1Y7PA

1.9 a crystal structure of a protein of unknown function af1403 from archaeoglobus fulgidus, probable metabolic regulator
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
216
structure length
212
Chain Sequence
LRGLRIIAENKIGVLRDLTTIIANITFAQTFLIKHGEHEGKALIYFEIEGGDFEKILERVKTFDYIIEIEEEESFERVFGKRVIILGGGALVSQVAIGAISEADRHNLRGERISVDTMPVVGEEEIAEAVKAVSRLHRAEVLVLAGGIMGGKITEEVKKLRKSGIRVISLSMFGSVPDVADVVISDPVMAGTLAVMHISEKAKFDLDRVKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF1403
publication title 1.9A crystal structure of a hypothetical protein AF1403 from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 62
structure length 212
sequence length 216
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01842 ACT ACT domain
A PF18462 DUF5612 Domain of unknown function (DUF5612)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1y7pA01
3.40.50.10550 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Hypothetical protein af1403; domain 2 1y7pA02
3OFGA 1PSDA 1XTZA 3LOUA 2MDAA 3O1LA 2NYIA 3TUIC 1YBAA 3W7BA 3MTJA 5IT0A 5T41A 3CEDA 3OFHA 1KS2A 1M0SA 3AB2B 2J0WA 2P9EA 3DDNA 3OFFA 2RQMA 3TUJC 1UJ6A 3U7JA 3IBWA 2PA3A 3K5PA 1UJ5A 4PWUA 1O8BA 2LQJA 4GMKA 1YGYA 1LK7A 5JJBA 1UJ4A 3LUYA 1LK5A 2ZHOA 3OFEA 3ENWA 3MAHA 2CDQA 2J0XA 2DT9A 2PC6A 1RWUA 2P9CA 3IXQA 5FIIA 3OBIA 2KO1A 3DHXA 2I9SA 2RE1A 3P96A 2FGCA 3TUZC 3AB4B 4IO1A 5IS2A 1LKZA 3HHEA 2DTJA 1SC6A 2RQKA 2JHEA 2F1FA 3KWMA 3AAWB 2QMXA 2P9GA 1U8SA 4LUBA 1Y7PA 4X84A 1ZPVA 2F8MA 2QSWA 4GO5X 3UW1A 2QMWA 3ENQA 3S1TA 3DC2A 3ENVA 3L7OA 2JOQA 2LVWA 5IT4A 2QRRA 3NRBA 3N0VA 3DHWC 3MWBA 4M8LA 4NMLA 2H9ZA 4GO7X
chains in the Genus database with same CATH superfamily
2RB4A 1P44A 3WGKA 3M2VB 3EH2A 3WNBA 1OXUA 1PT5A 5A9TA 3DQPA 5K8UA 3SJAA 2IW3A 4F5ZA 2OCXA 1E96A 1SA0B 1G4HA 2UVWA 1HXHA 4JY7A 1V8BA 2WVJA 5IT9A 3GEHA 4CLRB 3QLUA 4DAEA 4YA6A 4F8JA 1YQTA 1CJVB 3T7CA 3KU1A 4M21A 4UAVA 2QGZA 3ILXA 1KRWA 3EVMA 1MO5A 4FPIA 1NVDA 1FPMA 1H9CA 3MOGA 4I19A 2Q3EA 3P96A 2A9JA 2Q79A 1U65A 4K0RA 4XSHA 1EVYA 3TEMA 3LY8A 1IHPA 1O6XA 4YB8A 5SY6A 2PO5A 4D02A 1KFDA 1TZ2A 5ETVA 1Z4JA 1FP6A 2QUIA 2J3DA 1X5PA 3H7HB 3Q8YA 3BRWA 2C57A 1F9HA 2YNHA 3WAJA 2KT5A 1PX0A 4C2MA 2IXTA 5AW0A 4XWOA 3EYZA 4USMA 1GNTA 2Y9HA 4Q1EA 1ISJA 4F25A 2CXTA 2B3TA 4YYEA 4KHPB 5D4PA 1JDJA 4UREA 1Z0FA 2PKXA 3EAGA 2WPDD 3GRVA 2P4SA 2W7OA 1F60B 2FYTA 2QTCA 5HOQA 1FMCA 1YVFA 5LLSA 4LCEA 4HGNA 4RIFA 3JAMY 3WI7A 2GWRA 2DO4A 2EEYA 3W2GA 3M5CA 3UNYA 2BGNA 4BYGA 3MM5B 1VMKA 2JC3A 4PZ9A 1G20B 1YBHA 3ZZOA 3OMLA 3RYIB 4DLEA 3GEDA 3OL8A 1N33B 1LQ2A 1K68A 3I64A 3LAKA 2W2NP 2C7BA 5J59A 4DU8A 3IR5A 4C7QA 3ZJ5A 1H5QA 3L7MA 2AZ3A 2PZAA 5LL6P 3GARA 2ZH5A 2FJ0A 5G0UA 2JI9A 4Z9BA 1E69A 5J5CA 5CEEA 1RLIA 4IOKA 1HW9A 3SE7A 1XELA 5CHEA 3VBEA 5DGBA 1MG0A 3GNLA 1BOFA 3Q10A 3AP1A 4MS3B 1R27A 1UDAA 2PX3A 2F67A 3TQFA 5IQQA 1I7SB 1TL7A 4EBBA 2ZNZA 3S01A 5IV4A 1X1BA 3IOEA 3Q2SC 4YWJA 3C4JA 2Q5FA 3F3SA 4CMIB 3FHJA 4AG5A 1IATA 4P7KA 1XK6A 2VQDA 1W6RA 4IAOA 2C9MA 4RPIA 1JLFB 2F43B 1FO1A 3OOSA 5BV1A 1Z4LA 4ZRNA 2QIFA 3AIOA 2KO1A 3HHDA 3T34A 2HHJA 3NNCA 5FBZA 1MHPA 3MM9A 3TO5A 2HQ1A 3T9ZA 2QUHA 1JALA 2VBGA 1BGVA 4MQFA 5EQTA 1OIXA 4IWNA 3C3YA 3AOEA 5LBUA 1E92A 5E7JA 4H31A 5EZYF 1F4LA 1PCXA 4JQZA 4Z53A 2QORA 4KR2A 3RYCA 3DHVA 2OUKA 4P3XA 4W4MA 4HDRB 4Z8XA 3R24A 3DZJA 3RJZA 4BCDA 3MCSA 5G0RB 3C16A 5KB3A 2V2VA 3NDIA 3KHHA 2OPRB 2Y1GA 3PHBE 1CEYA 5AXNA 5CTAA 3V8QA 3UPTA 2Y9PB 1YH3A 1A0OB 3KLBA 1M6VB 1W49A 3MWJA 2L69A 4TXSA 4MTLA 3P2EA 5K8JB 4OM8A 2PU5A 3V1UA 1Z0SA 2VZ9A 4CRWB 3GOQA 3V81B 2YZ7A 2ZJBA 3VR4D 2CLMB 3Q88A 3RTBA 3ABSB 2WHPA 3C0KA 2ALYB 1NV9A 2P6RA 3HUFA 2ZJPQ 2VDWA 2Z8ZA 4QQRA 2P75A 2GHQA 4A3SA 3HGQA 2YPZA 4ALIA 5BV2P 2CEAA 3B2NA 1TQLA 1S6YA 5DTEA 4Y2AA 1QE3A 3VVLA 1AGXA 1AN0A 4D8VA 3LUBA 3LW7A 1WKKA 1PZGA 4HT7A 2QX9A 2GGPB 5JJCA 4PX5A 3KRTA 5JNUA 4IJWA 5HP1A 1JHUA 2W2NA 4E94A 3RR8A 3T99A 5AWFC 1F9FA 4IIJB 1GQSA 3RIXA 2V7PA 2LP4Y 2ZZNA 1EM8B 2UVQA 3ZH2A 2DT8A 2EP8A 1JNZB 3QA3E 2GBLC 1UW4A 4V38A 3ZWWA 2C2YA 4AD8A 3HY4A 1Z5OA 4NVRA 1N2SA 5KYNA 1R0LA 1EK2A 4NX2A 1KBQA 1DIBA 2W2MA 2GLUA 3HH8A 4LR7A 2QZ8A 2CUTA 3KYIB 3MM9B 4JZKA 3IPCA 2G67A 4AZVA 1DQ9A 3CB4A 4D9HA 1XWWA 4K05A 4P2MA 3MWGA 4QQFA 4MGEA 4NZ9A 3NOXA 2ENWA 1E6YA 4EB0A 4ZAFA 3B6MA 5CXQA 4ECEA 5E2AA 4M0PA 1N5JA 3AG5A 3OSUA 2B8TA 3H9EO 4F97A 1MO2A 1RAHA 4IEFB 5LBIA 4RTJA 3NDJA 1GGKA 1DLOA 3FB4A 2PUEA 5F41A 3SCIE 1RU1A 4N82A 4PW0A 4BLPA 1IYZA 2N9UA 3QO9B 1HTTA 4WN9A 2YKMA 3JZIA 3MAJA 3TL2A 2H29A 5AP9A 1GX6A 4NWIA 1NUHA 1GL3A 1QB8A 3ESRA 2J8SA 4Z3OA 5I7UA 5IJZA 3AR5A 4PC1A 3U31A 4DZTA 1PV2A 1I4DD 4DCOB 4UY8T 2NSYA 4OZ0A 1PEKE 3F47A 4TQ9A 2YMLA 3UPUA 3ZS8A 3M3PA 4BNIA 3HD1A 3VALA 5EMNA 5TPWA 2D3ZA 2ASDA 3IWNC 3OFJA 3BL5A 2GCEA 3IUSA 2OAQ1 3E5MA 3UN3A 2EFJA 4DEZA 2ZGVA 1BW9B 4FDLA 2YOGA 5LXTA 1T4BA 4DB4A 4CO4A 3LGAA 4H7KA 5JCJD 3QYAA 4WBFA 4DIKA 3FCWA 4LQ9A 4IIEA 1NTRA 4C48A 2XQGA 1R6TA 1JEQA 4EARA 5FHQA 1RJFA 3MTKA 5TQ0B 2F6RA 1HKUA 1Z39A 5DYNA 3AB3A 4UC0A 2FK8A 1GRQA 2IHUA 4D44A 3U09A 2NYRA 3H2VE 4JENA 3SS7X 4U6QA 1JHMA 2ADOA 7FDRA 2D7JA 1SQFA 1GZDA 2XMCA 3VRHA 5FLXY 2ZRCA 2A9FA 1CF4A 1F60A 1O97C 4NBVA 3LP2B 1FFSB 1U28A 1F06A 3DFKA 1B4SA 3N75A 2AX3A 2IYGA 3I9NA 1H69A 4KXMA 2Q7DA 4QUBA 1NN3A 5HKBA 1OTHA 4P2BA 4LF5J 4LSGA 3JAKA 2WSCC 4TT3D 3O0TA 4CTAA 5CYQA 2YKNB 8ATCA 3TOZA 1I7QB 2WIKA 1BD3A 3OR1A 5L1IA 2EVZA 4NCGB 3MXHP 3NVDA 3W05A 1LRLA 1ZICA 2YTZA 3EYAA 4YASA 1C9JA 5DULA 1GXSA 4MVJF 4DKXA 4ERXA 2Q99A 4MR9B 4IG3A 2H9YA 3OKAA 3WICA 5KFRA 4RCZA 1UMDB 4AX4A 2F59A 4GPIB 3OKFA 5IK2A 5ERXA 3ZWNA 5DZ6A 2GM9A 2H48B 2PV0A 4HMOA 1SK9A 1XPUA 2R7XA 3W9UA 1CT9A 3VNRA 4WECA 3OPMA 1RWNB 4AIRA 1IN0A 2JGIA 3WXBA 1KEPA 4KMMA 3Q7SA 2BM1A 5J3JA 1QC5A 3D2CA 1IXKA 2PYIA 4U2BA 2JFWA 2KB0A 2O0HA 2QXYA 2ZJAA 3OXFA 4YAWA 1KZ6A 4JC8A 1LS1A 2BZ2A 4IPTA 1BQMB 1QMGA 4YRBA 4EW1A 5FD8A 1N3LA 5C5DA 4MV1A 1CB0A 2GO7A 2J9FA 5DXFA 1NUUA 2NXNA 1KH1A 2AL7A 3I4HX 3ZI7A 1ZZFA 4RFSB 5BSUA 4KXYA 1Q95G 4DNQA 4B3OA 2C2OB 3LUPA 3S2GA 1MR3F 3LL4A 2Z9BA 2UYOA 4ZPDA 4L72A 4I4CA 1LKZA 3C3EA 4RULA 5IKMA 3A8IA 3Q4GA 4BJ5A 1DCTA 4Q93A 5CD1A 1XRRA 3K53A 3WO0A 3VU3A 1TZMA 4EA9A 4DL6A 2QBYA 4IGKA 1T25A 4JJEA 3HUEA 2QSFA 2NU7B 3HBLA 3IA2A 4QHTA 4JMLA 4M22A 2GO9A 1N1EA 3PX2A 1DAOA 3HM9A 1SCUB 3MN1A 2LXUA 2NSJA 2OD6A 1NVEA 2R7AA 4QREA 3RUCA 1XMVA 3C7TA 3LWMA 1HQKA 3T4UA 1KORA 4AJ2A 4QUDA 2XVAA 3W65A 2R8XA 4CQMD 2GF2A 3BD9A 5DP2A 1RABB 3MFYA 3WWOA 1LQTA 1CW2B 3VDNB 2FN8A 5LYJA 1FS4A 3WLLA 3ELHA 5CZXA 2DLDA 1EDBA 2ZIUB 2P9CA 5CURA 1I3NA 1Z0DA 3NTXA 1JKIA 2CQHA 3QPBA 4N5LA 3MUFA 1QVAA 5ULLA 4BLTA 1WEYA 3DCJA 1F8XA 3KLFA 1VK3A 4BFUA 2J3QA 2AUMA 3N07A 5JSHA 1W88A 3F71A 1NXQA 2YWGA 5B4UA 1ORVA 1UL3A 3JPWA 4FX2A 4X65F 3RYFA 3QBCA 4ZA2A 5SZHB 1OV4A 1KRHA 3ZBTA 4INJA 2V63A 3TAQA 1G19A 2WHQA 3V32A 4I1PA 5DJ5A 3AUAA 5LQNA 3B20A 1Z2PX 3N8IA 3LD9A 5JQWA 5IBQA 3IIKA 1TM3E 4J3NA 5KMGA 3V3TA 1VQLS 2XCRB 3MRSA 4FYVB 1Z4KA 2CVHA 1Y11A 5PNTA 2C1XA 2AYBA 3UH1A 5DNDA 2Z1MA 1QKIA 2Z8XA 2Y92A 4FEAA 1PTJC 3I9V1 4D0SA 2RGGA 4B6EA 1RWMB 2I5PO 4TLBA 1FKPA 3IMEA 5LQCA 3BL8A 2DSNA 2VXYA 4LRUA 4BX0A 4IR7A 3CG0A 5EQDA 1KDTA 4QYZK 4PZAA 1ZD5A 4ARUA 3ZU5A 2YOHA 2AEEA 1GZVA 2UUBB 3TLAA 1PAEX 2IEBA 3GLGE 1Y00A 1X7DA 2E49A 2VJNA 4V0MA 3AH8A 2OXRA 5HJ2A 1A50B 1NF8A 2EQAA 3VKFA 1KOOA 4C7XA 4RK1A 4JLBA 2J9FB 3DW3X 1WELA 4AL5A 1Z6ZA 1BH2A 1L5HA 4EX6A 1J42A 2W58A 1EA7A 2X76A 4K0KF 5ITHA 4XJVA 3E9YA 3RHSA 1JLEB 1TIBA 4LTNA 1OXTA 3EGOA 3UIEA 2WIDA 1KZGB 1G41A 2M98A 4L02A 5CVEA 3CRZA 1XK8A 3N0WA 5KOIA 5HGJA 3TRGA 3SYNA 4DBQA 3RT9A 1NW9B 3PYXA 3UAXA 2F17A 1V3ZA 1T8WA 4ZT4A 3UA3A 4FZJA 1RTIB 1VMIA 2M1XA 3DONA 2XAAA 4XYMA 1ZETA 3VV2A 3HD2A 1D0EA 3TI9A 2DETA 5SZKB 3L7BA 4Z4IA 4IKPA 2C7QA 4RW9A 4FTWA 3KO8A 1J21A 4BAUA 4NS1A 2IYWA 4KPFC 1I2DA 5FWXA 1WI6A 4I68A 2JH3A 2ORVA 2JEZA 4CLTA 5CITA 4ITSA 4CM6A 2IS1A 4BBZA 4EG6A 4H6PA 2KJVA 1T03A 4WFJA 2IYZA 4QYRA 3UT5B 4N41A 4UKDA 1NJ5A 2IXBA 1VHDA 4XVCA 3LCUA 4X4NA 1YQQA 3KJVA 4IIGA 5A4KA 3DRRB 4QWDA 2GD2A 3TOSA 3IE1A 4UU7A 4I8XA 1FJHA 2ZRIA 4CYUB 2QTAA 4LBWA 1M0SA 2YJGA 2GM4A 3L41A 4W7SA 3R2CJ 3SIRA 1J9ZA 3EB9A 3MPDA 3ZWMA 2B2CA 1L5OA 3LPYA 3VC1A 5A0YB 4COKA 1HBOB 4BVBA 4GOLD 4EO7A 2NXWA 1JU9A 1PJ6A 1N1GA 1ZWKA 4BBPA 5C4IA 2OV2A 3M0EA 3GLGA 4YC7A 4Z4GA 1HFKA 4HNGA 1KVJA 1CS0A 4ZT7A 1IBMF 5GGXA 1Z7BA 5TS3A 3MWDB 1IN5A 2QSJA 3PDCA 3LC1O 3WQSB 3B1JA 2PEBA 3EHEA 1ORIA 1TUBB 1DCFA 5A7FA 4RBVA 4H0NA 5B53A 4CMHA 2FG6C 4GS5A 1Q3KA 1IEVA 4KGXA 2OMLA 1CQWA 2M9MA 2I6GA 2BACA 4KO3S 1FFDA 3FIUA 4ZO7A 2QD3A 2D5AA 3NGKA 3FUWA 3BIXA 5HBRA 3RT7A 1X8JA 2V9KA 1T5IA 5F2KA 3MQFA 3QF4A 2PYZA 4HNQA 2ZI5A 1TYZA 4UHKA 3FHLA 3RS4A 1I51A 4X4QA 1DXYA 3OZ7A 3OHMA 5FF9A 2BYCA 5TMBA 2WSIA 1TCCA 4K7JA 1U1PA 5SV2A 4R7ZA 2F3TA 5KG3A 2YBDA 1Z5GA 5KSWB 2VSYA 4OUKX 3R3HA 5HK8A 1JT9A 3MTDA 3POTA 5BY2A 3IBSA 1OQ6A 2K7ZA 5JPIA 3AAWB 4EW6A 3F1KA 2B8WA 4JKOA 4LREA 2FX3A 5KFTA 4GU5A 5DM6Q 1FFWB 4Z51A 3ZZNA 5FFMA 3PIOQ 2AC7A 1OA1A 2VSFA 2WM2A 4J90A 4JN6B 3QLEA 4W5JA 4UE2A 2C9DA 1GX5A 3U80A 1Q1GA 1JI3A 4TMKA 1R37A 1IKYA 5DB4A 5TPWB 5EIOA 1FW6A 4LQLA 1MOSA 1JLEA 2FEXA 4KRXA 5BRNA 4Q16A 3HL0A 3HXPA 4JJ8A 5FNVA 3TTWA 3WIBA 1G9SA 4FYKA 1W1WA 5G40A 4BP1A 3OFHA 1UXOA 3CR7A 1KQNA 2I6SA 1AS0A 3CCZA 1E8NA 4LZJA 4PG8A 2PA3A 4HNTA 2QX8A 2C2KB 4ZIWA 1UVMA 1DQPA 2BDPA 2YWKA 4DQQA 3FR7A 2RDMA 2WU0A 2JLVA 1U6FA 1U1KA 1PRYA 4X63A 1Y7HA 3G7UA 1A8PA 2YZGA 2PA8D 4N54A 2QW1A 1DTTA 3ZYZA 3JQPA 3HCXA 3MWDA 1RBLA 5CGZA 1JILA 1II0A 1O8CA 2I4RA 1YJVA 2BW2A 4W6QA 4EY4A 1ZIOA 1I1HA 3NAHA 2C3OA 2HHPA 2OZEA 3ZCQA 3M1LA 2FZCA 3HUUA 4DM4A 3HLKA 3M32B 2E0IA 2IDKA 1X7XB 3QTLA 3RTDA 4CQJA 3EIOA 2BI7A 2WILA 3W9JA 3WK5A 5L9XA 2CJPA 1EUYA 3S8MA 3H1AA 2JIOA 4XEHA 1WTCA 4NI5A 1K9VF 5AXDA 1K0UA 3SEOA 2PANA 2XJ9A 5JRZA 2A3RA 1CVIA 1JTEA 3SIWA 4YEDA 4CYUA 2WU3A 4RSHA 4PXCA 3LMKA 4JC0A 5FAXA 4UM9D 4NJEB 1TEXA 3C4QA 4KO1S 4GM4A 1Q5PA 1NXIA 3BRCA 4QJVA 4W99A 1X87A 2YNMD 1OSDA 5GJWC 1RADB 2E85A 1IWPB 4Q34A 3G9TA 3W5IA 1KAEA 2L0XA 4GYJA 3UYLA 2ASLA 1HWUA 4IIUA 3OTHA 4BUZA 1MABA 2WVDA 2E4YA 4TQGA 2B6NA 3J7AC 4LXXA 4MFBB 4KFTA 1Y9DA 1Y98A 5A62A 4P32A 3IA0A 4FNAA 4P0PB 2VJBA 3OZEA 5ETNA 3KM0A 1QS0A 2J87A 2EKLA 4YMEA 3AMVA 3VGUA 1HPZB 3VQSA 1H2BA 1YZ7A 1BHSA 3TLCA 4Y2PA 1Q1KA 2QQFA 3W64A 1A04A 1NF3A 1PGJA 2LDXA 3N8GA 2R1TA 2GVZB 1HMYA 2K2QB 1XTSA 4MA5A 4KBIA 4FMPA 2KX7A 3OIDA 3B38A 1YAJA 3BGWA 3SC2A 4E2WA 4BB6A 1MWYA 5TJHA 4CMBA 5JV5A 3MOSA 4PCVA 1FX0B 5ALUA 1Y10A 4OJKA 4ZIRB 1PYSB 2Q07A 2OT3B 1WR8A 2HO5A 3HPOA 2IDJA 2DPXA 2W6QA 2D3WA 1YT5A 1FP1D 2BW0A 4TS9A 1F5CA 3HGMA 4KVFA 4RENA 3SM9A 3U1TA 4LTMA 5JNTA 2AD9A 1QGED 3ZZ1A 5AT1B 5DNWA 2B8EA 5KFUA 1RRPA 3VO9A 4H1UA 1YITS 5KKCA 2IZ1A 4N9WA 3KJQB 1W5SA 2JLQA 2ZK7A 4PSUA 3PW2A 1ZUD1 1O97D 5HDQA 5IEBA 2C9ZA 4DPKA 3L43A 3MM7A 2QRVA 4RIIA 3BL6A 2B8NA 5JD6A 1FKOA 2ZSHA 3CA8A 4WK4B 5AK0A 3NFYA 5LXTF 4MZXA 1EFCA 1G55A 1T8SA 4PRFA 5IAGA 4DJAA 1I01A 4RGVA 3GQCA 1KZ1A 2X51A 3MD1A 3R4VA 2XXBA 1KEWA 4L95C 2ZROA 2WONB 2IYPA 4YJ3A 3WGVA 5EE9A 2NCKL 4A9AA 3X0DA 4CL3A 1A2QA 4AN1A 5LYJF 1D2CA 4WLNA 3A8KA 1KN6A 5F0UA 4MO2A 4BX8A 5TVGA 5AJWA 1FRLA 2HFJA 3K70C 4PFKA 4GECA 3BO3A 4O1MA 1K4KA 2MY8A 5KFOA 4UVGA 1ZD8A 4KN5A 4IG0A 1M1HA 3R8FA 5K8LA 3GRAA 5DDPC 3FDZA 3H40A 1UFVA 2VUTA 1MXFA 1SULA 2HSDA 3P4YA 2HDNB 2H7CA 1XMJA 1JLBB 4MRMA 4DVJA 3NRCA 1ZUWA 4QJ3A 4UUXA 2P2GA 5L9AA 4ID3A 4QULA 4PX2A 4H15A 4KWCA 4KV8B 4OX9B 3OQ2A 3CO0P 1B23P 3H25A 2WFZA 1ZDMA 3U7QA 3KB8A 5IYZF 3R6GA 3KUCA 1O4VA 2DY9A 2M32A 5HBMA 3F6CA 4E1VA 1GNQA 3DXYA 1RQ2A 1G60A 1P1TA 4RVSA 1X8KA 2PZ8A 2HI0A 4LECA 1FXSA 3PLNA 3B6JA 4ED0A 3I5AA 1VFPA 2XWXA 4A6PA 1RWOB 3KUKA 4KXQA 1AT1B 3OKPA 2B6AA 1CERA 3HKDA 5B4TA 3TX8A 1GSIA 1HOXA 4LMAA 2APJA 3KDOA 5E3RA 4Y7DA 2H08A 2ZU6A 3PLAE 2CVEA 4I6YA 2E5GA 5HBGA 4Z9AA 3REGA 1G6BA 2P7IA 4KGZA 3B6EA 3CO5A 1OFGA 3G2MA 5J1EB 3KWMA 1K3FA 1T1GA 3DEJA 8GPBA 4G5OA 2I7TA 4DSLA 4TTQA 1MU0A 4NU6A 2G0NA 5ABPA 5EXSA 2QYGA 1YRWA 3RBVA 4B83A 2FZGB 1V16B 4R1SA 4AY3A 3U9TA 2I99A 1SEVA 1K9MT 1ITZA 5JS1A 1OY8A 5HUQA 3K5NA 4LBHA 3WYGA 3GLFE 1KHHA 2CV2A 2XWPA 2D1QA 4LDQA 3ENKA 3A14A 5ENVA 1CR2A 3D0GE 4Q3OA 5TGTA 3VZQA 5EWGA 4JLWA 4MP3A 4XM2A 1WOPA 3BH7A 4ALJA 2W8KA 2YVUA 1NK5A 1CQIB 5ECWA 1CFJA 3D6JA 3NCQA 3FOAA 3T5JA 3COJA 1CDZA 3V97A 1VRUA 5IM4A 4FQ7A 2MDTA 1EP4B 3KJQA 5LKRA 4US1R 2JFFA 1DJ0A 3QH4A 4Q3BA 1G63A 3RYHB 2VNIA 2CPHA 3ZV6A 1U1NA 4PZLA 5EE1A 3OCXA 1V8DA 3RJMB 3EMKA 3I0NA 1CK4A 3TOQA 3MAAC 4NNPA 4LF4J 3LGSA 3AB4B 4LNAA 1YRAA 3GZ4A 2PGDA 1NX6A 1EDOA 3SY8A 4DM7A 1H66A 5DNEA 3ZY2A 2J6IA 1IEXA 4G5HA 1L3BA 3QEJA 2IV2X 3DUFA 2EWVA 1PZFA 1YTYA 3AUFA 2Q0XA 1HTWA 3SLGA 1LLFA 2VT2A 5KINB 2FP3A 1NIPA 3RC9A 2FWPA 1IPFA 3JWEA 3FVRA 4FNOA 2VBIA 2H2WA 4HJRA 4FLFA 3RFXA 3PPWA 4LC1A 4B2LA 3C5CA 1UQTA 2WMYA 4LIPD 2J7KA 4CRJA 5J2PA 4ELUA 1RJGA 3VQTA 3RJ9A 4G36A 4UHHA 5LA6A 3H8WA 4DR3J 5DHUA 4OYZA 3FDZB 3KK0A 4NS4A 1HBMB 3K2YA 1AB8A 2FHJD 1IUKA 3TNYA 4YHHJ 1JX4A 1R7IA 1EFKA 2OEKA 1X9WA 2QGNA 3TEJA 1HLDA 4MQ4A 5K8IA 4J9PA 4DIOA 3CKLA 2CQIA 3L8HA 4ABYA 3GFQA 5ETRA 1VRVA 2REBA 4DR3F 1E1QD 3B53X 1JIKA 4KREA 2G9UA 4DUYJ 2BVZA 3TAMB 3AEYA 2UZ0A 2IVMA 1Q22A 1YDGA 4ZJZA 3ETJA 4DIEA 4K9KA 2NSBA 2RHQB 4P81A 4BLWA 4GNKA 1J8QA 3V1KA 1JDTA 4D3FA 5BNWA 4QDOA 1WB4A 2F3SA 1MH9A 2FSSA 4XUDA 1L3CA 4EJFA 5FH9A 3BERA 2GN9A 3KXIA 2CC2A 4OHCA 1UBNA 4BEBA 3TVZA 3LGHA 1UDBA 1FCAA 1AKEA 2QPOA 3TD6A 5DV9A 3SOZA 4Z7CA 3MJRA 4ZYLA 1WC0A 4R2LA 3DTTA 4HEA1 1PNRA 2VBWA 4OQQA 4YQEA 1U7UA 4G81A 3NYWA 3E8MA 4PONA 3QQ5A 4IJUA 1JHAA 2HN9A 1G8HA 3DOMB 4B3GA 2PUFA 1J56A 3AY6A 4E2YA 3KSDO 5ER9A 4CEIB 3PQ6A 5JZ9A 3UEOA 4C87A 3UCUP 4ZITA 3QO9A 4KO0A 1SU7A 4H6WA 1LD3A 3IMKA 3EX7B 5T67A 2H07A 5KFLA 3ZQJA 2Q9AA 2GARA 1CJTB 5ALSA 3EVOA 2EDCA 5FIUA 2ISSD 4C07A 1KU6A 4I3HA 4ZN3A 3WRWA 4AJ4A 4CMGA 1EEXB 2V8BA 1O95D 4ALLA 1NUPA 3DUFB 5CX1A 3LPNA 3S5JA 1E60A 3SYLA 1V6CA 3JYLA 4I9NA 2QW0X 2EX4A 2UUOA 3PPVA 5CLJA 1OYVA 2HQ3A 1JBKA 1SOVA 3EUWA 2WUGA 1DIHA 4USKA 1GLNA 3FKQA 4KBFA 3PRHA 2BKVA 4UDYX 2FRVA 2ZRHA 2D1TA 3S2EA 1SVNA 5IFLA 1NBEB 2ZLBA 1CP3A 1DTWB 4JYMA 4WHMA 4IDOA 4IV8A 3LVQE 1LZKA 1QQTA 3A3OB 2A7XA 2JRLA 2WD7A 5JATA 4Q01A 1Z07A 3SG0A 3QSYA 5ITZA 4TLRA 3T3IA 4J16A 3LS2A 5AXBA 3P26A 4RMNA 3RVLA 2EF1A 5TQ2B 2ZBDA 5K9ZA 1MA0A 5GJVC 4QIVA 2JKYA 1XLWA 5IZ4A 4V02A 1M73E 5F23A 1EBUA 2RRBA 1C9NA 4FYWA 4PSAA 2CA9A 1HLPA 2R85A 2GGPA 2O2YA 2ACVA 2Y3IA 1F9EB 3AF0A 4F4DA 1LH0A 2CV0A 3BX1A 1P4GA 2ZE2B 1L5MA 4Q0BA 4EK9A 1THZA 3RM3A 3DOOA 3WK9A 2IE0A 2RQKA 1NVAA 4PBRA 2Q8NA 4RZIA 5JOQA 1HQUA 4G01B 4NXMB 3A26A 4G0ZA 2HVZA 1K3TA 3T0FA 4PTZA 2XMSA 5JXGA 3I23A 5IZHA 2A9PA 5JNRA 1CUAA 2DNKA 4ZPAA 3PR4A 4FYJA 3ND8A 3IR5B 1JDBC 1TKTA 1OLUB 4ZODA 1D7OA 3H5SA 1O58A 3IX7A 5I51A 1O6GA 5G3YA 3MJDA 1GMWD 2O1EA 2Q4TA 2MSNA 2NLOA 3VNBA 2QAGA 3I0RA 5CD4H 1S57A 4NG4A 5IKEA 4RAOA 3OCJA 1WNEA 1Q5VA 4BPBA 2IOYA 3AEUA 2Y6UA 1BO6A 2EFGA 4IRCA 5AI5A 1NK9A 3CRRA 1D5CA 1VBFA 1PFVA 2X0RA 1XWLA 3OUYA 4A8WA 5BN4A 2I87A 1S1UB 1T0BA 3PXGA 1WKVA 4Q0BB 1O6CA 1Q8BA 1ZD3A 1RXOB 4KFBA 1DC8A 4BC1A 4BP3A 3DGPA 2FJPA 3E7XA 1RAGB 4F5DA 3PUXA 1NK6A 3Q7QA 5HO4A 2P9GA 2OXFA 3ZCRA 4NICA 2YZ2A 2H1OA 1ZD9A 5ALWA 3FVYA 2VVTA 4Y2VA 5D85A 1JTFA 3MB8A 2OZLA 4E33A 1Q7LB 2YH0A 4WDRA 1WCIB 4XI9A 5FORA 1Z8HA 3NTVA 2W8LA 3Q0TA 4B5KA 1HQEA 4I2VA 2W1BA 3EFOB 1GILA 4MKYA 2V6BA 2VBYA 2O1SA 4XSGA 1GY8A 4IH5A 4EQ6A 4FNIA 3N7UA 1QYCA 3A3OA 1CCWA 4H7FA 4TKVB 4LE0A 4FW9A 3D3NA 2DHCA 1N33J 2JJ2D 1MB0A 1D1UA 1YZLA 2VHCA 2V59A 4YRLA 3K9HA 3O4JA 1X42A 2G88A 3CDAA 4XIGS 1B41A 2PTHA 3FR8A 3NBAA 2AB0A 3JARB 1J5XA 1NZ8A 2BBEA 1OGYA 4FI3C 4O2BA 4Q7EA 2CQBA 3R3YA 3GUYA 1XAGA 4PXBA 1IZ9A 2H3HA 1C0KA 4JOBA 5AVZA 2BEUA 4G0VA 1ZL2A 2ZUWA 3L8ZA 4RDHA 4GDFA 4R4JA 5EIBD 1QP4A 3DL4A 1JSLA 1WEXA 2HAIA 1NI4B 2HVDA 4M8IA 1CULC 2Y71A 1VJ1A 2QL5A 1LJUA 5LQAA 5D4OA 1S2MA 2KH9A 3ZXXA 5FWNA 1YKSA 5A6SB 2PRSA 4UUWA 2JDIA 3GSDA 1ZJ4A 3GJSA 5IDVA 1E9CA 4WE3A 1MQSA 3DFZA 1DEAA 1UDWA 2XECA 2V5HG 1R5NA 4DR1B 1T3SA 4PQGA 1B2LA 1Z74A 3SF8B 4RF3A 1HYQA 3KLGA 4H4CA 2WT8A 3L84A 1UWAA 2CDRB 1YJUA 1OFUA 3VKWA 3ZDCA 5KT2A 1K0FA 5L6MB 3I2HA 1IY9A 3QX9A 2GFIA 4EW3A 3F46A 1ZTWA 3E35A 2AZ1A 3CRW1 5FL7A 3AONB 1ISMA 1N6QB 4L28A 4CDNA 4U9RA 4PLWA 4BKUA 2VQSA 1R4MA 4FF1A 3ADOA 1JLMA 3DTNA 3NU1A 5DO9A 4EF4A 4P7VA 1K88A 3VR3D 2NMVA 5BSVA 1MC5A 2V4JA 2ZREA 4UJ5A 4EVSA 1GQFA 1YB7A 3F67A 4QAJA 4CP5A 2B4PA 3PU6A 5EWJB 3JQKA 2W0MA 3R8XA 2VAVA 4NFHA 3ZZMA 1WDDA 2Z58A 3RZAA 3PQCA 3G9UA 4C0BA 1E2NA 1AK9A 3NORA 3AJEA 1DLOB 4IVPA 3OFKA 1JA1A 4NI2A 2XNDD 2BFDA 3B9BA 2MLYA 1IBLF 5F5LA 3ILLA 4TWAA 1YS4A 2CWXA 2ZUFA 4FSHA 1JAHA 5B58T 3NHLA 1V5GA 2AE1A 4M3NA 3L7IA 1NQVA 3HM2A 1MB9A 2XUDA 2XRZA 3U3RA 1J5EJ 4P22A 1TL3A 3R9WA 1X4DA 1RKQA 4JP2A 4DGQA 3PFNA 5M2UA 3SJ7A 4R8RA 3LYUA 4U2FA 2XGGA 2A1UB 2PFDA 4L3VA 3JSXA 3Q15C 3IDAA 4W82A 3NXZA 1VIXA 3BE6A 4RHUA 2DTEA 3PT5A 3DD5A 3DFFA 1H3NA 2YJ5A 1O6ZA 3ZWAA 4RKRA 2NSHA 3ZW9A 2GNKA 2JH9A 1XTVA 3HNPA 1RLTA 4XDHA 2FHOB 4J7XA 3VHRA 4K9MA 2Q3LA 1YBUA 1ND6A 5GAJA 2LE0A 4ZOAA 2HHWA 5LD2C 1FFGB 3CPEA 5BPFA 3N9UC 2IVFA 5HLFA 2NU6A 4TKUA 3V4PB 1UKCA 3VGJA 1PWXA 3BM7A 1Y6GA 2PEYA 2FC8A 1QJCA 4JCCA 2QRNA 2RILA 1XROA 4O4LF 2JFQA 3KMQA 3NWRA 1CUXA 4S1TA 5KYGA 2WT4A 1H2YA 3IBGA 4OV6B 3G5LA 3NBZC 3GDGA 2J0SA 4QBUA 3EVTA 1BX3A 4KVGA 3RRFA 3TARA 3RRJA 1HNXJ 1OWOA 1WOMA 4G1IA 1N0HA 2AVDA 3HVTA 1I94B 1VHQA 3IG1B 3W5DA 1ZPDA 4I2QB 3HZHA 4IDEA 2UZIR 4N3AA 1YFZA 4KRGA 1SCNE 3O4GA 4OATA 5LOQA 3NG1A 3I9V9 2TECE 2CLDX 2V0CA 2X19A 3DDCA 3C6BA 3O38A 5IAAA 4LIRA 1HR0B 3SJBA 4S04A 2VOJA 1YMVA 3Q8LA 4YN3B 3HA7A 4FYMA 4HUQA 3QNWB 3CJQA 3HJTA 2HADA 2VP4A 1KOJA 3AM5A 3DM2A 5HHTA 4RA6A 5ALQA 1GPWB 1R9NA 4EAAA 3M30A 2YH2A 3GJYA 4NI2B 2BJ3A 4O2AB 1AUOA 2V69A 2QIPA 4BC7A 5E3CA 1BHNA 4R05A 1JG6A 2MY7A 4QOJA 1J23A 1L4NA 3EZOA 1L9KA 4DQVA 1Y8QA 1QYIA 2I65A 3BGIA 1N3IA 3H8YA 2CG4A 4LISA 2AWOA 3P4UB 3MCTA 2I6TA 4C6RA 3FPCA 1SKAA 4L9SA 1SEPA 5CFMA 2H7VA 3LZDA 3AY3A 4CKYA 2MSDB 1DJQA 4L8LA 3RIYA 1P7ZA 2GGSA 3D8BA 2CVFA 2FDXA 2JAPA 5LP6F 3N4WA 3D6FB 2OPQA 5BUZA 3JQ8A 3RC1A 1QGDA 3CTPA 4HDOB 2XTJA 3AQ4A 2CB9A 1NVBA 1OMSA 2JGFA 3UWSA 2NNWB 2G4VA 1KTIA 3THVA 4BQIA 4N7JA 1YJBA 5AI6A 4B35A 1NSFA 3N86A 4JLPA 4ILRA 2H1WA 3BDAA 3U61B 2XQVA 3VR4H 2DH9A 3OJXA 4AW9A 5K4HA 1Z34A 1UEKA 1WHXA 4YUWA 1E3EA 2QRPA 1UL1X 3OFGA 2GK7A 3CGIA 1AKTA 5J2UA 4IMIB 4F60A 4E03A 1CUJA 4ZDKA 3LKBA 1XEFA 2BABA 2DRBA 2Z30B 1C30A 3W6NA 4RW4B 3E3LA 1U9ZA 4FR0A 4XAQA 1JAIA 3AM1A 3Q41A 4A92A 3FNNA 5HQMA 2XGJA 4ZVEA 4EO9A 5EE3A 1UWLA 3RW7A 4C11B 5FRDA 2PS3A 1OXBB 3UT5A 5FUVA 3I04M 1YR8A 3Q40A 4D2IA 2I4OA 2X23A 2J85A 5BNZA 3BYRA 1KGSA 1H8HD 1XQWA 1SPBP 3CUUA 4HTFA 1U1CA 3IELA 4RE5A 4MRRA 1HFJA 2BEUB 2LCQA 1W36B 4NLDA 3RQSA 4RSRA 2CDCA 1PFQA 3BXGA 1Z22A 2XUIA 3E9CA 3PHTA 3MELA 4GO5X 3EXHA 4WU2A 3D54A 4MYSA 4MVJD 2I0FA 2YR0A 4QTTB 5B3JC 5I7EA 3OF3A 3AL2A 4X7RA 4KYUA 4ECYA 2H0RA 3A4LA 1OOEA 3L8FA 2GNPA 3EZNA 1PU2A 2NU6B 2ALZA 5CU7A 2X5XA 4KGVB 1WVGA 4FHCA 1L0BA 3K4QA 2W8ZA 2A4KA 1T8UA 5DT2A 3TANA 2JC0A 2NZ4A 1KJYA 4S1OA 1NVXQ 5B2EA 3O90A 2ZZMA 2GZ1A 2AOTB 2QZ9A 2R7OA 5K5EA 3PGKA 3H5LA 4QG3A 2NUAA 3W8EA 4N1AA 2COUA 3TJRA 3D3EA 5HCIA 2QZJA 3EBOA 3DPUA 5GOTA 4MIKA 3B60A 4AMGA 2ZYUX 1BMDA 3GDFA 3VOTA 5F1OA 3GT3A 1X5SA 3ABIA 5KUTA 2CKMA 4MI6A 2IH5A 2J6HA 1CUDA 2BPOA 4OKSA 3OL7A 1Z0IA 3N05A 4B9LA 1ISGA 1RA7A 3D6AA 3TLEA 2CXSA 4DJFC 3D5TA 2WPNA 3FTQA 4WCVA 1EWTA 1QAIA 2HRDA 3V8MA 3HHLA 1VQ9S 3NAIA 2H9ZA 4ANDA 2GD0A 2O1WA 3QJGA 2ZB4A 4G07A 3IXLA 2TMDA 1OX6A 3QWFA 1K08A 3C5HA 3AVYA 3GONA 4F50A 4YJKA 1TL7B 4LY0A 3RHFA 3LDAA 1L4KA 2XCOA 2XJ4A 3FMPB 4NE9A 4E2FB 3TZLA 2CJXA 2HFSA 1ZM7A 4PGMA 4G3XA 4LK2A 1LTHR 1ONSA 1W46A 2OHIA 5ALEA 5A6WA 1UXHA 1W59A 2JGDA 5CFRA 3C48A 5KNCA 3H3XA 4LA4A 1U0TA 3CVKA 4NBLA 1Q86T 4DLUA 2IBOA 3LUHA 4QU9A 5KX5B 1K06A 5KAMA 2JVRA 2BMAA 4ZQHA 4CKBA 3ZV4A 2BELA 2MZQA 3JCZA 3R76A 1NNSA 2KJWA 2NQ8A 1ZI9A 3WKBA 3ZFVA 4OLBA 4NESA 1Y7PA 3KLGB 2HUNA 5T3YA 1BDIA 4M60A 1A9RA 5EZYB 3A6PC 3MLEA 3BRSA 4X1OA 1Y8QB 1U0FA 3IAEA 3IV7A 2V3CC 4CTKA 4LYJA 3N01A 3ZGXA 2AN5A 4LJ8A 1NQUA 3I1YA 4C3KA 4MKIA 3RI3A 3D4IA 4DWOA 1P7YA 1WPGA 2EW1A 3OZSA 3JQGB 1ZCJA 4BV2A 4B6JA 4CEJB 3CJRA 3PXDA 1PFGA 3O8CA 3IVXA 1YQUA 3RAJA 3LFUA 4B75A 4LF9B 4LF4B 4NLPA 3IVMA 3X2FA 3CF2A 4CO1A 3VR0A 4ZP7A 1EX8A 3D8RA 1UTAA 1Q92A 3GPBA 3BBPA 3E1KA 4LFAF 3UXMA 3FMFA 4NMMA 1MUUA 4RLEA 4K1LA 5CBPA 2C2MA 4RNFA 4ND7A 3SN6A 1AD2A 1HYGA 4A8JB 1UM8A 4RFSA 3S2UA 4YALA 5EKDA 3GC6A 1NV8A 5JPDA 4PPGA 3M4NA 2XB2A 3R5JB 2AA3A 4AXXA 1GO2A 2IF2A 3LECA 2NO7A 4G0YA 3KTDA 3DDOA 3JSAA 2YS6A 5A05A 3R7BA 2FVYA 4RZRA 5B1SA 2JAWA 3DE7X 1TUBA 3D4LA 2M0GB 1TCUA 2R8PA 1P0IA 1J5EB 2GA8A 4V3BA 1M76A 2TMYA 2JVOA 4MRNA 4FHDA 4EMBA 1I5OA 2ERYA 3WYBA 1V5VA 2BOPA 4KHRA 1DT5A 3Q7TA 2XE7A 1UEXC 1BLUA 3VR3A 4A8FA 2ZWOA 3KZOA 2KFZA 2CMDA 3EVWA 4FWBA 1RLOA 2R79A 4IDKA 2DHHA 1LDYA 4G9GA 1PR6A 1JFFA 2ZFHA 2YWDA 1IXSB 3D2WA 3TIFA 3WGHA 3L0OA 3FROA 3W04A 2CUYA 1KPIA 2UUBF 1H0KA 2JLFA 1QAXA 4WY5A 4DRZA 3ENAA 2J3MA 2L08A 2W2QA 1A7KA 1U0NA 2GN6A 3O8QA 1VECA 4YP5A 3U4CA 3M2TA 2C5GA 2IYQA 1SH0A 1X9MA 1N2OA 3D68A 4TM8A 2FLOA 4X62J 3B6ZA 3FF4A 1TU4A 3KQKA 4D9KA 1EXWA 5COBA 3ZI4A 3U48A 1ML4A 1WY5A 2R1UA 1LRJA 1SNYA 5EJ2A 3UCEA 5KTQA 2HPHA 1H2AS 2R7NA 4YQFA 3EEQA 4L5BA 3UO0A 2RHBA 4GX0A 2ZRAA 4R7GA 1B6RA 5A4IS 4P3YA 1Q1ZA 2UZAA 4FDTA 3NGDA 3GLKA 4I6WA 1HX7A 1RHUB 2ATEA 3CGWA 1USKA 3BB5A 5B3AA 4LRFA 1M6NA 3A1NA 3DP9A 1TA0A 1YWXA 5ADUS 2G0IA 2GIFA 2GMJA 3W2HA 5KOJB 5EZ5A 3NWJA 4U2DA 5LN1A 4H1TA 3WJAA 4G65A 2GBFA 4CUJA 3ZHTA 3IJRA 1JFLA 4HDKB 1NGSA 1OLUA 2O7QA 4DQDA 3SJZA 3NKFA 1MDBA 1WLYA 3W8RA 2DERA 3STXA 1HDEA 1FEHA 2Y8EA 4CLOB 1XMQJ 3AHJA 4X41A 2CQGA 3QAUA 3UHPA 3I2FA 4JB8A 1YZGA 2CHVA 1TFUA 1FDSA 2LA6A 1CVLA 1PBUA 3QKRA 5DHSA 3OZAA 4OMUA 1LK0A 4DDHA 3LC7O 3OQMA 1L8XA 3PRYA 4JZYA 3FCVA 1PR0A 3RB6A 1XEZA 4FVTA 2DH8A 4NLRA 4A0SA 3RJMA 3ISNC 4DMRA 2OEMA 4GAEA 4MWDA 3OP4A 2W6IA 1VI6A 2D06A 4D56A 1P9WA 4R98A 3BULA 2IIHA 3PXCX 3WXMA 4R71A 2ZD1A 1EZ4A 1UP4A 3E7FA 1VLYA 4R5MA 3PXEA 2G1AA 5HKLA 2Q3DA 1Y1LA 1IIBA 3M6MD 1Y1PA 2X1HA 2LR0A 2X77A 3Q2OA 5ALJA 3I5XA 3CUSA 4KKOA 2Y1IA 1VRTB 1DAIA 1E7WA 4QFCA 3BA6A 1TUGA 4DL5A 2PBRA 3CUVA 1DTSA 4CLHA 3SXLA 4QU8A 5HVNA 2PBFA 1UBHS 4I55A 2F3PA 5AIBA 3O2IA 3O8BA 1E7MA 5F8LA 4DV3B 2G2ZA 3NHUA 1MTOA 5HROA 1C9EA 4UFOA 5GOZA 3CZCA 4KLCA 1WULS 3CCVS 1X1CA 4NL5A 1X7YB 4LVUA 5FL3A 3N70A 2Y99A 2CWWA 2KYZA 1QU2A 1G38A 4RM3A 1VIYA 2WJPA 4H16A 4DFMA 4K4SA 4CNBA 2ZBRA 5T7LA 4ZYVA 2B4OA 2WDPA 4A8KA 3H5VA 4GVPA 3W4JA 5L4LA 2DE0X 1AZSB 1PS9A 1XTUA 2MSKA 2XB8A 5ADVA 2HHLA 4EHNA 2PA0A 3PA6A 4R1LA 3DKKA 1N5VA 2QTVA 4M7PA 1EDZA 5I9MA 3WJ2A 3Q3GE 1QAMA 5LOVB 1GU7A 3Q7RA 2DP4E 3OX4A 1JHOA 1WO8A 3RK4A 3HP4A 4HTIA 3FWKA 5CVDA 4JBYA 5HMZA 4NMXA 2O7VA 4DDMA 1DX4A 3G3EA 2HK9A 2H1RA 1LWFB 3IAS1 3VZPA 2G76A 4RQAA 5EKSA 5A5DA 4M1EA 5KNBH 1DZ5A 4LZNA 3L8GA 4K28A 1CJKA 1Z3IX 2WZCA 1N2CB 1XZCA 4ZZ3A 4MVWA 3A3YA 1JEOA 3KG2A 3UK2A 3ONNA 5CYMB 2V9ZA 4EYEA 1BQNB 1JHVA 4B80A 4C6SA 3VYRB 5H4HA 3G6KA 4FINA 1EFDN 4IIHA 1QGZA 2GFFA 3RVBA 5BP7A 3G71S 3ZTTA 3D8NA 4Q02A 3WX0A 3ZDEA 1WM1A 4RX1A 1R6AA 5BSHA 2J6TA 1WC3A 3NS6A 3FYUB 5JZBA 2HVIA 3MT0A 3B5EA 5HKAA 1VLOA 5LNK1 1SWVA 1CJCA 3NV7A 4BMVA 2IU6A 3AK4A 1PV1A 3H42B 2HRBA 3AP2A 4F5WA 2HZ7A 4JELA 3P45B 4HNUA 1P5ZB 2A6OA 3A37A 2VATA 2PL9A 1QGUB 3C8YA 4HWTA 1SCQA 2Q4BA 2HX1A 1IUJA 3EBPA 1EX6A 4PZYA 5H0IA 3E27A 3AJ8A 4KWIA 3K57A 2QT1A 3QHAA 2XMQA 4C8ZA 1QHXA 1UJBA 2JZCA 2CSUA 3HJUA 3ZNJ1 3BILA 1KBZA 2WB4A 4I6JA 1SJFA 1E77A 4PHHA 3CZ5A 1W7AA 7YASA 3MEKA 1H2UX 4UNIA 1ELOA 1V16A 1P2SA 1SPBS 3IPLA 4JI0J 2IZ6A 1TU0B 5KVCA 1SXJC 1TKTB 4A2CA 1F3OA 4JI2J 4IR1A 1UVJA 1TUGB 3T7KA 4DX7A 3OD1A 4JP3A 4HYQA 5FO1A 1PQYA 2DR7A 3AR6A 4IXNA 4JB0A 2V9WA 2VJMA 4TMZA 5DBHX 1SCDA 4EG7A 1QV9A 2JBAB 1SUSA 4UTRA 1ZH0A 3WMFA 1XYVA 1UXKA 5HI7A 1SC6A 4EFLA 3F8WA 5HJ5A 5KEIA 1XEWY 1PC5A 5CDGA 1W1UA 1EAYC 1FWPA 5BN5A 5B12A 4DN6A 2O5EA 1WXFA 5J1SB 3AUUA 4KBYA 2CUKA 5E1DA 2HK3A 3DXSX 4UE3S 4P75A 5AOBA 4D5EA 4RU2A 1B76A 2XGMA 4S12A 1LWEB 3RYTC 3TCXB 3NOOA 5DRYA 2FXIA 4M46A 1TL5A 3A4VA 2FMXA 1Z47A 1VRCA 3F6BX 1DLIA 1R6UA 1PKUA 3EDOA 2AJ0A 1G2PA 1KQFB 2I3AA 3LIPA 3LRTA 4MPJA 4YAIA 1V3UA 1UAAA 4BO1A 3RV4A 3ZLJA 1E98A 1U0RA 1KFBB 4FPXA 3IDZA 3K0FB 2ZH6A 2BE2B 5BN1A 1IXRC 3IIIA 2XSJB 4CMEA 4QA9A 1G3QA 2CFIA 3INRA 1JLQA 1SKWA 3O44A 1RT6A 4CTNA 4OYMA 2UDPA 2PH1A 2XV1A 4ELVA 3EGCA 1R7RA 3PNOA 2ZJFA 4OP1A 3NI2A 1XU9A 5CYMA 1Y8CA 4GD3Q 2FPOA 3G82B 4P38A 1TJYA 3K9QO 4DDTA 3FETA 4IP0A 421PA 1E2MA 4EPTA 3CBQA 3S68A 3NBUA 4PYJA 2HQSA 5ICCA 4ZOSA 4DR6F 5D00A 5ALPA 3KB2A 2PD6A 5KFQA 5BSEA 2RONA 3QKRB 1TM2A 3IUEA 3I12A 5AKEA 1R0RE 3F5QA 3TL3A 2D8AA 3Q1KA 2XUKA 3T95A 2C03A 1V8ZA 4JI3B 2UZ1A 4Y0VA 3TZBA 1V2GA 5I9LA 3MR6A 2BDEA 4TXMA 2E7ZA 1NMSA 4ME6A 5DNYB 1TRHA 4IHJA 2ZD1B 4Q3DA 4TT3A 2A0WA 4YIHA 1U7XA 1E79D 2OC9A 1MKYA 4QXRA 3UWOA 3WE7A 2ZUBA 1XIVA 3VAIA 1UBKS 4OYRA 1ICEA 1K9SA 5I9NA 5CYJA 5CW1A 2VJKA 1NSAA 3VZDA 5IWAB 1EP4A 1W7WA 2KI5A 2YVLA 3ZE8A 3U19A 1FD2A 3L1UA 3OWHA 1FNBA 3HBJA 3EJMA 4QPCA 5I4CA 2WTAA 2P69A 5CJJA 1U9IA 1YRYE 2FOIA 2IRUA 3CUYA 4Q9HA 2QVGA 2SICE 2FMKA 3D7LA 2HHHB 3J80A 1W4ZA 4DR7B 2AJ8A 3B70A 2BJHA 2XB4A 1VE5A 1S01A 5KYXA 1BXRA 4MQUA 2IIPA 3ADAC 1W0KD 1VJ5A 2WF7A 3SNKA 3VNUA 4N5SA 3WNQA 4N0QA 3UVJA 5I4KA 2C2ZB 4EY6A 2ZI9A 5BOSA 2IL1A 4AWXA 3GJSB 4FBTA 2ALJA 3KJZA 4KB7A 4RL4A 2H1FA 5T4BA 2GDZA 3GP3A 5KU1A 3OQ1A 1QLNA 4DS5A 3GDOA 5CUQA 3SFVA 2FE1A 3KPYA 1UANA 2YMMA 4NSNA 4E8UA 1J7KA 5K0FA 2QNBA 2XBUA 2R8BA 1K4YA 4YAOA 1Z26A 3KQVA 3PO5A 2ZSUA 4C3OB 4EMDA 4KQ2A 2V1UA 3MTIA 3DU5A 3MHYA 5IVDA 1F51E 1XZNA 2SKDA 3H9GA 2FKNA 4OQ4A 2MKKA 1CY2A 2ZZTA 4W92B 3HNOA 3QU4A 2HZAA 1U8EA 2WIAA 2Y2VA 1WOYA 2ZJ6A 2IIQA 4ER6A 3ZKAA 1EB8A 4M5KA 4UTOA 4MVJI 5E6SB 3MMPA 5DIFA 4QCLA 2G4CA 3DULA 4M53A 1EHIA 2NUTB 3R6GB 2BRLA 5HKKD 3CEDA 3ANYB 3NATA 2ZYHA 4RM2A 2LVBA 4U4AA 1SVDA 1RQGA 3PNSA 4QGAA 2AC4A 3VNAA 2XI2A 1MAVA 3FI0A 2H5JA 1XP5A 2N4CA 3JQMA 1DELA 3N2EA 4I1SA 4W63A 1NMXA 1GQEA 1C7IA 2FPIA 2F4VF 2VJYA 1XNJA 3O3CA 4TS1A 2DNGA 4G0UA 4H4KA 2ABYA 1FB5A 2JAXA 4G85A 1KSGA 2B30A 1QM9A 1SKMA 1G6HA 1IOLA 3GZNA 1PR5A 1IHYA 2N4DA 5FFFA 3S40A 4TYMA 2DCLA 1P5RA 4EKIA 4PIPA 3HCWA 3WK6A 4D0NA 3R5CA 1JQGA 5ESXA 4LWQA 4HEHA 1C1XB 3QFCA 2AR9A 1P9NA 1IQUA 1DFIA 1S1MA 2HGMA 4ZT3A 1S9HA 1A1VA 4K4YA 1Z45A 2Y0SD 3KALA 1C5KA 2ODWA 4E5KA 5KOHB 2W4PA 5EUHA 5CFZA 3BPSA 5HK4A 5ETSA 1JIIA 1FVFA 3EVCA 1IN1A 5A3RA 1NPRA 4C03A 4MK9A 1DSSG 4M0MA 5T41A 1UCFA 3BN4A 4LJ5A 1DCMA 1D8YA 3ZHVA 4BDSA 3MG9A 1TEVA 5LOVA 1P33A 2AYEA 2UVRA 1FNXH 3TZEA 1PNTA 4LRAA 3I28A 3V6JA 1P1KA 1ADYA 3ORFA 1G18A 3UA4A 2HNDB 2CLCX 2DECA 2ZUGA 4ON9A 3WWEA 5DK6A 5J2QB 2ZDOA 1QIKA 3ZXYA 2BSQA 4YROA 3PHEA 2AOVA 2RBKA 3ZV3A 2CRLA 1VJTA 4J0IA 3M6FA 2QG4A 3CZMA 3WWPA 1C9DB 1AHPA 5CVCA 1OJ4A 4RZUA 3QVJA 4LXUA 4X4VA 2PKCA 1XGKA 4UMDA 2XY4A 4HQ6A 1GGNA 1VMBA 1JA0A 2QU8A 5C53B 2M2IA 1YFLA 9LDTA 3DZDA 5HMWA 4QEKA 2XB9A 5TF4A 2E9RX 2VYFA 4DRYA 4DG1A 4WACA 3DMPA 1M5OC 4OZJA 3DB2A 2FU5C 3R8CA 1DAEA 1E3WA 1TYCA 3ILHA 3PDJA 1RHJB 4ANCA 1E6KA 4M9SA 1IWAA 3ZJYA 3TVDA 2X13A 4ZVVA 2ZRDA 4KYZA 2QG6A 3LQ2A 5MGBA 4MLCA 2BFCA 5EXDA 1OWXA 3AVUA 1EZZB 1U6BA 3MGJA 2JLRA 4U9HS 3DYBA 1XZFA 2SECE 3OZTA 2J5RA 4YJDA 1AUPA 3I5MA 1ZD1A 1NK0A 3GO4A 5C51B 4RUCA 4I5IA 3BKFA 5JBIA 4QUHA 1ZI8A 3P94A 2HXGA 2ZBQA 4BNDA 4MQ5A 2H00A 1X5TA 3UAGA 4W6ZA 2YMPA 1FSSA 2FGCA 3G6YA 2O0LA 3BSCA 4JI4B 2AYXA 3JYNA 2F00A 4L2IA 4RMJA 4PC7A 2XGQA 2PV7A 4I3GA 2HJRA 4DV0F 3KIPA 1NRJB 2VK1A 3H0EA 2ACWA 1K2WA 1N52B 3QYPA 4RJKA 5L1LA 3IESA 3PWSA 3H84A 3NXKA 1WEKA 5DEOA 3Q8VA 1SA0A 3O6QA 2CXOA 1XYGA 1UQRA 1QBKC 4X66F 2VJMB 1PKXA 1KEUA 4UZFA 2V58A 4DV5B 5E95A 3SDSA 3STTA 5HTOA 2YMQA 2FZ4A 1KE2A 4AQYJ 2ASVA 3DRYA 4OLOA 1CIPA 1KH2A 2BFCB 2QRUA 1M1KT 2NVUA 4U67Q 3B3QA 3LBYA 4HFMA 4E0DA 5CFPA 1Y81A 1X7XA 4TVBA 3R44A 1E6UA 1GR0A 3PNIA 4DV0B 2JHGA 4RUBA 2B1QA 2WMDA 4QYTA 1HY3A 4YLGA 1YQHA 1H4VB 3HO1A 2VUSA 1DU4A 4O44B 4K59A 4RYLA 2WAMA 4NZOA 1P1IA 3ZQKA 3GRCA 2X0DA 1OI7A 2J59A 2GPJA 4OZ5A 2VPYA 2Z56B 3D7SB 4ZJYA 1NBWB 1NJYA 4NBRA 5B58C 5K3OA 4BFVA 1JLBA 4MRMB 3OIFA 2H8KA 4QUEA 4PQYA 4WCDA 1V7ZA 1RT7A 3KUUA 4U39A 3SZOA 1XP8A 2DM6A 1D8TA 4LOAA 4U2GA 1VHWA 1JDUA 4W9NC 4DZRA 2W6JD 1QZUA 2RAPA 4WAUA 1W581 1LPAB 4D4JA 2XDQA 2WM3A 2QP4A 4JX8A 4FOLA 3A6HA 4X4UA 4G1FA 2F8LA 3K1TA 1E6EA 3DDIA 4PHCA 2MQMA 1N5LA 3NOVA 1TJPB 1Y9AA 3OTOB 1T8TA 1T9WA 3OZUA 4RF5A 3UFXB 3CE6A 1KVUA 5DWVA 5JHHB 2HBZA 3HE3A 2NPIA 4AT1A 3LQYA 4LN1A 1PS0A 3S70A 5DG8A 3ZU6A 4YBRA 4N03A 2AMYA 1EFPA 5KFGA 5DNAA 3MNFA 2VQFB 3QELB 2I2YA 5FI1B 1QVWA 4KR0B 2YWWA 3F44A 2CAJA 2IRYA 4GVBA 5J2QA 1YK9A 1WTBA 2EG5A 1GA4A 1QAQA 1Z5PA 1U8TA 3MFHA 1Z0KA 4F04B 1TYDE 1ODTC 3OSPA 4IHAA 1XAHA 1M8GA 1ORTA 1Z2DA 2RGRA 2YN4A 4REQB 4G1EB 2UZ1B 5EJ6A 1E5QA 1NF9A 5K6AC 2B35A 2QRLA 5DLEA 2MQNA 3MEDB 3D7MA 2DGOA 5CB6A 1JNYA 3L7OA 1RAOA 2K06A 3Q2IA 3N0VA 1E9DA 1DAFA 2IUTA 5CM2Z 4DFKA 3OJCA 1TMMA 2C1EB 1IY0A 4C08A 2M6RA 3BMCA 3ZU2A 4KTQA 4CF4A 4G84A 5HYVA 1NK7A 4P53A 4UUMA 2XLBA 1PK9A 2QZSA 4YY3J 2D1CA 1KI2A 1QDUA 4JWKA 3MDFA 3F7OA 3CJ5A 1DHMA 1M2JA 4I50B 1YA8A 4YLEA 4J9QA 3ANMA 2FWNA 1TT5B 1QFJA 4CKCB 4C97A 2ZVDA 1EE9A 1HZZA 2VDPB 3GG9A 2VA9A 2JFNA 1XRSB 1JJ7A 4RA9A 3T1AA 4UD2A 1YACA 2OCYC 4XOIA 5BSKA 1JR3A 1Z15A 4ZICA 2VJVA 1G1AA 1HL6A 1ZSVA 3D2AA 4HACB 1M5KC 3O47A 1PZNA 4ZOLF 4ITRC 2KZZA 1Y1QA 2LBPA 5E6UB 4HGQA 2B9XA 3CT4A 3AIMA 5E3QA 3KSMA 4KNWA 3PX7A 1KAOA 2O8FB 3VR2D 1FF2A 1A8UA 1HNZB 2G4BA 4BKPA 3D54D 4AQYB 5K6TA 3NT4A 1U1GA 1GPNA 2QM3A 2QFIA 1MAWA 3WL3A 4HFRA 3PFIA 3I9JA 2ZIEA 1URRA 2VDVE 4DY4A 3QJ5A 4B43A 1XMIA 2Z58B 1BY9A 2JVJA 3MYYA 4G09A 4RNNA 2QBYB 4GXQA 4WUVA 1BFUA 1ZN7A 3AYXB 4DMFA 1PR3A 1SUDA 3X3UA 3KX2A 1T13A 1MAHA 5M2PA 3WRXC 3T1QA 2Q1LA 3OQBA 1FYXA 4JUAA 4GRSA 1POXA 3KPUA 4UUNA 5EWEA 4CO0A 1FLDA 1E2PA 2N42A 3AI3A 2HSJA 3FXAA 4MJXA 2OMEA 4YR7A 4GOKA 1QKKA 1GNVA 4ZU6X 2GJ8A 1SGWA 4L0MA 1COZA 1RRKA 6YASA 1N8SA 1DEOA 1XN9A 1MH1A 2HCRA 3VAYA 1O9GA 4HN4B 1EFUA 3S8YA 4ZTZB 3P4UA 4UHEA 3AHHA 1R74A 2XMVA 2VKQA 1H7WA 4PO1A 3WQRA 2FFHA 3UK1A 3ICWA 5LR6A 4GIBA 4C7JA 5AK5A 5EMMA 2I6WA 2OZPA 2BMWA 1XFAA 2R7UA 4IVQA 1ZH5A 1QO0D 2Q1UA 3DBHB 3DLGB 2DTDA 2PXCA 4DYDA 2CNOA 3AJ9A 4JBGA 4MAKA 1GRVA 3RUAA 1KVSA 2I4NA 1CP2A 3GT4A 1GZ3A 2O1PA 1HW8A 2XY7A 4COOA 3JU3A 4IJKA 1EP9A 4OH7A 5KHAA 1NDHA 4LNUA 5AXKA 1SJ1A 4DWIA 16PKA 2HJWA 3F4KA 4OHVA 2E5LF 5IVPA 4G5GA 3D1JA 4PZDA 1TMKA 1D7AA 2CB0A 4R8VA 4LSLA 2FF7A 2L17A 3U4HA 1DTTB 4CKEA 1Q0LA 2G70A 4PPZA 1ABBA 2W0SA 1BJKA 3S1AA 4BVAA 3GNQA 1RT5A 4R2MA 3ZCSA 1BJRE 2FMUA 4GZ3A 5E2QA 4FKXA 1O0PA 4FFNA 4HGYA 3VX4A 3UENA 4PXYA 3HI4A 2SHKA 3TE6A 2ECKA 5AM0A 4AS1A 5CABA 5ALXA 3PHHA 3BSFA 1W6UA 3S4YA 2XE6A 1C0UA 2YZNA 3JTOA 3S2ZA 3PEHA 4K6FA 5LBTA 1E8DA 5B30A 3ICCA 2X8WA 5CFOA 3TZCA 3K2IA 1VR6A 3QFSA 2VDJA 1U0BB 1XVLA 4FLEA 4WK3A 3DE4X 1UK8A 2WICA 1WBDA 3VZRA 2MT9A 3T6KA 2ZSAA 4LC0A 2OFPA 4RVDA 2BJ7A 2PKWA 3COVA 4DMCA 1ESMA 5L1JA 1VIAA 1M2KA 5NLLA 4GL2A 3I30X 4PRLA 3BB1A 2GPSA 3R5GA 2EYUA 2A0YA 4TMTA 4LPKA 4MIOA 2E7VA 5HJXA 1SVKA 1QYXA 2X0EA 2XA1A 3NY0A 4ES2A 4OX7A 2O2ZA 2A6PA 4M49A 4K86A 2BMFA 2XVXA 3D7SA 2KQUA 1G98A 2OGSA 3A13A 1SKUB 4J1QA 4PWWA 3HB0A 4BNGA 2E3JA 4YDDB 2A30A 4OSOA 3THSA 1T9TA 4N3NA 2OXCA 4V0SA 5FR1A 5A4MS 1PW7A 1VFJA 2CJWA 3VR6D 4MCAA 3DBVO 2DBQA 4E30A 1U11A 3LLCA 1QYWA 3KWJA 4WYWA 2G6TA 5BMVA 1ZR2A 2ZBUA 1X77A 4UVHA 1EXNA 1LFWA 1UEVA 1IKWA 3VAZA 3JQAD 5DHPA 2F8HA 3A04A 1JJAA 2HHXA 5DLFA 1RJ9B 3OV7A 3VPSA 2P9EA 5BRJA 4E4RA 1QH1B 1PJ7A 5DYIA 3B3AA 3V1MA 1NTOA 3ZGLA 1UJ6A 1SG9A 5B7WA 3OVSA 1SIBE 4JI2B 3AR8A 4PCQA 4II3A 4WLFA 3WMGA 3I92A 1XVVA 1KFJB 1YTLA 1HV8A 3EXCX 4DNFA 5C7OO 3SI8A 4RDCA 1E58A 5ICGA 4J2HA 3A7EA 4RMGA 3DAGA 2CBXA 4ZVNA 3T06B 1VYVA 2QI9F 4WU3A 3M6AA 3HSGA 1FYVA 1LGYA 5KWSA 3PVXA 3O94A 1RM5A 2PX6A 2W2PP 3RBZA 5FJJA 3G8BA 5AI8A 3USZA 1LDMA 5M2RA 1FXUA 3PFCA 2MIIA 2NO1A 3BJYA 3F74A 2CJXB 4C05A 3HSSA 1SBNE 1WMFA 4IJ6A 4CWBA 1JVSA 2QR3A 1BQMA 3U4AA 4B6RA 1YJTA 3NNSA 4EKDA 3AI2A 4FDMA 4RPCA 3C6ZA 2CNLA 4UOQA 3BWBA 3ZDQA 4DCUA 2FX5A 3RVPA 4FJ1A 3KSBC 1OU4A 4AQYF 4P82A 2QG9A 1J8VA 3KQHA 5L3RA 1SUQB 5KSPA 1PJAA 4BVFA 2AQKA 2FUNB 2Y2UA 2R2AA 4NXNJ 3HKWA 2JG3A 1BS2A 1Q16A 2JATA 3C3DA 4AF8A 4Y9RA 3GJTA 1QAOA 2CEKA 4W5WA 4Y6QA 3O4VA 3WL8A 1L5QA 4OJQA 2CMGA 4LY3A 1TQHA 5FWXB 4JGBA 2PEHA 1V1RB 4JK3A 2UZ4A 2NYHA 1NL3A 3I6QA 3SICE 2Q1SA 2DPGA 2VOPA 3ICOA 3ZLVA 4RHXA 3HYNA 4AXBA 1CZOA 4UMFA 2ZIWB 2F2TA 3BKXA 1LXJA 3RFFA 4P4NA 1O2DA 2QMOA 2XYVA 1SIZA 1A4RA 1DMRA 1PUXA 1GPMA 2YJ3A 3UCZP 3TI7A 4P92A 5FBHA 1ZINA 2PPLA 2YNIB 2GW8A 2D7SA 1VC0A 2WA1A 3JVEA 2NACA 4CTMA 4BNKA 4X84A 1FFWA 3TTXA 1VIVA 1KI9A 2MYPA 2ETVA 1Z17A 5IZCC 4GYYA 1PR9A 3LCCA 3D3QA 1E9EA 1SQGA 1EFAA 1B15A 2A2DA 3IUJA 1N92A 1FUEA 3UGTA 2BLLA 4QBHA 3LPEA 3VZSA 4DR7J 1RIFA 4LNUB 1L1RA 3QKIA 1YB6A 4U5XA 4M5GA 4OTZA 3I4CA 2EWMA 2IVFB 4TXNA 2V4MA 1Q16B 1WD7A 1MHTA 3TRKA 3BD8A 3K7EA 1OXKB 3O03A 1GKLA 1GHTA 1CJUC 3D7KA 4CF3A 3O5AA 3U3MA 5IABA 4LCBA 3ZC4A 2CFOA 3HJFA 2DHRA 1JHDA 1H1LA 1FZQA 3N2GA 2HRZA 1NOIA 2XSFA 1LBEA 4G8CA 4IMJB 2WF8A 3UB3A 3W6ZA 1UFOA 1T0IA 2VH1A 2BFPA 4C21A 4MKRA 4CMAA 4ECQA 3BKTA 1K8ZB 4OX9Y 4FEYA 4FYHA 4A8HA 2LU1A 1JJVA 4ICLB 1GG9A 1BDBA 1KFEB 1SUIA 1XCLA 3D3JA 5GQSA 4C7MA 4LCJA 4HK4A 2O48X 1A9QA 4QGFA 1AQNA 1KU0A 2J76E 2V8HA 3OTIA 4PYAA 2O5CA 2O3DA 2DUWA 2NZJA 1QIJA 3SHFA 2QMZA 4F67A 3ZHUA 1U8XX 1E0DA 3MD9A 2X1MA 2RI6A 1NI3A 3G9QA 4EPWA 5TEVA 3MT7A 3EIFA 2Q2VA 1TQ6A 3QE9Y 2I22A 4ZVUA 1YZTA 4V0ME 3KPVA 3RS5A 2G1DA 4LPSA 4F3CA 4WLVA 2MKHA 3B6KA 4DMHA 2B94A 1KJNA 2FPLA 2Q4EA 2XQJA 3AOGA 3MR7A 2IEAA 4L22A 3B7WA 1YZVA 4E5SA 2C04A 4M9UA 2CZVC 2OH2A 1KMNA 1OHHA 3I1FA 4JI6F 5FPHA 1SHKA 1TFRA 3ZV5A 2TS1A 3BIWA 3E8OA 1W85B 1N34B 2YY3A 3W62A 3BV8A 3BPSP 4CNQA 8OHMA 3GCXP 3QY0A 2XHZA 4QPDA 1MB4A 1LCIA 3NOGA 1SB9A 4DLVA 3BKUA 1I33A 2O06A 2HA5A 2ZPUA 2GXAA 1YUNA 3AL0C 2BVNA 1JLLB 2FPMA 5FTLA 3HPRA 2OWDA 5KFNA 2J45A 3X44A 3DS8A 1Q1BA 1YR6A 3V8BA 4IYQA 3L18A 3NM6B 1I3MA 1F1JA 3KE9A 3K16A 5KI6A 2AMVA 5BOVA 1R12A 4URUR 4CFZA 3HVJA 2CZGA 2CT8A 4NXNB 2O50A 3TPZA 1L8OA 4AWBA 2IU0A 1Y0HA 5CPBA 1FK8A 1M1NA 3Q2TC 2AW0A 3A32A 3ZKWB 2HU8A 1YB2A 2QL5B 3ZU4A 3HTXA 2Q4RA 4MUKA 2OFHX 4F2WA 3GMSA 3E7PA 5L4NA 4OA8A 4USJC 4IOCQ 1ICIA 1QC5B 1AZWA 3D81A 4JXJA 1H3FA 5AW4A 2FRXA 3CW2A 3I09A 4RESA 3IL2A 2UU9F 1LC0A 2E89A 5ELLA 4QEZA 4NBUA 3GILA 4FUQA 3KOYA 3OLVA 4LV6A 4EH1A 2ZEJA 3U40A 5FPTA 1ZRMA 2FP4A 2CFRA 3TRJA 5D3GA 4B3OB 1PKEA 2HNYB 2HQFA 4KHZA 3TXXA 3ECCA 3CLSD 2R4FA 3LUFA 1XQXA 3LO8A 4NK4A 2Z9CA 2JCYA 3U2QA 1Z16A 1QIFA 5HA5A 2G77B 1QYVA 3CB2A 3LTEA 4O2LA 4ZOEA 3M8RA 5H82A 1KS9A 4F8YA 1I4TD 2WAOA 3H1FA 4B34A 5DYWA 4AJLA 3CLTD 3U7EB 2CKWA 1P3JA 5BWCA 5M5BA 2XKAA 3DM9B 1M2VA 3AQIA 1UXGA 1E1DA 5GM2A 2NWQA 5KTMA 4BO9A 1Y4SA 1HE3A 2DQ4A 1HNWF 4YRCA 4A8PA 3QRRA 3SZ3A 2QLMA 1HDIA 3UV3A 3CUNA 3M33A 3M2RA 4WEQA 3I61A 1Q0SA 2L9DA 4D0GA 2DCMA 4CIVA 3CH4B 3NEYA 3ROQA 3ZHSA 2Q28A 4WK6A 5FPSA 2QQ5A 4OYOA 1JECA 2GS9A 1UOQA 1GU1A 1BQNA 1XNGA 1N57A 3I83A 1I1OA 5TE9A 2Q3JA 1IONA 2O66A 2Y05A 4OL0A 4AFNA 2PWAA 4NFYA 3K1YA 3T7AA 2F40A 1SQ5A 1OO0B 2L42A 1L7XA 1UZLA 1N5KA 2C59A 2WT9A 2IK8A 2PWBA 4PG7A 2EATA 4LOIA 1JMVA 4HNSA 3TNLA 5C5CA 3W1EA 2MWMA 3L6BA 4PSCA 1ZGJA 1KKLA 2JEIA 1A9XB 5JROA 4DQSA 2BJDA 3I37X 3H13A 1VDZA 3G8YA 4PTYA 5BXQC 3CF5Q 1ECFA 1RA6A 1QIMA 5IF3A 2FOLA 1WZ2A 3KLHB 2CW5A 2ZRPA 1C29B 5HQTA 3MGKA 3X1JA 1XQ9A 3UD3P 3ONFA 3THYB 2OCDA 1L4UA 1PLKA 2IPOA 1P2TA 1JBEA 3IP8A 3DVRX 2AVNA 5JCXA 1M2WA 1VJRA 3VR5A 1YQDA 4DGSA 3AUJB 4Q18A 2Z56A 4QARA 4MQEB 3W06A 2HKIA 1AB6A 4CKBB 1N2ZA 1EP1B 5BMVF 3OEEA 5G0WA 1TMGE 3X2EA 1GEHA 1TPZA 3LPCA 3A1DA 1FYWA 3ADCA 1Y89A 4FYYA 4KOAA 2MSWA 2V54A 3NNDA 1WD6A 1U9JA 5MDHA 2J5QA 4KDRA 4A0GA 1QDUB 1C4XA 1Z6PA 3IKMB 2JANA 1VPWA 4I5GA 2ZM6J 2AOWA 2WSBA 2V55B 1ZAVA 3CZ9A 3L0DA 3UUFA 1M2VB 1SVMA 1JQKA 4GO1A 3PC7A 4CL2A 4UBKA 3X1MA 3AOBA 3N6NA 4GQAA 2VNKA 1BMTA 3OOHA 3KJNA 4ZCPA 2ZRLA 4FX5A 3GRYA 4RZ2A 4LIWA 1ORDA 5TX7A 1BCSA 5BYSA 2GVDB 1LV7A 4YRZA 4MA0A 3FPBA 1DWOA 4KGZB 3V5RA 3AR7A 1NG9A 2JFHA 3K09C 4RW8A 1B00A 1G16A 1AK2A 3L79A 1N5IA 1VQKS 2VUHB 2DD8S 4MV9A 3M2RB 3R20A 1H65A 3DHNA 2CMFA 5F3RA 3O4FA 4Q8EA 2HIMA 1DJPA 2BKOA 2YV4A 2A9OA 3LP1B 3ECAA 1XYYA 5C42A 4S0ZA 3IDOA 2RI0A 1U3DA 1FX0A 3FNQA 4TKVA 2K1RA 1PDWA 2ARKA 2PGXA 1KVKA 1NAQA 3VAKA 2WUFA 3CRVA 2WM9B 5EHHA 4G0NA 2R7QA 4DA0A 3PQ4A 5CNMA 4C7OA 2X3GA 1FRFS 1LB1B 3F9CA 4Y1GA 2Y1LB 3D28A 3U7IA 4DIUA 2Z1DA 5J2UF 5KFBA 2CL6X 3CM0A 1RIIA 3EIUA 2YXDA 4CF6A 1RLJA 3JYHA 5KFYA 1OE0A 1RS0A 2LYVA 3DL2A 5JS8A 3KJVB 4A73A 4B3FX 5JZOA 1AROP 1U45A 3ZCTA 5EWLA 4DTIA 4RKYA 4IFVB 4RKEA 4H18A 1KEVA 4Q3CA 4ZMSA 1VCIA 3T9EA 1XR3A 4KWEA 4NHOA 2XMTA 4PZUA 5DM0A 5HS4A 5KX5F 1ISPA 2H7YA 1B8NA 2QLXA 2Q9BA 1ZBDA 1S2GA 3RW6A 2UU9B 1W8IA 3AYZB 4IEEA 3TXAA 4IYJA 1VZ2A 3CCMS 2R6ZA 5JUWA 1JZSA 4URZR 1AMUA 4KQ9A 3CH5A 3REQB 3B36A 1Q7EA 4CLKA 4TX1A 4DLWA 2W2TA 4JP5A 1PQPA 4QOFA 1QNLA 3IBFB 3WQPA 3R0XA 3GLJA 4JQCA 3PRDA 4OBEA 5DMHA 1B70B 4DCTA 1SJ4P 4XX0A 4A03A 1YJ5A 4NEQA 4ND5A 4ZI5A 4NJOA 5J2PB 1VLZA 5DOZA 2G9NA 5C9ZA 2UYCA 2QL9B 5FOQA 3H1PA 1NVVR 3K5WA 4ZLNA 5TMPA 4P3OA 1NW3A 1WZUA 2CFCA 3M7VA 3OY2A 4ND3A 2TMKA 1N5TA 1DZ3A 4LF6F 5A5VA 4V0KA 1S4QA 2ZJ1A 4O5OA 1GUBA 1UBSB 2QN8A 3G79A 1O95C 3VAJA 4C0SA 3G59A 2E5HA 2PMZD 3FTNA 3TM5A 1C1DB 1V0JA 1Z2ZA 1JR3D 4GXTA 2I6QA 1T1SA 1NURA 4ZAYA 1A6LA 3A6GA 3NUZA 2PO4A 1LPBB 1D2MA 1EFVB 2R8ZA 2ROQA 4LVOA 4GH5A 3O8LA 3M05A 3EXEB 2HGNA 1EGVB 5B2FA 3ITHB 3N87A 1WSVA 2EG9A 3FSJX 2CMKA 2CLOB 3II6X 1FRQA 1SBQA 2OPBA 1CUIA 2Y76A 4J2OA 5JSZB 3V4VB 3IPXA 1FQWA 2CIMA 1L7VC 2XWQA 4ECVA 2QTZA 5HF8A 1WUJS 4UFNA 3WHKA 4NCJA 3L0BA 5GMEA 2H5EA 4FT4A 3ULHA 4HS9A 2Y4OA 4Z7OB 1QJHA 3RUDA 3W4IA 2L82A 4ACAA 1NJGA 1ZOPA 3E6AA 3RC3A 4A8YA 2EIXA 4JI6J 3TX0A 3AHFA 5AVYA 1GQRA 1TV6B 3KYJB 4XFDA 4YB1P 3UPFA 1B6SA 1UADA 5CDFE 2XBLA 2VPWB 2W2QP 3OAAD 2VJLA 1EM8A 4B9UA 1VCTA 3L6UA 2PSZA 3A3KA 3L0YA 2DEJA 4DR6B 3FOCA 3PXBA 4IFVA 4ARSA 2AH5A 1SBHA 3EICA 1Y5IB 3WJ7A 3AIKA 5F35A 3E8XA 3EGXB 4NU0A 3AV0B 4J4TA 1U4OA 1FFAA 1S96A 3ZE9A 3TNDA 3DBLA 1FFBA 1NUTA 1UK9A 3GJTB 3KHKA 2QXTA 3MMZA 4P98A 4HR7A 3B1ZA 1XHLA 4MUHA 4KIFA 4Q48A 3LHKA 2I6FA 3E3NA 3IT0A 1SB6A 3IFEA 4R5HA 5GJBA 4ZGWA 2R9LA 5EX0A 3SNHA 5A5EA 4UZBA 4LDPA 4EFNA 2I7XA 2H0QA 3ECSA 3SSOA 4KWTA 4BNZA 3TJAA 3EA0A 5FADA 1S6PB 4NULA 3WL6A 1EINA 9ATCA 5DK4A 4U96A 4R83A 4EUNA 4ZO9A 5AW8A 3N79A 2W2XA 2AXPA 2UVPA 3WMWA 1CJUB 1H0RA 3PUHA 1GMUA 3BGDA 2V45A 2LXFA 1NQWA 2JX2A 3HZOA 2FVRA 4PLGA 1XCJA 4PCAA 1OY9A 1KTVA 3TINA 4C0AC 3MERA 1WXHA 4LDAA 1A8SA 3P0RA 4C3UA 2RS8A 2HIAA 1QTIA 5LQRA 3C5EA 2IS4A 3EVAA 3PXXA 2X15A 5EKTA 1VGVA 1SG6A 4D80A 4TLEA 4F4KA 4CLRA 3F6YA 1EJ6A 5D7NA 2FA9A 1JT2A 4FQ8A 4E3WA 4YRSA 3ZKWA 1GKIA 5JMPA 5BN4B 2RSQA 4DARA 2FR8C 2DG2A 1RLUA 1YZQA 3KKZA 3ROFA 2A2CA 1T0TV 2D8MA 4KNVA 4NATA 1KDVA 1SOAA 4DIMA 3F4LA 2E18A 2XO6A 4AFFA 1SUCA 4ZVTB 3F6SA 1SJQA 3EDQA 2HWHA 4IIJF 2FSFA 1KDOA 2H52A 4A0FA 3PQ8A 4HG2A 2I5JA 2B7BA 2WTMA 1A71A 1CUVA 4RY8A 3RNOA 3VAGA 4WOJA 3DB1A 1Z5NA 3CUKA 1I7NA 2V03A 2ILTA 4D3YA 4UTVA 3ZTOA 3CLHA 1WDLA 4BFWA 4JB2A 2RHDA 1N56A 4F36A 2ILVA 2ESRA 1DUVG 4ZXPA 2G7MC 4XYBA 1VK8A 1YBTA 4JB3A 1KVRA 3AHEA 3W9HA 3WMXA 3VNQA 1FMJA 1HK7A 1UC4B 1LF5A 2VJOA 3B54A 2CNKA 4R2XA 1M2FA 2GNOA 2W6CX 2KJQA 3DI6B 4V0OA 1BCRB 3ZJUA 1GL6A 1JDVA 5DZ7A 4P6VF 3I62A 5JI2E 3DBRA 3HVIA 1TZCA 5F5NA 2JJ8A 4NBWA 2EC5A 4KFUA 2G7ZA 3FDIA 3E8SA 3UN1A 1CUFA 3P19A 4P7FA 3JWHA 4OXQA 1OWMA 3HKZD 3K1JA 4PCUA 3EXYA 4AWAA 1TD1A 2PUVA 1NMZA 1PIWA 4WV3A 4HNAB 4K6MA 4ENVA 1TB4A 4DQUA 1IJBA 3IVRA 2X0JA 2QLJB 1UP1A 1WG4A 2CCJA 3G2JA 5PGMA 5H80A 5K0NA 4J9MA 1F0PA 4RLSA 1GFSA 2C8KA 4MFBA 5IKPA 3BDVA 1VZ3A 5IRCD 2DO0A 1MD9A 1O57A 1XPRA 3JAMU 5H7XA 3H9BA 1MVOA 4B8YA 3H9CA 5D0HA 1VXRA 4O08A 3SVTA 4X7BA 1N2EA 1X1EA 1XDSA 5I8WA 1LSJA 2B51A 1EZZA 2GOYA 1YJWS 1QX4A 1VQSA 5KC9A 5JBQA 2ZTLA 2ORIA 2VPXB 2BKUA 4MULA 2PQ0A 2C4HA 3REQA 5DTJA 4PF1A 3L0CA 2BQ3A 3RKSA 3QLUC 3HSZA 5ERYA 2D3O1 4RPGA 1RPNA 1ZX1A 1FFGA 3E4CA 4OB8A 3T3EA 2OHOA 1S89A 2E37A 5I3CA 5IAKA 5TPZA 4YY3B 1FL9A 4L3WA 4J0DA 4IKEA 2XGSA 1FRVA 4P1ZA 3T9BA 4P36A 4ED2A 2PJDA 4C2TA 1Y1SA 1PG0A 4ZVSA 3LKZA 1ZH4A 3WR5A 4O5AA 4GBJA 5IUJC 5FI0B 2ADFA 2AGVA 4BQQA 3IR7B 3QLTA 4O3RA 3AY7A 1YDWA 3LYAA 5FLKA 5K9FA 3C7CB 4F12A 1E4VA 3C3WA 2R4QA 4KLZA 3WLPA 1H23A 2WC1A 2JFPA 3RWBA 4WBNA 2ON6A 3VFDA 4XDZA 1LX7A 2JHPA 3G2NA 1HMPA 4OL8A 4RTOA 3JD2A 1KY2A 4FZVA 5HW0A 3ENQA 4OLAA 3RYHA 3PNBA 1MT0A 2J3LA 4PNEA 2V7BA 1UZMA 2LRHA 4JXKA 5EUQB 2O5DA 3VYTB 1XFDA 3AERA 1Y4DE 3R09A 4JI0B 4FILA 4EUHA 4YV7A 4LZAA 2RAVA 2ODBA 4KP7A 4MUGA 3OT4A 3GB9A 4R9RA 1T34A 2X0KA 1OROA 1BCSB 3MC1A 1RLDA 5I47A 4J0CA 3PP8A 5HR5A 2RB5A 3HCEA 3I0RB 1E66A 2MINA 2Q3CA 1IBKF 1B1AA 3A1TA 3DVAA 5GADI 4GVXA 2CHQA 5F21A 1A0OA 3MR5A 2F62A 3UWPA 4YDXA 1TI7A 2NSDA 1M5HA 3T7EA 1EIYB 3CJ8A 3FSXA 2R2RA 3CNBA 2VTKA 2PFKA 4AZWA 3THTA 2GZHA 3D4PA 1QHHB 3RAMA 1IXYA 1NLYA 3IQWA 1NJ1A 4S1PA 1XQYA 4R8MA 1TGVA 1TE2A 3TKYA 3ZY3A 1QIHA 5BNFA 3PRBA 4F2HA 3GPAA 2HQGA 1C9KA 2NO0A 4PGFA 3BK2A 3QXXA 3CRQA 4OBXA 3BXOA 2IZ0A 2BFDB 2O2XA 5KNCH 4M5JA 1T4MA 2QVXX 4B3TB 2B6AB 2GZOA 4U02A 2V68A 1S4FA 4ZMMA 5J63A 1UMCA 1RI1A 3FRYA