2JJ8A 1G3QA 2H16A 2VIIA 2XTNA 2J0QA 4KYUA 2WJJA 4QM6A 2ZS8A 3O8DA 1W48A 1C9KA 1G3RA 2IT1A 4PO1A 2EW1A 3CR7A 1GIAA 1RRCA 4KYIB 3NWJA 3UG7A 4ESHA 1YZNA 3THWB 2ZPTX 4DRZA 4MDEA 2FOLA 1FOEB 3Q7PA 5L3RA 3QI2A 4W5HA 1E98A 3F5FA 3B8HA 4RD3A 1MABA 1XTKA 2IXEA 4A36A 5AUQA 2GEVA 1PJRA 3PJRA 3AVVA 2AXNA 4C30A 4TTRA 1QHIA 1CJTC 4XSHA 2GEUA 4TQ9A 2XTMA 3EZFA 5AJZA 4CW7A 3FFAA 1N0VC 3QF4B 5DO9A 2R8RA 1A7JA 1US8A 2WJHA 1IXSB 3FVQA 3B6EA 1K8RA 2GXAA 3MCAA 4EQ6A 4LBWA 2JLWA 4M9QA 4XVRA 1US8B 3UMFA 1TF7A 2AFIE 5CYOA 3W34A 1QDEA 3FWYA 3GCGA 1KZ7B 1XCGB 4PC2A 1BYUA 1UEJA 3K0FB 1W44A 1EWRA 2ZTSA 2FSFA 1SVMA 2WSMA 3QKSA 4V0OA 1E0AA 4K8OA 4URVR 1GFIA 2XB4A 3LNCA 4NDZA 4WOPA 2FPLA 1NN5A 4DZZA 4Q7MB 4B35A 4EPVA 1NSFA 4OL0A 4JLNA 2AK3A 4EIWA 2CNWA 4TZ0A 1DBSA 1NIPA 1X86B 2C2HA 4NCNA 4RZ2A 2V54A 3AVYA 3A8TA 1S4QA 4B75A 4MKIA 3KJEA 4L5BA 4ZDKA 5L8VA 1W36D 1G4AE 4C7OB 1PLKA 2W00A 2IHYA 2PMKA 3QG5A 4I81A 1MOZA 1G1MA 3VMFA 3VR3A 1ZM2A 1CBUA 3U4QA 1QHXA 3R9WA 2J3EA 2IYZA 4LC1A 1AKYA 1T91A 2FF7A 3OEED 3R7WA 1W0JA 2RGNA 2W58A 3AVQA 2R6FA 3CKLA 5BXQC 2CCKA 3E2IA 2N1BA 2FH5B 3ZYCA 5J4YA 2ZI9A 1Q1EA 4OQXA 3T34A 2JATA 3GLIB 2RGNC 3LW8A 2GDJA 2CHGA 4ZCIA 4JT2A 3B1WA 2GKSA 3RS2A 4FWIB 3GLIA 4DCUA 2DWPA 3I1FA 3I73A 4JL8A 3AVUA 2CDNA 2DFKB 4LHXA 2BOVA 4HZUA 1D9XA 2XXAA 5EUQB 3AKCA 3AP1A 1GWNA 2YWFA 1M2OB 2XX3A 4LJ9A 4NYIQ 1CULC 4GFDA 2ZJYA 3A1UA 4ZO4A 1PUJA 2O8EA 4TLAA 3PG5A 4M1KA 2NG1A 2O8BA 1E2HA 3CB4A 4UNQA 4JT4A 3EPHA 2FZ4A 2ZSFA 1ZCBA
chains in the Genus database with same CATH superfamily
3ANMA 4MYUA 5CJ2A 1MQ9A 3ZS8A 2OVFA 4R69A 3R9IA 4ER7A 1OYOA 3EFOB 1X7XA 4MV7A 4YH1A 1SCDA 2BEUA 4K2AA 1EUDB 4NAVA 4ZK6A 3VJMA 1T3LA 1OFIA 2JB9A 2Y76A 4YCJA 3N7AA 3IT1A 3TQQA 4KLZA 4JC0A 3LOUA 4RE6A 5CVJA 3JD0A 3BAZA 4LHZA 4CUJA 1OI7A 1S9HA 2BN4A 2OYRA 3TRKA 4E70A 3VKHA 4LDPA 1GAEO 4BRZA 3UKOA 5ALQA 3UC5A 1N7GA 5HQJA 2VZEA 5FOVA 1A71A 1EXWA 3P2IA 4FZ5A 1G8SA 3K2IA 4MVJE 4X65B 1ZYUA 3LH5A 2O2JA 4REQB 3DLBA 1LQ2A 1GAJA 2OSVA 4G0XA 2ASEA 1EJ0A 4XCVA 1FJ2A 2C5HA 5TJHA 5AVVA 2W2LA 3ZJ4A 3KVOA 1D2HA 5BR7A 1SUEA 4O63O 4BECA 1HWYA 2ZRBA 2XMQA 4HZGA 2DGDA 2JRLA 5I7WA 2EBHX 4OMCA 4LF8B 1D2AA 2QM0A 1CUUA 4J94A 3IB3A 3M9WA 2XA9A 1DLJA 5JR3A 2P0EA 4YA6A 3R9XA 3ADBA 2YXPX 2YZMA 4G5XA 2Q07A 3MWDA 1XE3A 3RVRA 1PG0A 1JHMA 3GEGA 1JMVA 3WQRA 4BMVA 2OZPA 2WICA 4ES6A 1X42A 4OQMA 3ZNPA 2Q5CA 5EIXA 2W2KB 5E6SB 1T5OA 4XPIB 2B7CA 1MEEA 1BHSA 2BW0A 2XQJA 4BKQA 2FUG6 4D92A 4AQ7A 3AL0C 1WUKS 1G19A 2PLFA 2VP4A 3JWJA 1M1YA 1BFKA 3L93A 4JLDA 3I5MA 1LVUA 2J32A 4QA9A 2OP0A 1FSGA 1VJCA 4UM7A 5C5EA 2NQ2C 4BNKA 4Z4GA 1UBEA 2PMBA 2DPLA 1ISIA 4M1WA 3I9OA 2C5AA 3IQXA 4KXVA 4BBPA 4F4HA 1RJ9B 4V0ME 3PLAE 1E9EA 2MTBA 3KJZA 3L41A 4L2IB 2HF9A 3Q6NA 3FETA 3ONEA 4OMUA 1AM4D 2EDCA 2ZXFA 1BXRB 3QKUA 5IZCA 121PA 2YJTD 4OBXA 5AJTA 5FKJA 3L4KA 3PI6A 1K8ZB 1LY1A 1PYGA 1SC6A 2R1VA 4U02A 2BGGA 2OL4A 4KLCA 3V4ZA 3IDQA 4V1CI 1NC3A 4HEHA 4HDRA 1JB1A 2IDZA 1JBEA 3B9PA 4XIFA 5EQFA 4ZEWA 2AXPA 4J2TA 3T7AA 3WZMA 2O1XA 4FYIA 4LDAA 4MROA 4UAVA 4UEWA 4UHDA 5HCUA 2IQIA 4PYLA 2EYQA 4R7ZA 2IUYA 3ZV7A 1KVRA 1VL8A 3WGQA 1JTFA 1VRWA 3L9WA 3S1AB 2G1UA 4HDSB 4DM3A 2QT0A 5COBA 4KV9A 3LX6A 3OURA 2PTHA 4Q4DA 3WRYA 2Z2ZA 4LSWA 3LGAA 2AX3A 1BEEA 2BKEA 2J3DA 3PC8A 4EUHA 4I50B 2RJ3A 2CVOA 1N2XA 1VBNA 4RH1A 4W8GA 4EFNA 4BO7A 2X2OA 3ZLUA 3N2EA 4HG2A 4I4NA 3KB8A 4OU5A 4G4SO 4PXSA 5AIAA 1AKWA 4R8KA 2PV7A 3TIFA 5L4NA 3QXJA 3NIFB 4RCYA 2PL3A 3U40A 4MV3A 2VP5A 2WA1A 2RK6A 1N9KA 1ULSA 4GDFA 4NOJA 3RGGA 3I58A 2VP9A 3E7FA 5HF8A 1T4DA 3VR6H 5TPWB 10MHA 1GTSA 1EP2B 1U8TA 2BSXA 5GWXA 1KFCB 3CWCA 3M89A 4BZPA 1B26A 5IABA 4G9BA 1HE3A 4ASUA 2FFRA 4WCDA 5HIKA 3D2LA 4KFTA 3K0FA 1AS0A 3R3WA 1C3OB 1SVIA 1WABA 3ACBA 4MVJP 3TDNA 5CK5A 2GD1O 3MWLA 2QN2A 3DDCA 4ECAA 4GI2A 4UVEA 1PT6A 3UPUA 3DCIA 2Q2OA 3G5LA 4MI9A 5AW6A 4BQPA 1RHJA 4UTXA 4DM7A 3QEAZ 1NBIA 1CP2A 1VSUA 3AERB 2UAGA 3LX5A 2XCTB 2IHVA 2ICAA 1VG0B 3AF5A 1J20A 3F0TA 1QTRA 1TCBA 3MOIA 4YWHA 1F60A 4HADA 5FQNA 1C4OA 1NW4A 3I2KA 4F3TA 2XODA 3ZVMA 1MT0A 4FNGA 2YWRA 4LHVA 5BPFA 3CRNA 4MGKR 4NH4A 3WLAA 2FW6A 3CEPB 3A2KA 4J1TA 2HIMA 1GQFA 1B8UA 5LQUA 1E8MA 1P1BA 1L5HB 4G5QA 1JDBB 3N86A 1GQSA 4MV6A 4YV7A 3ZLJA 4JBYA 1YK0A 2RC6A 2M1XA 4WGGA 1RSZA 4UZSA 4F8JA 2XB2A 2P9BA 3KKMA 2E6UX 1YQEA 3PQ5A 4JX9A 4LHSA 4L72A 3HDVA 1UBKS 5K3FA 5JNSA 2VXBA 5IJ0A 5EI5A 1ZOSA 1YZVA 3O8RA 3UCEA 4A10A 2P9TA 1LBHA 1R4NA 1LB1B 5AKJA 3VZRA 4D8WA 4ZZ0A 1UC4B 1JRLA 4IV8A 1WG8A 1NXOA 1TM7E 1H8HA 1R0CA 3KALA 5IBPA 4CQLA 4M0FA 3ZE1B 4AUEA 3KEQA 4WSOA 2Z1DA 1QIJA 4KLAA 2ZI5A 1V3UA 1NVKA 1WQ1R 1Y8RB 2WVJA 1Y4ZA 4QBIA 4A5SA 2YFKA 1YS6A 4TV8F 2BBOA 4G01B 4A2CA 3M1IA 3ISJA 1K88A 2W5UA 5E8JA 3I37X 2WD9A 4BN5A 2P9CA 1WU7A 3BF8A 5JQGB 2RHWA 3E8SA 2ZYTX 1C0EA 1T9GS 1O6ZA 3H99A 2Q1WA 1C2TA 4YUXA 1Y33E 1OREA 2FEWB 3MCUA 1ULUA 3OEWA 2ZBFA 3OZVA 4J7XA 2XRFA 4K3UA 5LP6B 1G64A 2SKDA 1YB2A 3PE6A 4J16C 4TM7A 5JD3A 4O2AB 3HLTA 1QHNA 1O2DA 4RD2A 3ZZUA 3BWBA 1JKJA 4BC0A 2GHIA 2DBRA 2H07A 1FW6A 3BIFA 4WE3A 4BWVA 4DR2B 2A92A 3LPMA 3FAKA 2Z2IA 2B0JA 1YGPA 2PCJA 4P93A 2JD0A 4QD3A 2CNNA 4BX8A 1ISPA 1NR5A 1P45A 4EI9A 5FLYA 3F67A 4CZ2A 3NBZC 3FHTA 2OCLA 3QLEA 2CDAA 1M3SA 3W5IA 2WUEA 3C8HA 2AD1A 4NMWA 1Q3TA 2KX7A 2R4QA 3GLSA 4JBXA 3UM9A 4AO8A 4Z3KA 2CCJA 1Q0SA 3SU8A 1VE5A 4A03A 4CR7A 5HOEA 4RDCA 3TE6A 3WDLA 3OM9A 5KWJA 5E6RB 3S40A 1DS6A 1QAQA 4Q1EA 4BO1A 3FPCA 3GJYA 2GCEA 3TX6A 3RS4A 2BRUC 2XOKA 1ZLYA 3S8MA 2VJOA 4RCVA 1U5BB 1KDTA 1W34A 3HXKA 3O4GA 1HT0A 3NHLA 3C5EA 2PWAA 4D8UA 1YK1A 3B12A 2PLNA 5G4LA 1CRLA 3CX6A 4DDKA 1FFYA 4U7DA 2FZVA 3HS3A 1X7WA 3VSAA 2WHYA 4OIFA 3W1EA 3D3WA 4F8EA 2VR1A 1RYEA 5FNVA 4EG1A 4KPGA 2Q7OE 2DLCX 2OCIA 5DHQA 3ZY4A 3MLAA 1QVWA 4DC9A 4LOJA 1DSSG 3LYAA 2CMKA 4RGVA 3ND8A 4PQRA 2V7BA 2QIOA 2RONA 1S8FA 3FPFA 3ONNA 2A9KA 3DDOA 4L7QA 3G1TA 4GEKA 2P4UA 3N2LA 4JT9A 4GDMA 1W6UA 4Q12A 2PZGA 3H83A 4AY3A 4E51A 2AG5A 3BIOA 1SOWA 4FD3A 3EH2A 4BNXA 2Y0BA 3UC9A 4E4RA 3NOQA 3LIIA 2EFCB 4GL4A 4UZFA 5DWVA 5IKOA 1Z18A 2QZPA 1CCWA 4HLUA 3GAAA 2JH9A 4A26A 3KUCA 1FP1D 4JXZA 3PXEA 3PLRA 5FR2A 1N2CB 3HY4A 4OI1A 3ZX5A 5IU6A 3FJYA 3U61B 4KBGA 4JELA 3QVXA 2YZKA 4TM8A 1ABBA 3T0IA 4L78A 2WA2A 1P44A 3CRW1 3OJCA 3OX4A 4NE7A 3OZDA 1C7JA 1BN6A 3WIOA 5A9SB 3KWJA 2WFZA 2D2IA 1Z07A 2P2YA 5DM1A 4JSRA 3QPAA 3SICE 4AD8A 5IN4A 2NO5A 1QGAA 1CRZA 3IE1A 1V2GA 2FSSA 3DA8A 1SBIA 4IDDA 2MSCB 1XQYA 2JEZA 2FKAA 3BEOA 2YJNA 4F2HA 4LJYA 2P69A 1HT3A 2B92A 1M8FA 3MTEA 3SC4A 4QTYA 2KBFA 1G21E 5AM4A 1R18A 2VJBA 1FFXA 3QVGA 1NLFA 5CTJA 5IG2A 1PKXA 1Z17A 3QNMA 1DEHA 5BN3A 3QMVA 2GK3A 4QXPA 2WOOA 3K6RA 1OH8A 2WDZA 3D54D 1TVKA 1FDUA 4JLMA 4KUEA 2PZAA 1HG1A 1Z5ZA 4QEKA 1Z39A 3PIDA 4J4HA 4U2KA 3T3HA 3UCXA 4B40A 4BFLA 1KYTA 1ZRHA 2FXVA 3BERA 3G2JA 2A6PA 4YJ3B 3GG2A 3Q7SA 3CC8A 3D43A 3EFHA 3TMAA 3BS4A 2RC5A 4AICA 5FPKA 3FHCB 1EP1B 3D7NA 3S70A 4DMHA 5BNFA 2ZJ8A 3RSGA 3ZDZB 3PPWA 4M22A 1DINA 3GD5A 1QLWA 4R6XA 3V1MA 3EPKA 2O5EA 1Y1PA 2VQSA 2QQ5A 1U98A 1MA3A 2EBFX 4WD3A 4CKCA 2H1CA 1T2UA 3JALB 1U0JA 3KWMA 5DCYA 4AK9A 2I0FA 2WHXA 3IVRA 3CZQA 2H1VA 3OX3A 4GO1A 5IAJA 5A3RA 4R8SA 3PGMA 4HR7A 2DERA 4QYMA 4U3JA 1AHPA 2CSXA 4BFWA 3SZLA 2IYPA 2X15A 4D57A 4BY9E 5T64A 4GC9A 3WQSB 4ZMSA 2GFIA 1FQOA 3V8PA 3DQZA 4OI4A 1QU2A 4PZPA 3LRXA 4G5OA 1MNQA 2R11A 5A71A 2FSPA 2VHUA 3TK1A 3FOZA 1NJ5A 3U4AA 3PSAA 4D9BA 4EHHA 3R5SA 3RC9A 1UPUA 1R4AA 2H4FA 2W6PA 1RYFA 3T4PA 3INNA 3HR8A 4ZV7A 4AMZA 2BISA 4HVCA 5JEEA 4F0JA 2P62A 2C4NA 3O82A 5K6AA 2VHZA 4NMXB 4YMWA 1ZK2A 5DNWA 2Y0DA 3LLCA 2NPIA 4FFBB 3AY0A 1W52X 4PIMA 5GM2A 4XQEA 2O8CA 1N1MA 4P0TA 4QQRA 1NN1A 3TSWA 1CY8A 1I2MA 1SCAA 3GMDA 4HWGA 1T3SA 3GARA 3O4RA 4AMBA 1PSWA 3UUFA 2QTRA 4MEBA 5DGHA 3DLPX 4G36A 4IFTA 1BVUA 3N8IA 3T5BA 8ABPA 2IIQA 3HKDB 4Q6BA 2WHEA 4B6FA 2XYPA 3M83A 1W4RA 2O3TA 5E0KB 5HGJA 4A8JA 1RRVA 3I61A 1G8FA 4D8XA 5D3QA 3TO5A 4F5WA 1EDEA 1JDPA 2R7KA 4WKBA 4DUZB 2ZSKA 3CEAA 3EUAA 4OHUA 4CT0A 3WJ1A 4EJSB 1ODSA 4LXTA 4RYDA 1I4LD 3MCWA 3UJBA 1EGVB 4EFDA 2V7PA 4AUKA 3OCZA 1E3WB 2IA5A 3DKKA 3E1GA 3EVFA 3L7LA 4IHJB 3ELWA 4AW9A 5B2EA 3UANA 4CKYA 3I32A 2B8TA 3DR3A 3TEFA 2QRVB 5ILGA 2W6QA 1JQ3A 1PUXA 3C3MA 1WP9A 1YR3A 1IEWA 2ADFA 4MYSA 5I9BA 1U3GA 3FUVA 1AT1A 4R7GA 5K2OA 2IY8A 1NXXA 2VAPA 4FEEA 3AH8A 3U60B 5BQXA 2Q2VA 4EHJA 2PIDA 2XH8A 1ZM9A 4F3RA 2R47A 1ZK3A 5BUQA 2CD7A 3F9RA 4NFYA 3FNFA 3OY2A 4FINA 3HJNA 2Y9PB 3UBMA 1WQ3A 3PF8A 5BUCA 1E66A 2GI4A 4DIOA 2Q1TA 1XTRA 1CDDA 5G02A 5B1DA 1RLTA 5A2GA 3C14C 3R7BA 1XBTA 1JQDA 1KZ1A 2JFUA 1QKJA 2BUBA 5B36A 2XUAA 5B7QA 2FX3A 1YNOA 4FYVA 2IOHA 3ZWAA 2J3MA 5KCMA 4JXJA 2VSOA 1V47A 1EIWA 1TQHA 1SIOA 2HCJB 2NOAA 3TLGB 2O6LA 5DCWA 2VRCD 3B6IA 4M0DA 4OI2A 4OKNA 2ZU6A 2ZKIA 2QTGA 3IS3A 4BO3A 4RJTA 1XDWA 3M4JA 3TCNA 1B1CA 3FOWA 4NCKA 5HPYB 3E27A 4ZAYA 2JEOA 3CLUD 4IIJA 5DNEA 1NJ8A 1RFGE 2C5LA 4ENPA 1FFAA 4YMLA 1ZUNB 2J9YB 1Y0BA 1E7MA 1V8DA 4PC6A 2J3LA 2QSJA 3M49A 4XM0A 1LTQA 4QYWA 2CLDX 1Q0TA 4KIJA 5D84A 3PXAA 3GRCA 2HPVA 1ESEA 2Z83A 2CNDA 3RTCA 3DE5X 2AQHA 4RGYA 4CR6A 3GLVA 2P4QA 4GLBA 4HLQB 5KO2A 3WGOA 5FD8A 2RHOA 1BCRA 1GPDG 2NU9A 3N0VA 3PRJA 4I55B 3QVJA 1XJCA 1NW7A 2VBCA 1J21A 4ESEA 4R83A 5CR9A 1EX7A 3AEQB 3C3EA 4B48A 5ICMA 4IDNA 4ZTZB 1RBYA 1XEXA 2A94A 4XE5A 4ND6A 4QJ4A 5ALYA 1OTHA 2YXNA 4TT8A 5CGQB 4DCSA 4UPVA 5A0FA 4X9XA 3KEGA 4H9GA 1P5ZB 3WLMA 2JIRA 1E4YA 5AJVB 1R10A 1TE2A 4RV9A 1GCOA 4RESA 3SQXA 4U7WA 1NL3A 3FMIA 5AVRA 4KNWA 1PDWA 3DEKA 4I50A 3V4VB 4AYXA 2WJAA 3K05A 3V00A 3QKWA 5HF5A 4JGGA 3ROFA 5JASA 1DX6A 1A5AB 1YTLA 3BXGA 3D3JA 1KK1A 2WAYA 1KRXA 1E0KA 2GPNA 4COOA 5K5EA 1QHHA 4QE3A 3M6XA 3GJTA 3PUVA 5AOAA 3FNHA 4KO4S 3UO8B 1CUBA 4XW2A 3RHFA 2SCUA 4BO4A 2JLRA 1ARZA 1J00A 2W2NA 5C18A 3QOXA 4YRIA 2VSFA 3NTQA 4TMWA 4ZC1A 4JEMA 1IZ7A 1PFYA 4F4JA 4UTVA 2Z3ZA 2FWRA 1UBGA 3KQMA 1ZJZA 1OZGA 2QN3A 4JBNA 5LC1A 3SC3A 4ATNA 3A6GA 3K5PA 4TV9B 1L3CA 4HT3B 1EE9A 3Q8KA 1CR4A 2GZDA 1DT5A 2ZI3A 1O89A 3D8HA 4BQSA 1MHTA 4PS0A 4LJ4A 5FUBA 5JECA 3KIPA 4KUHA 1FFDA 1H6CA 2XE6A 3GGDA 2BPOA 4ID3A 2B25A 3LFTA 3U1TA 4CNQA 1FMTA 3HWWA 3MWEB 1EA7A 4LV6A 4TWRA 1JPUA 2GN1A 2RDMA 3E9EA 1SHTX 2AMJA 1Q19A 1ZRMA 2OOSA 3ZH2A 1J24A 3EMBA 3FZEA 3GMSA 5TB5A 4C0LA 3M34A 4D3FA 1Y7HA 1WW2A 1JLSA 5HJ2A 2V0NA 3GJ4A 4C5AA 3DUWA 1FJHA 1ORVA 2EQ5A 2QW0X 4N7RA 4RD4A 3RUHA 3L8GA 1JE0A 4GZ3A 3ZHTA 1XCMA 4H3KB 3KYIB 1DRJA 3AETB 3C43A 5TARA 5TE9A 1K5HA 1YIAA 1Z5OA 1MORA 1UJCA 3K0BA 1L7OA 3KQYA 1CY6A 3AM5A 5CLIA 4XJVA 5CYGA 3X2EA 3I3OA 1PG5A 2ZBPA 5A04A 2Q5OA 3TS1A 2FQYA 3WB2A 3WFZA 4O4LF 3IURA 3KKPA 5ALKA 5C8YF 1GN8A 3FOFC 4G9EA 2PUAA 4E2XA 2ZCUA 1ZNYA 4QGBA 1L1EA 2H9AA 2K7ZA 1DKUA 3H6KA 4BO6A 4BNVA 4BTLA 1AOXA 2YWGA 4UFNA 2A35A 1JQLB 4AX8A 3IMKA 1V6AA 3S2EA 4US0R 5C1PA 2OQ2A 1WXIA 1FDWA 4YREA 1ISHA 1OV6A 2Y92A 2GZ2A 5FHRA 2GOYA 5FYQA 3DJYA 1DTWA 5KQPA 4LZZA 5JV5A 2IHNA 3DPIA 5ALHA 4UARA 4NYIR 3NAGA 4UXIA 3ZGXA 3ICQB 2FEAA 2AE1A 4CETA 3FH0A 3BT7A 2AF3C 4CDRA 4EFLA 2ZB2A 3O38A 4UZEA 2AW3A 1USUA 1T5HX 4LOAA 5BN5A 3TSYA 1I01A 3NJRA 3I2HA 4FMDB 4EPRA 4U5QA 1U8UA 4CQMB 4RA9A 2C7OA 4KPYA 4P32A 1KYIA 1TUBA 1XZGA 4DPKA 5H59A 2XW6A 5AUPB 3RNLA 2VRNA 1PNOA 2YRFA 2JIOA 1T2CA 3ABOB 1RTKA 3HXLA 3IFSA 2JCSA 1RZVA 3LSTA 5AW9A 2OYCA 3FDXA 2WQZA 1Z33A 2HJWA 2I03A 1R3UA 2NZJA 3FPKA 4KQIA 3UGTA 1JIVA 2JCVA 2JIPA 4LI0A 1ORRA 3WMRA 4CTMA 1IC6A 4GMDA 4HWTA 1F4PA 1KZYC 1Y4AE 3LLVA 3I12A 3ZDCA 2X8LA 1U2GC 5GAJA 4OHYA 1TPZA 1P3Y1 1TF5A 2F1HA 2QTVB 5K3DA 5PNTA 4EHIA 5CYPA 5LA6B 2GPWA 1VKJA 1I1HA 2PAAA 4BJ1A 1Z6QA 1L5SA 3G2OA 5LCXA 3WHLA 5CFLA 4G0QA 3HCBA 3TJRA 4IIGA 2QVCA 3WWCA 3OOSA 3EFEA 1OFUA 4D98A 3QHPA 4NQZA 1LD3A 1MVOA 4BZZA 1T9KA 3V4FA 4M0UA 3FUXA 1BROA 1E9VA 4L08A 5AQEA 2OFPA 3LCUA 5ESXA 2ANBA 4DJAA 1YDMA 2RI1A 1EK1A 3PVZA 2F43A 3CRMA 2WWTA 3FWKA 2D4AA 4JLAA 7MHTA 1BXGA 3I5AA 4LHWA 5B3LA 1WZEA 3D1JA 4NK5A 5K45A 4DQDA 1V3VA 1SHZA 2AJDA 3COYA 2O2EA 3KQOA 3K1JA 5EJ6A 5IFKA 4S04A 1D0VA 2CFOA 2YOHA 5AQ1A 4NCAA 1G63A 1W85A 2O48X 4PYNA 3WSVA 3OEEA 5ALTA 3GLQA 1SK8A 5CT6A 2A59A 3NT2A 3C4JA 2F00A 3EEFA 2AV6A 3K8QA 4IGIA 2HWYA 3KNZA 3VKWA 1OBHA 1VIDA 2WU3A 3JVEA 2BJHA 1ONNA 3O9VA 4UHFA 2UYYA 3U3XA 4UOZA 5F9HA 3CT6A 1BE1A 2H2WA 3UBTA 3IKTA 3U3JA 3LL4A 5F5XA 3TW4A 3H4IA 3ZTWA 3AGQA 3D3EA 3PUKA 2XDYA 1X87A 2G07A 2D5AA 3CURA 3DQPA 2OT3B 2VHYA 1NNI1 3PNKA 5B3JA 3CCCA 4YRZA 3KDSE 3MELA 4AAYA 1VIVA 2FUNB 1UK8A 1WKCA 3E1KA 3JPWA 4FLFA 4HATA 1USVA 5CPBA 4B71A 4DMCA 5KDDA 1Q14A 1U28A 2WJYA 3EIXA 3HGMA 3VSEA 4GLOA 2Q5FA 4C0SA 4ZVRA 4KNVA 1YQQA 1ORWA 3V5NA 4Q4JB 5CA1B 3DFIA 1UBLS 3B9BA 5A9SA 1SKBA 4MJ3A 3W6OA 2IYWA 3P9PA 2C9ZA 4YTEA 1TK9A 5C1IA 4JYAB 1GGFA 4QX6A 1ISFA 2ZQYA 1A8UA 4MQUA 2ODAA 4B82A 3DVAB 5FA5A 3UUWA 1CLUA 2P3OA 2VCEA 5KOYA 2VJYA 1V8ZA 2A5YB 2P7HA 4TWIA 3UJCA 3B89A 3VH4A 2XMGA 3KSRA 4JI1B 3C39A 4WNYA 1J8YF 3IYLW 2VSYA 2EZ4A 4YJ2F 4F5DA 1KORA 3AI7A 1EZZA 1NYQA 4BNZA 5F77A 5JRDS 2ZRHA 1M8GA 4NQRA 4BS9A 1PFGA 3ST7A 5IVDA 1XPJA 4LCJA 4OHKA 4C7JA 2X86A 1KMNA 1NRJB 2JGRA 4GKVA 5CXXA 4RBNA 1IBLB 3NCHA 4MUJA 1NIJA 3TH5A 5TEWA 4GHWA 1B00A 1MENA 2Q5HA 3HDHA 4R2XA 3WG9A 2B7BA 1N2BA 1B43A 2WTEA 3QBVA 1KJYA 2BKLA 2C9OA 4MWDA 4XWKA 2IYAA 8AT1A 2YVUA 5KNDH 4DR1B 3OJEA 3WHKA 4Q4LA 5BSRA 1N3YA 4AZ3B 2HMAA 3BMCA 4RF4A 4JCCA 3EA0A 3JALA 3GW8A 3HPQA 2OVBA 3T7EA 1GZ5A 4OLBA 3M6IA 4UU8A 4BNLA 1JEAA 1DKPA 1I1NA 5LLTA 4ND3A 5FBVB 5H9WA 3GFFA 3L92A 3P0HA 2W4IA 1TLTA 4RD1A 1Q44A 3E48A 1RQGA 1I0LA 3FPGA 1P9NA 4LVUA 3EGWA 4LY3A 4EGQA 4BV2A 1JEQA 4J1NA 4DJ5X 2C61A 3L6BA 3P0JA 3MUFA 3QUSA 4X8HA 2PT9A 3DKPA 3I8OA 3JTMA 4U6QA 2P2NA 1L5GB 3W5UA 2B69A 2VUUA 4AF8A 3NH6A 4KAAA 2FN7A 1LSOA 1GG2A 5IT0A 4OQZA 4RJJA 1TEXA 4OK3A 4DLBA 4DR7B 4OQNA 3HPRA 4DR4B 3PTLA 3TQSA 1DWQA 1L8AA 1HH4A 4HGQA 4UUMA 3VHLB 4EARA 4L4RA 1YC2A 4RHUA 3SYNA 4DYDA 1LDBA 1IM8A 2GCNA 1UZNA 1BMDA 3MBIA 3KPYA 3WGHA 1PUIA 1ATIA 4UC0A 4IIBA 1N5OX 2EEPA 1A04A 4FGKA 2F62A 3NTVA 1KQGA 4B85A 2BI4A 2FXIA 3W2FA 3WQQA 4DG9A 1KI6A 1T3HA 2WYWA 1PV4A 2PR2A 1EG7A 2QRJA 2ZSUA 4RIEA 3WMXA 1CTQA 5KU7A 1UOQA 3PJFA 3VU1A 2O05A 3LHSA 2VBFA 1Y5LA 4W8HA 5TQ0B 4BYMA 1UZUA 4LRYA 1OTXA 1ZGGA 4ZI7F 4NV1A 1SU4A 3NI2A 2IY9A 3FTNA 4EW1A 4HDQB 5JSQA 4JI0B 4UHHA 1N5RA 5C8DA 1DKOA 1TLLA 2M6SA 2IDKA 4ARZA 4OQQA 3RFCA 3E3LA 5JNLA 4J8PA 4OM7A 4OXXA 4N12A 4TMXA 1KRWA 4C4YA 1ZGJA 1R6TA 2OZKA 1ZW1A 3GOQA 2X0RA 4KXFB 3CVXA 4D3DA 5EVJA 3FY4A 1TMOA 5HR5A 2YQ4A 2ZRAA 3AILA 2P2LA 1BO6A 1JU9A 3IP6A 1GL6A 1YJCA 1NAIA 1NMXA 1PIWA 2B99A 4XGRA 4ANFA 2W4QA 4C3VA 4EABA 5SZJA 2GYWA 4K1XA 2PWYA 3F7OA 4FE4A 3UPDA 4E33A 3BCUA 1JQ5A 1MOSA 2G88A 3HU5A 4R54A 2LPMA 5JTTA 4E2WA 1NFRA 4YDSA 2ZRGA 2ZUSA 3KZOA 3R74A 3V7FA 1RC0A 2H9YA 4G9GA 3C15C 2YWEA 1FX0A 3UKDA 5E2IA 4Y9TA 1CDEA 4ND4A 4CIWA 3RWBA 2VSNA 1FVHA 1OHHA 5CD9A 4HN2A 1QRTA 2J5QA 2Y77A 1JLLA 1S8OA 2WB2A 3L7NA 4EF5A 1LVHA 1CZNA 3B5JA 4I6JA 1P39A 1GZ7A 3P9KA 4Y30A 3HYRA 1YSCA 1J99A 4QOSA 3G0GA 4Z1OA 5EQDA 4E7OA 3DCJA 1CS0B 2JLCA 1OXXK 2P0YA 4WOBA 2WV9A 1WNTA 2HQRA 4WUVA 1BMQA 4HX2A 1LA2A 3QSYA 1XTBA 1ZP6A 3ZDQA 4JQYA 2H2GA 3JWEA 1M0WA 3ZDYB 1MO6A 3GRUA 3O4JA 3A3NA 3SEAA 5JALA 2YH2A 4R2IA 5HF6A 5ITZB 2NACA 1Q95A 5CUQA 2QROA 4TRRA 3W5DA 4LZWA 4LZOA 4OX9B 2VQ3A 2WG2A 2X7XA 4URFA 3JZFA 5FH9A 4TWBA 1U2DA 4LOKA 3GA5A 4OREX 3KJHA 5EJAA 1TOAA 3BDVA 2CL0X 2CLEB 2J3IA 2GZAA 3KUDA 1DUIA 1YI8A 3L01A 4IZHA 3TNFA 4EF6A 1FYXA 2GPSA 4RVOA 4TKUA 4B7XA 1GGEA 1RYYA 1E7RA 4OHOA 4Y2RA 1G6KA 2EWWA 5HE9A 3T95A 2HW8A 1D6NA 3D7RA 3AEQA 3L06A 3ZY3A 4MLPA 4QVGA 4HVLA 3K9LA 3HLYA 1NE7A 2FEKA 4BP3A 2VAMA 4CM6A 4CF7A 3VJLA 4KHPB 1OW3B 1T4MA 2JK0A 2VLIA 3ED5A 3FUUA 3LQKA 4NZOA 1DELA 2DULA 1Q1AA 3WYCA 4B4KA 4BUCA 1CZOA 4BQNA 4YP1A 3I4CA 1L7DA 1DO0A 1E4OA 2A9OA 1A2QA 3GEHA 3B3JA 4ITRC 5G0UA 2FLVA 4K03A 2V7VA 2C2YA 1Z6GA 3SXPA 3X44A 4DS3A 3DC7A 2HZBA 3G9UA 3MRSA 4HNGA 4ZMBA 2NYAA 1SXJC 3U4GA 2QD1A 2RGDA 2V45A 4WVLA 2CUKA 2OKGA 4KXYA 2GSWA 3BFPA 5CFOA 4ZDIA 1RI2A 2OR3A 3DKVA 4MVJF 2J3JA 3BGVA 1DG9A 1A2OA 4A82A 1IK4A 4EJ6A 2YHAA 4I14A 1RP7A 2OGZA 3OVMA 3WLPA 3T3NA 4BLOA 2PKYX 3IHWA 4CDMA 1AJEA 2P65A 3CB2A 1H1DA 5F98A 2NP6A 1XRSB 4PN7A 3GLIE 2ZI6A 3UB2A 1V4BA 3C7DB 3KQWA 4AP5A 5AXDA 4LRUA 2FAXA 3AI3A 1Z36A 3TTXA 4XD7D 3BMNA 4LYYA 3P9RA 3I39X 2XTAA 4NPAA 5CDFA 3FLAA 4TYYA 6ABPA 3G7NA 4A6DA 4H0CA 5DX1A 1GRCA 2N1MA 3MTQA 4Z54A 2PEYA 5BNWA 3S8YA 1FIUA 1JIKA 3L8CA 4MLDA 3W9UA 4MAAA 4MUNA 4BQFA 3NBFA 2AFIA 2XKKA 2IEYA 2WYUA 3AUUA 3K53A 3ERCA 3ORQA 4MICA 1SM4A 4RVUA 1JNXX 1Z45A 4FZ3A 4LHYA 4O3MA 4C14A 3PC8C 3AY7A 3OUZA 2V9PA 4XGIA 2D4HA 1FL9A 5TV2A 4CHTA 3LZ6A 5HX7A 3OMXA 1H3FA 5P8WA 4EB6B 1LPOA 1UM9A 3KBOA 1YGYA 4G5YA 2X5XA 3NKVA 2FRDC 3CW8X 4MPRA 4IEFB 3KQUA 4KREA 1QLHA 2JH8A 3UXHA 3O91A 3CLTC 4EBFA 5T4BA 1N5IA 1GNSA 5KSPA 1U65A 4K8RB 4L3WA 4M0KA 1LBIA 4WFKA 5ENZA 3MYRA 1VGQA 4K9OA 1TUGA 4PSVA 4YCDA 1P6XA 1EXNA 3A2LA 4RQBA 4F7DA 2FWNA 3GLGB 2A1UB 4MVJA 1GRRA 1OFTA 2JGMA 5CW1A 5FO0A 3VU9A 4GP6A 5AVJA 5EXSA 1F8FA 4JOQA 3D8BA 3RKSA 2IF0A 2O0KA 3MTIA 4BVGA 1AG9A 2QR2A 4CL8A 4Y7CA 5KTSA 1RYMA 1UP7A 3EAQA 3VGPA 5IYZB 3UFXA 2JGKA 3DFUA 4U7HA 4P08A 2AL7A 2WJZB 3SHFA 3GFPA 1J0EA 3M81A 4M7OA 2C8VA 2FWIA 4O2BA 3OCVA 2NU7A 2PYZA 5ERGB 2CLIB 1CJVC 5BQPA 5C31A 3U0VA 2ZJOA 1DNPA 4DGQA 1PNQA 2C31A 3R3VA 2A2ZA 1NP3A 3O83A 2WTNA 3SK0A 4RSRA 1JIQA 4PGMA 3WB9A 4X8LA 5GONB 4K0RA 4R1TA 3LKBA 4IEEA 4U2CA 3TAHA 3PEVA 1XTUA 3F90A 5K2MA 1AXGA 2JJ1A 4FE3A 2EFGA 2Q3EA 3TDMA 1MA0A 1CJSA 2V96A 4NIMA 3ICCA 2O14A 4X3CA 4JBHA 4V2IA 1Z88A 1P9WA 2JDID 3DXFA 5CM9C 1IY0A 1HDIA 2LV8A 2DYKA 4KO1S 1EFVB 3JQ9C 3R20A 2JGDB 3WL6A 3ZE9A 1N7HA 4ZVPA 4DCOA 5AUOB 1D7AA 3IEUA 5DHSA 3AKZA 3EIEA 1YV9A 1GDHA 2DH6A 1S5PA 1RCFA 4JXKA 5IRCD 2IYLD 1LPMA 2ZFUA 1HFJA 4KQ9A 5B2ZA 4XD7A 3HCRA 3GIWA 2HEIA 1WSDA 3NWPA 2EJBA 4ZCLA 1CEQA 1UOPA 3EXHC 1NKTA 3N8GA 4XLZA 4GOJA 4XDHA 5ARCA 3S1LA 3TVTA 1W29A 3PDIA 1TMYA 2Q3JA 4HGRA 2VXOA 1WXGA 1ZBDA 3OE1A 4PRKA 4E14A 3JQAA 2B1IA 2QYOA 3KHKA 1ZNXA 2C8JA 1KMMA 2BRUA 4LCEA 1FSSA 4HQLA 2ZTVA 4QJIA 1XPUA 1PVOA 4LGYA 3GUCA 3F6BX 3BZWA 3EVAA 4PX2A 3UV7A 5L3VA 1QRUA 2HK7A 4Z2YA 4AZWA 4F85A 1CD5A 4PYQA 1XZHA 3GLHA 4ZT7A 4Y2TA 5GINE 2QSYA 3B85A 4D9FA 3PGKA 5I5EA 3EYAA 3SPXA 4LXYA 7REQA 4R0VA 4DR5B 1TVMA 3QVOA 3ZLTA 1KH1A 1QC5B 1SHLA 5CIYA 4UEJA 1Q7GA 2GA9A 1SU7A 2IBMA 1DBWA 3I52A 1F2DA 2HWXA 4HAUA 3NGLA 4JH0A 1X2BA 2R48A 4X7RA 1P5RA 3BJRA 4MB0A 1XL0A 3P2YA 3FB4A 4MR7B 4YDRA 4C4PA 2R6DA 4DT1B 6CHYA 5JS8A 3NBQA 3ZWXA 1M2GA 3A4NA 3GT3A 4DMKA 1QVAA 2F64A 5HK9A 4PFQA 1WUYA 2P3LA 3NV9A 2QYTA 5EP2A 2G9UA 3HVJA 2Z1MA 3FYDA 1RVV1 4ALIA 5KYGA 4EZIA 4TXNA 2ET6A 2Q0XA 4NBTA 2DBVO 4NYJQ 1UJ6A 5JDCA 1JU3A 2C7QA 4L5YA 1TA9A 2AG0A 2C42A 2QNRA 4UVIA 2MWMA 2ROQA 3QX3A 2ZQ5A 3COJA 5ALGA 2Q6OA 5H68A 1FNDA 4ON9A 2HA6A 4OGFA 5JHHB 2PY6A 4MHTA 3BAFA 1AKEA 1TZBA 1UBRS 2ST1A 2D1FA 5IT4A 1KAQA 4RFVA 1GTVA 1E60A 1G291 2QBYA 2OCYC 1G2IA 4MVWA 2C0PA 1OGIA 2OCGA 1HX7A 1JMKC 1J56A 3IR6A 4RV4A 1NNSA 1CIVA 1VYUA 1E2NA 3JQ9A 4RMGA 2VDWA 3PXUA 5P21A 5SYMA 1WUHS 5FFNA 2H63A 4IMJB 1G8GA 4DV6B 4MS4B 2HQ1A 4JR1A 4A0QA 5EL0A 3TQOA 1BGVA 4DA6A 2YOFA 1ECFA 2WB4A 3WMFA 5GIOE 1UXOA 2DECA 1ZA1A 5LR6A 3LPDA 5DM70 2Z6VA 1CUIA 2QJRA 3IHKA 3OPXA 3PQ6A 1JB9A 4FONA 4G2NA 5JISA 3W90A 3ASYA 4HAZA 2AG1A 2J6CA 2WZBA 4NESA 4X6UA 4XJTA 4NZMA 5CIWA 5F7ZA 1OAAA 3Q40A 1KMHB 4ZZ2A 1Y80A 3JSAA 1V2HE 4KXWA 3I8SA 3UIEA 1K3UB 2ZRIA 1XZJA 4X8OA 1UKEA 5ER6A 1K86A 1VJDA 1YDWA 5EIBD 4QOGA 2OFOA 2O9JA 5AHXA 5EZYB 1B8NA 3A3KA 5HE8A 1JIJA 3BH6A 1DC6A 3IQFA 2Y1KA