1YKFA

Nadp-dependent alcohol dehydrogenase from thermoanaerobium brockii
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
352
structure length
352
Chain Sequence
MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADP-DEPENDENT ALCOHOL DEHYDROGENASE
publication title NADP-dependent bacterial alcohol dehydrogenases: crystal structure, cofactor-binding and cofactor specificity of the ADHs of Clostridium beijerinckii and Thermoanaerobacter brockii.
pubmed doi rcsb
source organism Thermoanaerobacter brockii
molecule tags Oxidoreductase
total genus 112
structure length 352
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 1996-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ykfA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1ykfA01
2FR8A 3JQ9C 3OA2A 3DO5A 1HEUA 2Y99A 3HG7A 1P9LA 5K9ZA 1XCBA 2O3UA 4BO7A 4QX6A 4K1LA 2W2LA 1T26A 4CMGA 1SCUA 3ZZNA 2ZTLA 3JQFA 2PWZA 3GFGA 1R16A 3A06A 1H0KA 2B0JA 4GI2A 2VYVA 3ANLA 5JFOA 4JIGA 4CLRA 4DL9A 1E0DA 1P33A 1TI7A 5CHEA 4PLHA 4PLGA 3RBZA 4HNGA 4BV9A 4RF4A 1PSDA 1ISGA 4Z3DA 4A03A 3RBVA 3VPXA 2DUWA 1PJ3A 2GN6A 4KQWA 1K5HA 4TROA 1GUFA 4BKUA 3PIIA 1BXGA 2C0CA 4EEZA 2J3KA 3ZH2A 4E3ZA 4KUGA 2I5PO 3A4VA 1K2WA 5A9TA 3BTOA 2VYNA 2XAAA 3EUWA 2VUUA 1T4DA 3WMWA 3ZU4A 3CXRA 1EK6A 3KV3O 1QV7A 4XGNA 4R1UA 2HAEA 1LSJA 4LRSB 4BKOA 1B0AA 4FBGA 1B15A 4Y8VA 2J8ZA 2HSDA 5HWSA 2BRUA 1LDEA 3PYXA 3QLJA 2WJPA 3F4LA 4AL4A 2R2GA 4CMJA 1V3VA 8ADHA 1JKJA 1O89A 3JQCA 1WWKA 4CR8A 3PRJA 2GN9A 3K92A 2CF6A 4D3FA 2B36A 3PQEA 4CM4A 4MKZA 3GG9A 4BO5A 3HQ4O 3HDQA 4GLOA 1GQ2A 4PVDA 3OM9A 3RUDA 5JY1A 1CF2O 3JQAB 1LTHR 4E4YA 1NFRA 1ADGA 1HE4A 4DVJA 2CVQA 2UUOA 3GLQA 4L4XA 4CMCA 4E30A 1P1KA 3U9LA 3WR5A 1O9BA 2C82A 2VRCD 3F46A 4CM3A 4J0EA 3C85A 4OOFA 2QW8A 1P31A 4DWVA 2V7PA 5ICMA 2QZZA 3D3WA 3OJEA 4DPKA 1NVMB 2UAGA 5B4VA 1VJ1A 3QWAA 3WS7A 1HSOA 5BSHA 3WIEA 4MJLA 1QYCA 5DT9A 4DGSA 2CVZA 2IXAA 3BMOB 3RVDA 2J5RA 1A71A 5BSGA 5JC1A 1E7MA 1YWGO 2NVBA 1CJCA 1MC5A 4IGEA 5IAAA 1DRUA 2TMGA 3MOIA 2AA3A 4KOAA 2DTDA 4XRRA 5CDYA 2FMUA 1GD1O 3NTQA 4ZQGA 4R3NA 3L9XA 1LC3A 3D3EA 2CFCA 2GF2A 4YQYA 4XGIA 1XLTA 1NVTA 2JJYA 5L45A 2H6EA 3EW7A 3ONDA 4XRGA 1A7AA 4XYMA 4IIUA 2UYYA 3GEGA 5BNTA 3ZW9A 3NEPX 1PIWA 3OHSX 2AG8A 3ZHYA 3K2BA 5K1SA 2NU6A 4CV1A 3JD0A 3TFQA 4IQGA 4DYVA 1Q7BA 1UAGA 3RUAA 3FSRA 3PGXA 1QYWA 3G79A 3X2EA 1R0LA 1QYVA 2W90A 5I7VA 1NFFA 4GVXA 2DFVA 2RBEA 2XF8A 4Z0HO 3UFXA 4CV0A 5CFZA 2PFGA 5I9LA 2WDZA 3QW2A 2O7SA 2WMDA 2BFPA 3T4XA 1DDOA 4DIBA 2C2XA 3Q0EA 1FMCA 1EVIA 4XCVA 4AJKA 1D1SA 1LQTA 3DC2A 1GQYA 1JAXA 2VWQA 4HP8A 2AQ8A 3DWFA 4FCCA 3W8FA 4L0QA 4TRJA 5BNIA 3QA9A 1ZK1A 1KBZA 4WK6A 1EE2A 3WFIA 4U6QA 2IZZA 4J1SA 4WLOA 3GNQA 1KVRA 3EHEA 1DAOA 2GYYA 1ZK2A 3MOGA 3AY7A 1ZSYA 1NAIA 4PG7A 4CLOA 1IL0A 5A02A 1GAEO 4OSOA 2EJVA 3TSCA 4PLCA 4A10A 2AE2A 4YR9A 1MV8A 3WJ7A 1A5ZA 3IC5A 5I8WA 3I9JA 3O8QB 2O2SA 4FS3A 1PZFA 4CQMA 4M86A 4N18A 5F5NA 3X2FA 3DEYX 4E2ZA 2EXXA 2C59A 1KETA 2A94A 5EESA 1B26A 5JAQA 5CPBA 4Q3AA 4BNNA 4XQEA 3H4VA 3RWBA 4RJTA 4KDEA 3MJCA 3ZWNA 4CM9A 2H1SA 3BMQA 2BMAA 3GZ4A 3NDIA 3F9IA 3PHLA 5JYDA 2Q4EA 1Y9EA 1PL6A 4JBHA 1C0KA 1HT0A 1Y6JA 1ZVMA 4RCVA 4FFRA 4ND1A 1PZEA 3OQ1A 3A14A 5G0VA 2ZYAA 2Y1CA 2D4AA 1ZK3A 2HRZA 3PWKA 4RPJA 3NGXA 1RKXA 3AM4A 3WQRA 3NDJA 2HMSA 5L51A 3W6UA 3H9JA 4FD3A 1GCOA 1Y8QA 1LLCA 1OOEA 4MVJG 5ITWA 1SNYA 3VKUA 2D1YA 1RM0A 1ISMA 3G1UA 4DA9A 5K6AA 1U3VA 5FFFA 1NQOA 1TLTA 1N9GA 2EW2A 3E48A 3FCOA 4J2OA 5JCJD 3SXPA 4NFYA 2O50A 3UUWA 4QFDA 1C0PA 4O0LA 2GR9A 4PLTA 3F4BA 4PFJA 3GRKA 3DBLB 2VHXA 2Y66A 2VHZA 1GYQA 3RD5A 4YVFA 5G2OA 2OMEA 4Q39A 4B4UA 3VPFA 2C5AA 1E1MA 1F12A 1YL7A 3FPCA 3PPIA 2IXBA 4II3A 1YQDA 1I5RA 3LZ6A 2NUAA 4ESOA 2AQHA 4IDGA 3U3XA 1C1DB 1ISFA 4BIIA 1A72A 2O23A 4H7PA 1LA2A 3IDSA 3OICA 3ON5A 3EZYA 4KDFA 5U1PA 4GH5A 5G4LA 1KVUA 5TJHA 3AW9A 3A1NA 3WX0A 3M2TA 9LDBA 4CMIB 1UAYA 2BI7A 1KOLA 3AOEA 3TZQA 3T4EA 3PLNA 1E3EA 3ROQA 5EERA 2Y67A 3AUTA 1ONOA 4YT2A 3WGGA 4DIOA 3H9GA 4YJGB 5MGBA 3ZWBA 3DBRB 2OP1A 2RH8A 3R3SA 3WTCA 2EG9A 3L4BC 4ZHSA 1TT7A 1Z75A 1LUAA 3EAGA 2WEKA 1R0SA 3BHMA 4JP2A 1KC1A 1U28A 5B12A 4PZCA 1XU9A 5JDCC 5DNAA 4XQ9A 1DFHA 2YV2A 4Q3DA 1NYTA 4GVLA 1GZ3A 5A5FA 2VWPA 4YB8A 1X14A 4H16A 4I9HA 1XR3A 1YB4A 3AI2A 4KTVE 4GLLA 2E48A 4OQYA 3GVIA 3OH8A 2EKQA 1P74A 1ZO8A 3BAZA 4R51A 3RUCA 4XA8A 3DOCA 3I4CA 4URFA 1PTJA 4J1TA 2CNBA 1ARZA 1JN0A 4AJJA 2HCTA 4NFSA 3MCVA 4TRMA 4E0BA 1I32A 5COBA 3EYWA 4AICA 4MVJI 3WOHA 3JQBC 1T25A 3UW3A 4IQ0A 4Y6RA 4J9UE 1N2SA 1PS8A 4MKRA 1F0YA 2GGSA 1HYEA 4K6CA 4RPGA 5T8KC 3DHNA 4YDRA 2YHUA 5I8ZA 2NWQA 5EIOA 2C5EA 1WDMA 2GN4A 5HBRA 1P1FA 2X0NA 2EJWA 2X5KO 3WIDA 3PQDA 1P45A 2Y1EA 4RLSA 3VPHA 2PGLA 1ZSVA 1G0NA 1ID1A 1AGNA 2HMTA 2QRLA 4QO7A 4CUJA 5IDYA 2B4TO 1H6BA 1U8XX 2QRKA 3DZBA 4NU5A 4NR0A 3GOHA 2O4CA 3JTMA 4CMAA 4DXHA 4IS2A 4MVJD 2BLLA 1UXJA 5CG1A 4L9RA 3UGKA 3Q2IA 3FNGA 3G1TA 3LDHA 4P4LA 4PG4A 4BNXA 4AJIA 1X13A 2GDZA 3T7CA 5ENVA 3ITDA 1LC0A 4OHUA 5KJ6A 4FQ8A 4Y67A 4L4SA 5G0UA 3L6OO 1EUDA 3JQAD 3SJ7A 4J7XA 4DQUA 2VZ8A 2ET6A 1BXKA 3FWZA 1CRWG 2W2KA 1FDWA 4UUMA 3A9WA 4Z9XA 1EE9A 3QWFA 5DBIA 4R69A 1UXIA 5K6AC 3UAGA 2HK8A 3H3FA 3TOZA 2CY0A 3COSA 2RH4A 4CM1A 3FI9A 1XHLA 2YZ7A 1Y8RA 1YBMA 2UUPA 1NQAO 5TGDA 3ZWYA 1ADFA 1C14A 4YQZA 3GR6A 3SX2A 5ER6A 3ZCXA 2ZQZA 3MJVA 4WOJA 1J49A 1YOVB 3WTBA 3JQ8A 1JDJA 1IE3A 5C37A 4HXYA 1I2ZA 2YQ4A 5BQFA 1EFKA 4OKIA 1GFSA 1F8GA 3DAFA 1ORRA 2JFGA 1DB3A 5CDSA 1XKQA 3PTZA 3W1VA 3IS3A 1HRDA 1U5AA 4BKPA 4R4JA 4CM6A 4EUHA 5GZ3A 2O2YA 5A5EA 2I3AA 4Q3EA 4TWRA 3OJ0A 3ONFA 3PHJA 4FFPA 1YL5A 2NVUA 3KSUA 5ILOA 2A9FA 3OETA 1BW9B 3GA0A 1A9ZA 4WUVA 5JE8A 5BNFA 3GVCA 4D45A 5B4TA 1EFLA 1H5QA 3V1TC 4ZGWA 2Y1FA 3RIHA 1Z73A 4DIFA 2W8ZA 1HYGA 2ZKLA 1HWYA 3FR7A 2B4RO 3JQEA 3JQ9A 5EPOA 7ADHA 3E8XA 3JCZA 1EK5A 2JD2A 4YJDA 5KKCA 3KUXA 4AJEA 1HF3A 5IF3A 3NYWA 1QYDA 1V35A 2Y05A 3UCXA 1Z74A 1PX0A 1MG0A 4YEDA 3HNPA 1ZEJA 2AE1A 2Y0CA 3U4HA 3ULKA 1E3LA 5TT1A 3WGYA 3WQSB 3ENKA 4B7UA 1HZJA 2B35A 1V8BA 1NNUA 1RM4A 5DDIP 5JY6A 3GDGA 4H15A 4O63O 3HADA 2B5VA 4LRTB 4ALKA 1VLLA 2G1UA 4DBZA 3LLVA 3E9NA 4BO9A 2CD9A 3Q11A 1P1IA 1LJ8A 2FPIA 2VHWA 2HRBA 4FOOA 3M1AA 1C1XA 1HDZA 3EY4A 3IAHA 3U4CA 1PJ2A 3RFTA 1GL3A 4RPHA 1NQ5A 3RUHA 1GY8A 4XWYA 4Q9NA 2HMWA 2OXIA 4II2A 5DOZA 1C3VA 5DP2A 1ISJA 1NAHA 1LDYA 4IDDA 4D0RA 1HE5A 1JWBB 1UDBA 4J49A 3ZU3A 2GLXA 3T7EA 1YJQA 2X5OA 1M67A 3R6DA 4EJ0A 2QRJA 4NQZA 1VJTA 3ADOA 3JD1A 3OBBA 1KEWA 2RHCA 3GEDA 4IJWA 4WNIA 4CUZA 1FJHA 2GZ1A 4IDFA 3AFMA 1Q0HA 4IJUA 3O9ZA 1JA9A 5IXYA 1CQIA 2E6UX 3S8MA 2CMDA 3KYBA 3RU9A 1QORA 4WASA 2ZTVA 2POQX 2BHLA 3GHHA 1MLDA 2SCUA 1XWFA 2DBRA 5KCZA 2Q46A 4YJHB 4OOEA 5LCXA 5CEEA 3KSDO 4Y6PA 3IQDB 4NK4A 1KEVA 2OBNA 5U9CA 2P2SA 3HFGA 2I67A 1YKFA 4R1TA 3RCBA 2BFOA 3STHA 4YCAA 3WYBA 2X0IA 4B8WA 3JV7A 5B1YA 5EMHA 3EZLA 2NU9A 1X0XA 3OP4A 4LW8A 1PWZA 2WYVA 3BIOA 3WGHA 4HV4A 5ICSA 3VVBA 4QTZA 5A9SB 1XSEA 4IZHA 5DZSA 5KVCA 3D0OA 3CZMA 1ISIA 3I9NA 2YDYA 3RAJA 5JO0A 3H9EO 1HTBA 5CDUA 3NJ8A 5KIAA 2C7VA 1P0CA 3RC2A 1ADCA 4RL6A 3W8DA 4ID9A 1B8UA 3P2YA 4XB1A 2J6IA 1WDLA 3JYNA 5AXDA 2PGDA 2I65A 4OKNA 3NKLA 3I6QA 1RJWA 3DFZA 4RVSA 1GADO 3B70A 3PK0A 5JMWA 2YV3A 4B4WA 1ENZA 4X54A 3FF4A 1LDMA 3ZHZA 4LSWA 4AJOA 4D79A 4GL4A 3UXYA 3GZNA 4ZQHA 1I2BA 4OO3A 5L53A 1BGVA 3WWYA 1NHGA 3TZ6A 4QUKA 3LT2A 3OA0A 3DMYA 3DZKA 1K0UA 3IL2A 2UVDA 4IDAA 3DQPA 1SC6A 4HNHA 5G0WA 1BTOA 1EQUA 1Q0LA 2Y1DA 4UVHA 5FYDA 2AEMA 1P44A 2HO5A 3ZNQA 5K0ZA 4YT5A 5BSEA 4NDNE 1LDBA 2AG5A 4LSMA 2EKPA 2X9NA 1LNQA 3WB9A 1B14A 3D5QA 2Y1GA 2JHGA 1O94A 4CQLB 3TN7A 3NRCA 1HKUA 1ZKMA 3H2SA 1DFIA 1EDOA 4W9NA 2OGUA 4ILKA 3D7LA 2X23A 4XYEA 2DPHA 1R12A 3H65A 3CEAA 4G81A 4EI2A 1PEDA 3I4FA 2Y68A 3RC1A 3TZCA 4AJPA 2JAPA 1I3LA 3HDHA 3DHYA 4XZ3A 1QV6A 3VKVA 1CETA 5KNLA 3I6IA 1NWCA 1E6WA 3RU7A 4PVCA 3JQAA 4IJVA 1NP3A 2PLAA 2VZ9A 4R1NA 4RORA 5JXWA 4UUPA 1K6XA 2ZTUA 4BKQA 1BW9A 2FR1A 3GUCA 3LK7A 4O59O 5AVOA 3NTOA 3VTFA 5JAMA 1EMDA 4GX1A 1DRWA 1EZ4A 1VI2A 1FXSA 2Q1WA 1EDZA 4GSLA 4GGPA 3U09A 4D3SA 5F1PA 3KM0A 1SOWA 2P4HX 1O6ZA 4MVJP 4W7HA 3VOSA 2O3JA 2R6JA 3F6YA 3UVEA 2YJZA 4IQ8A 4XDYA 1O0SA 2EEZA 2V6FA 1E7YA 1NPYA 4C4OA 1FDUA 3L0DA 3U4DA 2IYOA 3GN2A 1DEHA 3LU1A 1A4IA 4K6FA 7MDHA 4GQAA 5A04A 1ZEMA 4P4GA 3NX4A 4OJNA 1VKNA 2NU8A 4MVJF 2GZ3A 2PGJA 3EMKA 3JQ7B 3TNLA 5B4UA 1XGKA 3ASUA 1UXKA 1YDWA 3GQVA 1G0OA 4PLZA 2CSUA 1MUUA 1CWUA 3BZUA 4GWGA 3JYQA 3I83A 1BVRA 3GC6A 1W8DA 3WGTA 3WYCA 3LYLA 3IKVA 1PWXA 4JJFA 2EGHA 4E32A 4CL8A 3HN7A 2I66A 3BMNB 4YACA 1GUYA 3TJRA 2NTNA 1Z6ZA 3KRTA 1DFGA 4XD2A 2D5CA 5JAIA 3DB2A 2WYWA 4M49A 2Q2WA 3MJ4A 3UN1A 2W2LD 3HB4X 3PHIA 2WTBA 5U4QA 3CSDA 4A26A 1T2DA 2HKIA 2J5KA 3KTDA 4LISA 1T2FA 1JQBA 3CIFA 2VZ0A 2RAFA 2VHVA 1GYRA 5F3RA 3R0IA 4IZIA 2NU7A 4AJ4A 4CLDA 4NBRA 2JKVA 2AEJA 4GKVA 4JN6B 1U8FO 4E5YA 5L40A 3FN4A 2DT5A 1OAAA 5L4LA 4QEDA 3ZV5A 4AJ2A 3B1FA 2WD8A 3BTVA 1WPQA 3ZNOA 1K6JA 5KOIA 3DZFA 3GG2A 4WLNA 3HJAA 3DONA 3PZRA 2EV9A 1SBYA 1PS9A 3PXXA 1DJQA 3KVOA 5FI5A 1GEGA 2OZPA 4D42A 4DC0A 4DLAA 1CERA 5DOVA 2HMUA 4E5PA 3ZNPA 1Q7CA 1QMGA 4FSHA 4J6FA 5C3MA 3ZNNA 2ZB3A 5DCUA 4U7WA 1X0VA 2P9EA 5IDXA 3ST7A 1LRJA 4J16A 2J5QA 4I5EA 2PZJA 3GRPA 5JAZA 3N74A 4WECA 4XR9A 1I33A 2X0RA 2VRBA 3I1JA 3E6AA 4IPTA 3MZ0A 3JD3A 5DULA 4ALLA 4CMBA 3ETDA 3F1KA 4JGBA 4BNHA 4BHTA 4DMLA 2FOIA 2HK7A 3SLGA 1WLYA 3E5RA 2R00A 3QSGA 4ALMA 1JVBA 3FNFA 2P4QA 4XJSA 2DUUA 1AUPA 4YA6A 1U3TA 3H6KA 1PJBA 2FZEA 4UEOA 2QQ5A 5KJEA 1DIHA 4GX5A 3OJLA 3DFUA 1XU7A 1RWBA 1DHTA 5TQVA 3ZWVA 4M87A 3VPGA 2ILTA 4NBUA 2VT3A 2GD1O 2YHIA 4FGWA 5FEUA 4E6PA 3DXFA 4U6SA 1M2WA 3TZKA 3V5NA 4AJ1A 3DBLA 1QR6A 3GF4A 3PI7A 1NFQA 2GN8A 5BSFA 5JBIA 2XXJA 3DMTC 4QT0A 4ONEA 4WEOA 3ROPA 1YL6A 3OFSA 4DQVA 1YQGA 4BNGA 1KVSA 1GZ4A 2G76A 4Z0TA 4CV3A 4YAKA 4UVDA 1E3IA 1N92A 5FI3A 4XB2A 4ZVVA 1XEAA 1KVTA 1SMKA 1YONA 3OMLA 1A7KA 1E5QA 4JX8A 4AG3A 5EINA 4CM4B 4OGWA 1E3WA 1NM5A 1QLHA 1WW8A 3G0OA 2D8AA 2OBYA 4BS9A 2E82A 4D44A 2GASA 1P3DA 4PLWA 5H81A 2BKAA 3RASA 5A03A 5A9RA 2C20A 3GEMA 2NNLD 4CLXA 4DPLA 1LXCA 2PY6A 1J0XO 4R01A 2QYSA 1PL8A 2CZCA 5HRUA 1TT5A 2YHIB 1BWSA 1X7DA 2Q1UA 2NM0A 3RBXA 1EBUA 1BRMA 2YW9A 3AU9A 4RF3A 3PWSA 1JU9A 3DBRA 1QLJA 1AHHA 5CEJA 4BQPA 1N1EA 4XJTA 3PHGA 4IIVA 1VM6A 3DZGA 1ZMOA 2P68A 1R4NB 2WE8A 1Y7TA 2IEDA 3AOGA 3P5SA 4PG8A 5IDWA 4YAGA 2JFHA 3SC4A 4KUHA 4WCFA 4ALIA 2PR2A 1B8VA 1E3WB 1HSZA 2Q2QA 2P91A 3EDMA 5L7WA 3F3SA 4FJ0A 1DXYA 3JYPA 4MIOA 4QFCA 2ZTMA 3CMMA 1K89A 4DYDA 3QVOA 1CQJA 1I3KA 4ZQBA 5A3JA 2ZYDA 2G0TA 3QV1A 2GPTA 4UVGA 5HTOA 1KY5A 3M2PA 2PKQP 3I5MA 1YJ8A 4D0SA 4R1SA 3B1JA 1D7OA 1DC5A 4TSKA 4CODB 2FHSA 2PA3A 1T1RA 4J90A 4Z0PA 2WWRA 4MVJM 3IIEA 1Z7EA 2Z5LA 4CM8A 1PL7A 4BNVA 2PZKA 2RIRA 4AJLA 5EL0A 4OSPA 4E2WA 2Z95A 4IMRA 2PZMA 3IUSA 3WGZA 2X6TA 5TS3A 5TSDA 5IFLA 4YPOA 3U5TA 1YXMA 2H5LA 1ULUA 3OSUA 4WEQA 3W4KA 3LT0A 1IYZA 5L7TA 3GPDG 3K73O 3DHEA 3WICA 3CH6A 4BO4A 1S7CA 1IPEA 2QHXA 2X7HA 3PJGA 4A73A 4XX0A 1EVZA 5HS4A 2B37A 3PVZA 1PGJA 3QQPA 4BNYA 1E7WA 1UP7A 1Y5MA 3ZGYA 1KYQA 3FBTA 1LSOA 3RSHA 1J6UA 4B4OA 1HLPA 1WNTA 4J9VA 3KETA 4CM5A 1LSSA 1CEQA 4BGIA 3RI3A 4UUNA 4W9NC 3NAQA 3DOJA 1Z82A 3HB5X 4RZHA 2DLDA 1N5DA 4FJ2A 5KWEA 1DJNA 4E5KA 1E7QA 1KVQA 4J3FA 3IKTA 4UREA 5CDTA 3HFSA 3C1OA 5DF1A 3L6DA 5T67A 2AMFA 2X8LA 5A9SA 5AYVA 1JVSA 2EHDA 2WD7B 1NQTA 5CAEA 3OIFA 1HDCA 3BMQB 3D4PA 3E18A 3E5MA 4HX5A 1Q1NA 2GO1A 3GPIA 4YXFA 1U3WA 5AOVA 4Z9FA 5ENDA 3EGOA 4YT8A 1E6UA 4GBJA 4M89A 1ZH8A 3OIDA 3AM5A 3IMFA 5THQA 5TC4A 1U2GA 4Y6SA 3K31A 4N5NA 3WDSA 1KY4A 3MJSA 2NADA 3CUKA 3U0BA 3INTA 1NR7A 1I3NA 1HDRA 2NQTA 1UDAA 3HUDA 3JSAA 4MPDA 5KJCA 3EC7A 1NBOA 4BO2A 3Q1LA 3IJPA 6LDHA 1YOVA 4U8GA 3VAZA 2VTEA 4C7KA 5I9MA 4ZA2A 3E1KA 1YO6A 3QVTA 4N5MA 4YAJA 3JQDA 5T57A 4B79A 1NWHA 2J3IA 1ENYA 5ADHA 4PLPA 4D46A 3QWBA 1TVEA 2QX7A 2WD7A 2CDCA 4H3VA 1V3TA 4UAGA 1Q2XA 1VKOA 2F1KA 4PLVA 4YJFB 1ZSNA 4NIMA 3OEWA 1RM3A 1Y5RA 3VDRA 1N9GB 2PNFA 2EKLA 3PWZA 3H5AA 4J4HA 1PZHA 2VRCA 2Q99A 4WLFA 1MA0A 3BMCB 4BNUA 2V65A 1B7GO 3PFFA 3VDQA 1UXGA 5TRTA 4AVYA 1DOHA 3B1KA 1TXGA 3ZWMA 4D7AA 4YT4A 3ROMA 2NTJA 1C1DA 1LQUA 3GVHA 3KYCA 5HA5A 3DZHA 3CINA 4D3DA 1SB8A 1L7DA 3WNVA 3JYOA 2AW5A 3GNSA 1B2LA 3KEOA 4JROA 5IXSA 5B37A 4O6VA 1H2HA 3FD8A 2VCYA 2ZB4A 1LDNA 1T2EA 5JLAA 2BGKA 4JJIA 3AM3A 1QXSA 4P8RA 1AE1A 4RO0A 4RF5A 4LK3A 1R0KA 1PS0A 4W99A 1H6CA 2X4GA 1E1LA 3GGPA 3K5PA 3PYLA 1A4UA 1M66A 3OIGA 4BNMA 3G3EA 3W6ZA 1UDCA 3S2GA 2OP0A 1R66A 1V0JA 2DAPA 2VUSA 5KJ1A 5T6BA 3C3XA 4BGEA 4S3MA 1HXHA 4XDZA 3A28A 4OXYA 4QO8A 4GWKA 3HDJA 5GZ6A 1RPNA 1IOLA 4E12A 4NK5A 4XYLA 2ZYGA 5JCJA 4OIMA 2UV8A 4HFJA 1NHWA 5JW6A 1ZJZA 3I9MA 4TVOA 4ND4A 4PCVA 2VT2A 4BO0A 3DBHA 4BMSA 3K2EA 1UR5A 3VPSA 2A92A 4L8VA 4RDIA 1IZ9A 1I01A 1K3TA 5L4NA 3WG9A 4EZBA 2D0IA 2VQ3A 3Q9NA 4FC6A 3QE3A 4NI5A 1I8TA 2JD0A 1EUCA 3GDFA 5L9AA 3OQBA 1R4NA 3E03A 4WPGA 2Q45A 3PFWO 2H63A 1XQ1A 1H6AA 3G49A 4RF2A 2B69A 3PQFA 4GX2A 3OJFA 3CE6A 2FN7A 1BG6A 1U4OA 3I23A 4IXTA 1QG6A 4KWHA 4JXKA 2ZATA 1Q0QA 2RCYA 4KQXA 3VZSA 2EGGA 1N7GA 5ES3A 1GUZA 2G5CA 3LLSA 4B7CA 4IGFA 2QYTA 3V1UA 4GKBA 2VTDA 2BF7A 3PEFA 4NH4A 1DC6A 2IZ0A 3LC2O 3TF5A 3DBHB 1NX6A 5FWNA 1YE3A 3QRWA 1WDKA 3BA1A 3PP8A 4QQRA 3ORFA 5C7LO 3WBFA 3DTTA 4CL3A 1ZJYA 1PGNA 3NTRA 1T24A 3S2IA 2ZIZA 3C8MA 2Q1SA 1GU7A 2JD1A 4CR7A 3DAPA 4U0KA 2FY8A 4YJHA 5GY7A 1AHIA 1JWAB 5EJ2A 3FR8A 3LSYA 4A7PA 1O5IA 1BVUA 3SC6A 5KJFA 2NTVA 3LQFA 1Z7BA 1GPDG 2PZLA 1JW9B 4NU6A 1U4SA 4RLHA 2E37A 4FN4A 1ISHA 2F00A 4TZKA 4FW8A 1TEHA 4XIJA 4NG5A 3SVTA 4ZRNA 2XXBA 4B3JA 1ZK4A 1ULSA 3H3JA 3K30A 6ADHA 2QG4A 3UH1A 3DBVO 1PQUA 4E21A 2DBVO 3L4SO 3PZBA 2Q2VA 3GGGA 5I7SA 3KLPX 4UEJA 1MP0A 1A27A 3Q2KA 3FHLA 4FFMA 1IHXA 3CMCO 1ZUD1 2IDZA 4IMPA 1I30A 1SB9A 3R3JA 5TT0A 4HUJA 3LVFO 2E49A 1EBFA 1DSSG 3WSVA 4B4VA 1Y8QB 4J7UA 1DAPA 1M75A 3ZN2A 5J23A 4IS3A 4J1NA 2O3QA 3JQ8B 1DPGA 2JCYA 3GZNB 4CMKA 4DPMA 4FFOA 1BSVA 1C0LA 1WXDA 4DC1A 2EW8A 5A05A 1Y1PA 1I2CA 4W4TA 3ZWOA 3C1TA 3GUYA 2ZB8A 1SZJG 3ZWXA 1PJSA 3DR3A 1SOVA 3WBBA 4CR6A 2FWMX 2VHYA 1AN9A 1DLJA 3M6IA 2C29D 3C24A 4CV2A 3TZHA 4K28A 4I5FA 2Y0DA 3WQQA 3JYLA 1GV0A 4Z9YA 3LC7O 3QIVA 4GMGA 1P1RA 3TRIA 3VZPA 1WZEA 4EUFA 2EP7A 1BMDA 4MKXA 4XKJA 4TQGA 1M6HA 1PQPA 4W82A 1NASA 4DMMA 1NPDA 3Q9UA 2Q4BA 3CTMA 4HKTA 3M1LA 4JQCA 4BO3A 4R9SA 1EEHA 3ZV3A 1V3UA 2YQ5A 2BH9A 2PK3A 3O03A 3WWZA 2YYYA 1YGYA 4HFMA 3LT1A 1D1TA 4FGSA 3I9OA 3WGOA 4DREA 4YJFA 2W4QA 4EYEA 4E2XA 1XG5A 2GUGA 1NVGA 1PJLA 4RZIA 4WOKA 4OAQA 3W8EA 1OC4A 4MO2A 3AJRA 1HE3A 4TZTA 2PTGA 4YBZA 3V2GA 4YJGA 5JDIC 1JAYA 3MWEB 2JAHA 4BNZA 1VL0A 2ZJ0A 1PJQA 4GMFA 3K9QO 1YBAA 4JCOA 3IP1A 1T1SA 4R54A 1E7SA 3L9WA 4EBFA 3D5TA 4C7JA 3AK4A 4DLLA 4UEKA 3LT4A 1VPDA 1PU2A 1W73A 5GMOA 3KYCB 1M6WA 4ND2A 1EVJA 1WP4A 5AXBA 1DLIA 2IRWA 1OFGA 3DTYA 4FR5A 3TWOA 2BELA 3ZV4A 4BL5A 1NTOA 2Y93A 2X58A 4HWKA 1RYEA 2DTXA 5IZCA 4RVFA 1NR1A 2O4UX 4NNJA 3PDUA 1E5LA 4YTEA 4ZRMA 4BNIA 9LDTA 3I3OA 4E31A 2GZ2A 4DQXA 3DZIA 5DCYA 3JQ7A 4DRYA 1U5CA 2IYPA 4PRLA 3HZZA 4DTIA 4XQCA 4W6ZA 2IODA 2B83A 4CJXA 5A1TA 1FDTA 2I9PA 3DL2A 1DC3A 1QSGA 1D8AA 3LF1A 1DHRA 1LSUA 3BHJA 3RQSA 1ZXBA 3NDRA 5IZCC 3L07A 2ZCVA 5T64A 1OI7A 4R3WA 1SEVA 4IUYA 5L7YA 1H2BA 1BXZA 4Y9DA 2BFAA 4L76A 3S2EA 3H9QA 3WLEA 3RC7A 4BOYA 1T2CA 1X15A 2YFHA 3PIDA 2X0JA 2DQ4A 2X1HA 3D4OA 4DUPA 3O8QA 3WNQA 4WGGA 4E13A 1E3JA 2VN8A 4R5MA 5JCXA 3ZHBA 3GAZA 3LF2A 5IZ4A 4PLYA 3S2FA 3L6EA 4GGOA 2LDXA 3P2OA 3GT0A 1MXHA 3HN2A 1KERA 4EJ6A 1ENPA 5DBFA 4A5OA 2OORA 1VSVA 4ZQFA 5IN4A 5IJZA 1SAYA 2A4KA 2EF1A 1NPTO 2C7GA 2EERA 3I9LA 4WCFC 1R4MB 2W2KB 1FDVA 4FOSA 4Z3KA 3KBOA 2D3TA 4R5HA 3ABIA 4OMUA 3U62A 4ZICA 4XIYA 2PD3A 4MVJE 4AFNA 5G0SA 4TKLA 2AQIA 4CQMD 4JNKA 3DMTA 1D4FA 3GK3A 4CLRB 3DAGA 3RKRA 4J43A 1ML3A 3WSWA 5EN4A 1S6YA 5KVVA 3RUEA 4RGBA 3VH2A 4MOWA 1GR0A 2FPGA 2VOJA 4HFRA 2DPGA 1LLDA 1BXGB 1ZNQO 4WLVA 4HBGA 4IY1A 1E1KA 3VZRA 1F14A 4MIEA 2B5WA 2A35A 2DBQA 5F1OA 5F5LA 5LC1A 4BGUA 4EITA 4BB6A 1I3MA 2XOXA 2OUIA 2YV1A 3FRJA 1E6EA 4M8SA 1HDYA 4Q3NA 3ANNA 3ICCA 1B8PA 3H5NA 4R16A 3ADPA 4UULA 3VVCA 2Z1NA 3P19A 8LDHA 1JKIA 1MX3A 2QZ9A 1H93A 3W4IA 2I3GA 3QVWA 3OECA 4LCJA 1DIAA 3AI1A 4IXWA 1T4BA 4XYGA 3RC9A 3KOUA 1P77A 1R6DA 1GQQA 2NVWA 4L4RA 1I10A 3HSKA 1L7EA 5JSFA 3O4RA 4N7RA 3BXXA 2NVUB 4BKRA 3HE3A 4RV9A 4BNWA 4YAIA 5JDCA 2O3TA 5EQDA 3KSZO 4R68A 3Q6IA 5CP8A 4J0FA 4E5MA 2X5JO 1H9BA 1PGQA 3D3WB 4WKGA 4YRDA 5JDIA 4BQRA 3RJ5A 5A06A 1H6DA 3H2ZA 4ND5A 3ZWCA 1PJ4A 3DOOA 2JCVA 1UJMA 4YRAA 1E77A 1UP6A 4FPXA 5H82A 3GY0A 3GGOA 1YB1A 4FFNA 3MJTA 4ZU3A 2P9CA 4EEXA 4AJHA 1SPXA 3UICA 3SJUA 1IPFA 4PGFA 3E9MA 2HMVA 3GVXA 3IP3A 3JQBA 3G17A 4NJOA 3E9QA 4QSMA 4TMFA 2WE7A 4G65A 4G5HA 5TF4A 1BHSA 1LX6A 2D2IA 2Q49A 2EWMA 2VNAA 1IUKA 5GZ1A 3C7DB 4DBVO 5BR7A 4BB5A 1UXHA 4BO1A 4BMVA 3IUPA 2NLOA 4IJKA 4LVCA 1YS4A 1HYHA 2QIOA 4J2HA 4EGFA 4OL9A 1FK8A 2CDBA 4OXKA 4FIZA 1YRLA 3F5SA 4I5DA 1MB4A 1T2AA 4TRRA 4LMPA 1R37A 4FJ1A 5I7EA 5F1KA 4FFLA 3NUGA 1VL6A 4MVJH 5CDGA 1P1HA 4J4TA 4JBIA 4RVGA 1UZLA 1P1JA 1V6AA 5KVSA 3PGJA 4NBVA 1WAMA 2H9IA 2VWHA 3KYDA 5TX7A 1UP4A 3ZWPA 3NV9A 2FRDA 2PKQO 1ZCJA 1KEPA 2GCGA 3ANMA 4O5OA 5ITVA 5JNLA 1X1EA 1J4AA 2WYUA 4MP6A 1LBEA 2HJRA 3EVNA 4JP3A 4RDHA 3S55A 1OC2A 4AJNA 2VUTA 4OYRA 2GERA 4OM8A 1C0IA 1GCUA 1U7HA 4PIVA 1UZNA 1G6KA 5CEFA 5DN9A 2OO5A 1YVEI 4KZPA 4J7CA 1XQ6A 4CLHA 1ZW1A 4RVHA 1O95A 4Y98A 3H7AA 4IDCA 1IB6A 3V1YA 1DIRA 3UOGA 4CM8B 2IZ1A 1Z45A 4CQMB 2R00C 4CLOB 2Y0EA 5A3VA 4OXNA 5HS6A 2Z1MA 5G0TA 3N58A 3ZI0A 2ZQYA 1ZXLA 5BT9A 2JCXA 4N5LA 1YBVA 4BMNA 1M76A 3KEQA 2BD0A 2I6TA 4JJGA 4CM7A 4BV8A 1IULA 3RKUA 1IHYA 4LMRA 1Y8RB 4JLWA 2FPPA 3FNEA 3VH1A 4F46A 2JFFA 4WJZA 1JKFA 1VJ0A 2YUTA 5JO9A 1HDOA 3SBOA 4NBWA 3GN1A 1ZFNA 1HL3A 2WM3A 3PHHA 3LC1O 3O38A 1VL8A 4RPKA 2FR0A 4PRKA 5THKA 4F6LA 1ONNA 4I8XA 4XQGA 3BTSA 1AXGA 1DC4A 3I9KA 1QRRA 1TB4A 1YQXA 4YAEA 3ETGA 3FWNA 4I08A 1B3RA 1DO8A 4L73A 3D1LA 2EIHA 2HK9A 3MTJA 4J91A 1KS9A 2DKNA 4E33A 3NT5A 5IDQA 2CDAA 1UUFA 4U5QA 4F3YA 3JQGB 1U3UA 5CG2A 4RQTA 3BYZA 4O1MA 1RYDA 2RHRA 3GNTA 3RFXA 1MFPA 1W4ZA 1Y9AA 3PLRA 4ITUA 5L3ZA 3TDKA 4EUEA 4BUCA 5C7OO 5L4SA 4GSKA 3K6JA 4PG5A 1XIVA 3GMDA 4I9UA 5DBGA 1QKIA 1GTMA 3KXDA 1PGPA 1PR9A 2YY7A 4ALNA 4IINA 4JK3A 4G2NA 2UDPA 3FPLA 5DP1A 5ILGA 4R41A 2CF5A 2AHRA 3KLMX 5TNXA 1OBFO 4CMIA 3QVSA 4YRBA 2AEFA 4W7IA 1GDHA 3E82A 4R9RA 1GEEA 4UVIA 5I9NA 2LDBA 4Z6KA 3ZDFA 2YFQA 1PJCA 3IJRA 3ZHXA 3H5RA 1FDSA 4ZN6A 5KKAA 2B4QA 2ZCUA 2JL1A 2P5YA 2Q1TA 2JHFA 2NACA 3JQGA 1HZZA 4FC7A 2V6BA 5COAA 3AY6A 4OQZA 4EJMA 4U0JA 3FTPA 2PD4A 4K26A 1KIFA 4BNKA 3UCEA 2E4AA 1CYDA 3O26A 1HETA 1G1AA 1HLDA 4LCEA 1LEHA 4KMSA 4MINA 1ZBQA 3VTZA 2OHXA 3QWIA 4BNJA 1VC2A 1WMAA 3WLFA 5I7FA 5TLSA 3GFBA 1H94A 4PZEA 3TL3A 1ZZEA 3ZW8A 3GHYA 1C1XB 1FF9A 3N7UA 1NXQA 2DTEA 3QWHA 2GSDA 4L74A 2YDXA 4CMEA 1K6IA 1X7HA 3I52A 3HDYA 4TKMA 1TT5B 2X86A 3GDOA 5F21A 2C2YA 3WGQA 3OQ6A 1PZGA 5KTKA 3GMSA 3VHRA 1V9LA 5IG2A 4MP3A 3RUFA 1PQWA 1VRWA 4WE3A 4IBOA 3D64A 4GPD1 5MDHA 4E5NA 5FF9A 4CMHA 1XDWA 2O3RA 1B3BA 2P5UA 4F45A 4NJMA 4RVDA 3QHAA 4INAA 4K9DA 2HU2A 2BGMA 1E92A 3AOEC 4S1VA 1DBVO 4A2CA 4OH1A 3B6ZA 5HM8A 1HDXA 1YB5A 1F17A 3INGA 2PH5A 2BFMA 3ONEA 1I36A 1KC3A 3WFJA 2O7QA 1LLQA 2WSBA 3CPSA 5L95A 3IOYA 4QECA 1QP8A 1ZMTA 2D5AA 3RFVA 3L4BA 4KTTE 4P22A 1CDOA 4L75A 4KP7A 4NPCA 2G17A 2HDHA 2DVMA 2AXQA 4CM9D 2VNSA 4BVAA 1EUZA 4MIYA 3U49A 3AFNA 1O8CA 1XELA 4A0SA 3AUSA 3KYDB 1UH5A 4M55A 1Y81A 4NJMB 2NQ8A 3L77A 4P38A 5KVQA 3TL2A 3NGLA 3F47A 4KWIA 3K96A 3WMXA 2BI8A 2ZB7A 4ZJUA 1PJTA 2HLPA 4NBTA 5LDGA 4LN1A 3D4NA 1EQ2A 4WCDA 4IDEA 2HUNA 3HHPA 3C7CB 4D41A 3H8VA 4ROSA 1EVYA 5AXAA 2NV6A 4JBGA 4HY3A 3V2HA 3RUIA 3UCFA 1MFZA 4UVEA 3U4IA 1IY8A 3KB6A 2DBZA 1P0FA 1Q7GA 1E1NA 1ENOA 3EVTA 4J4BA 3UF0A 3V8BA 1L1FA 4A27A 1F8FA 1YDEA 1ZIDA 4CLEA 2J3JA 4BGVA 1DIGA 2FP4A 2HJSA 1LRKA 4B7XA 1W0CA 1LLUA 3ICPA 4FB5A 4E2YA 1LU9A 3PJEA 1R4MA 4MDHA 2IEBA 2PD6A 4I5GA 5C7IO 4BNFA 3PYMA 2PKRA 1I24A 3GAFA 3OEYA 2X9VA 3KZVA 4LVUA 3S1LA 1I0ZA 3QVXA 2V6GA 3R1IA 3JD2A 3B20A 4CUKA 2DM6A 3V2UA 2PV7A 3GVPA 4N54A 5JMPA 4ZD6A 4FDAA 3NT4A 1N7HA 1W6UA 1N8KA 4MP8A 3TFOA 3ROKA 4NZ9A 1DRVA 4DLBA 3BHIA 1OMOA 3PJFA 4UUOA 4M54A 1MXFA 3DZJA 3TPCA 3VC7A 3RROA 4ALJA 4YYZA 2DFDA 2VOEA 4D43A 2C07A 2VWGA 3JQ6A 4RQUA 4CQLA 5TIIA 4J1QA 1F06A 1E3SA 1ZK0A 3BTUA 3OJOA 4ZQEA 1H9AA 3QY9A 2OOSA 1GYPA 1U7TA 1R15A 2BGLA 4B3HA 4GAEA 1SO8A 5C5IA 3KHUA 3JD4A 3FBGA 4M1QA 4WLUA 2VYND 5JPIA 3BMOA 1MG5A 4I9NA 4PLFA 4WNCA 3ZWAA 1LDGA 2NSDA 2O48X 4PZDA 5EQFA 5AQ1A 5JYEA 1SEPA 3ZU5A 4TVBA 1X1TA 2GNAA 3BMCA 4NHEA 5G4KA 3TOXA 3ENNA 5T8KA 3ZV6A 1U2DA 4PN3A 2Q3EA 3RJ9A 3AWDA 2PH3A 3F1LA 4IDBA 4CMEC 1D3AA 4EDFA 2VYVD 1GV1A 5DCWA 3Q3CA 1UZMA 4TRNA 3VZQA 2HQ1A 4RVUA 3WYEA 5A4DA 2CVOA 1WMBA 3AY3A 3EK2A 3QP9A 3K8ZA 3PJDA 2G82A 2Q50A 4RPLA 3P7MA 3ETEA 5AXCA 3WGIA 4MVJA 3ZU2A 1VE9A 2C54A 2FZWA 3AUUA 1HE2A 1U1IA 1JLLA 2P9GA 5CPFA 1AXEA 1J5PA 3ASVA 3UHAA 4B8ZA 2FSVA 1TA4A 3ZWWA 5LDHA 1WZIA 5H83A 2Y1OA 3MTGA 3OF2A 2CUKA 3NJ4A 5T5QA 2I99A 3F5QA 2FSSA 4WLEA 4B3IA 2I76A 1CIVA 2X22A 5ER9A 4BO6A 1PR3A 2X9GA 4HFNA 1DIBA 2DC1A 2ZK7A 3H9UA 1WVGA 3HWRA 3MWDB 5G4KB 4BNLA 3CZRA 1BDMA 2OL4A 3CKYA 2ZJ1A 1BDBA 3AUAA 4WCFB 3QJ5A 1E7RA 5COQA 3TQHA 1JTVA 1X7GA 1HDGO 3GH3A 3BMNA 4XR4A 1ADBA 3AI3A 1KEUA 3KO8A 4HADA 4EW6A 5IN5A 2O3SA 3ITKA 4Q3CA 1MC4A 4CPDA 3DDNA 2XPCA 3MEQA 2IE0A 3UKOA 5JC8A 1A9YA 3AU8A 3C1AA 4PG6A 4I1IA 3PDJA 1U9JA 1LRLA 2D59A 1QYXA 2V6MA 2W98A 3SLKA 1PGOA 2OFPA 3WXBA 1XYGA 1GPJA 2DU8A 4YWJA 3C7AA 5JS6A 3SEFA 4BO8A 4F6CA 4QXMA 4XYBA 4LGVA 1YH3A 5TJ9A 1XA0A 4IM7A 3INRA 4XGKA 1GZ6A 3NT2A 4NMHA 4XEHA 4GX0A 4P4NA 1ONPA 2J3HA 4BNTA 2GRAA 3FTNA 4KUEA 3VH3A 1B16A 1LI4A 2TMDA 3WJAA 1OZAA 3W4JA 2EP5A 3JQFC 4NFHA 1RM5A 4ND3A 4Q3BA 3FNHA 1IZ0A 3MJEA 1N1GA 1VSUA 2AQKA 3VH4A 1MGOA
chains in the Genus database with same CATH superfamily
3H2JA 4H4CA 4BFTA 3ABRB 3V8MA 1PVOA 3DO5A 1YB6A 4MV3A 1OYOA 2AYZA 3LY8A 3DTVA 2G0NA 1ZDMA 3R0ZA 3WRXA 4K1LA 2RI0A 2W2LA 3HMQA 4Q4CA 1CUUA 2UZ4A 3QX9A 4GKKB 1FQOA 2Z9CA 3E7DA 3OFVA 4Q4JB 3L0ZA 3NGMA 2YNMA 3GFGA 4N3AA 1R16A 1R4AA 1H0KA 4GI2A 5JFOA 1P4RA 4CLRA 1TI7A 1W49A 1NRXA 1L4KA 2ZJ6A 4BV9A 1PSDA 2O5VA 4DN6A 1ISGA 1RRGA 1S2GA 4KQWA 2G9VA 3QOFA 1JE1A 4IVPA 3PIIA 4E3ZA 1XTQA 1K2WA 1E1DA 2VNIA 3BDIA 1P6QA 5A9TA 3JRXA 1AKNA 1Z12A 2OY0A 3DULA 3ZU4A 1T4DA 2QT0A 2VDPB 3B60A 2G5TA 1MX5A 3K0KA 3KV3O 1FJ2A 3LYUA 3PNMA 1LSJA 3NHSA 3IB3A 2A1TS 3EEQA 2O5RA 4H17A 4NYMR 4AZWA 1DT5A 3D4IA 5GOTA 4BQEA 2I80A 4X6XA 1RJ9B 3MFYA 5HWSA 2EFDB 3SSOA 3V6LA 5I5GA 3AB3A 3DM9B 3ZDDA 1QTIA 3F4LA 1Z18A 4AL4A 2IZ5A 2X2FA 3ZIDA 3GLGB 5T3YA 2Q5OA 1WY5A 1JKJA 1O89A 2XMSA 1OFIA 3JQCA 4C0XA 8ADHA 3A25A 1V8ZA 5BY2A 3GRUA 4QPCA 3RVJA 4CCSA 1O0CA 4B80A 4MRAA 4D3FA 3G5AA 3D2AA 1L1EA 1ZNYA 3TSOA 4R2IA 4TUYB 4EFNA 3GLIB 2X1MA 3PQEA 4BO5A 1TZMA 3DB1A 4GLOA 5NULA 3RUDA 3C5CA 1H69A 2DPMA 4RHTA 3SOPA 3P71T 4EA9A 2WWWA 1OJ7A 5DLDA 4LF8B 1L7NA 1LTHR 4H3SA 2XTNA 4L1KA 1TEVA 4G1EB 2IS2A 2CVQA 3GLQA 4L4XA 4NMXB 3IQHX 2Q5FA 4QHTA 4WESA 1P1KA 3TPZA 4FQ7A 2JEYA 3WR5A 4HAZA 1IG3A 1JVNA 1G8HA 2XGMA 3LO8A 4KIGA 3C85A 2P9YA 2BDTA 4DWVA 1CQZA 4KK3A 4NC9A 5AFSA 3F78A 2ETXA 2OV4A 4URYR 3GGCA 3A31A 3RVLA 5DNUA 3WS7A 2E6KA 4BWFB 2AX3A 2OM6A 2ZZKA 1H3FA 2H52A 3A1CA 5DT9A 3PUWA 4HB4A 1Z07A 4NU0A 2DKFA 4Q6WA 4CVNA 3E3NA 1T2NA 1DAIA 1E7MA 1YWGO 3DQQA 3ZZUA 5JZMA 2NVBA 1MC5A 1ULTA 4M3NA 2XNJA 4IGEA 1DRUA 1B1CA 2D8MA 1G6Q1 1SOAA 2DTDA 2GTPA 3FUWA 2EFHB 4IV5A 3LHIA 2FMUA 4NATA 1XZKA 3NTQA 3O4JA 5FPSA 1ZWKA 3CNQS 1LC3A 3I09A 5IVPA 1RWPA 2PKEA 3A9SA 3WP1B 2JFNA 1UWLA 1YB7A 2GF2A 2ISQA 2YXEA 1KJZA 3BILA 4RMIA 1NVTA 2FGJA 1UKAA 5L45A 3LUAA 2J5XA 4LRYA 2UYYA 4IJQA 4PIPA 2HT6A 4HEHA 2J0UA 3RJTA 3EFOB 3G2HA 4EP1A 1K9SA 3FFWA 3WLOA 1W25A 2R5WA 3BE6A 3W6NA 5K1SA 2IS6A 2NU6A 3O3MB 4ZANA 2WIBA 2Z56A 3T41A 1DV1A 2VLBA 4Q47A 4DYVA 5BQ3A 1UOPA 4YT8A 1ZOSA 4U2CA 1ZHFA 1WD7A 4B83A 3AP2A 3TAHA 5TMBA 4DJ5X 4L6CA 4GD3Q 4CKWB 3TOCA 1PFVA 1QH1B 3WO1A 4IILA 5IP5A 2DHEA 3WSTA 2AD1A 4JVNA 4BZWA 1R0LA 1QYVA 2W90A 5CIWA 4J3NA 3UWMA 1QGUA 4Q16A 4RJJA 1YSCA 1Q3TA 2NO4A 4F5ZA 5CFZA 5C53B 2PFGA 4OBBA 4U7HA 1D4AA 1OAOC 4DCMA 2RC6A 3HL0A 3AONB 2O7SA 3QW2A 2BFPA 3Q7QA 2YY5A 1QAOA 4IJMA 1FSFA 1GPYA 2FI1A 4BRWA 1YQ9A 1EFVA 3AF6A 2OB1A 1JAXA 1E2UA 4U2FA 1FX0A 3ENQA 4B0PA 4I4TB 2OGZA 3TQFA 2ZJZA 2AQ8A 2C5SA 1KZ1A 2PWYA 5JZ9A 4L0QA 1RZRD 3QA9A 1PQ4A 3GPLA 3PFCA 3T7AA 4HS9A 1HTTA 4TSFA 1GN9A 1G6HA 4J1SA 4WLOA 1P7YA 2BTOA 1X6VA 3GNQA 5FL3A 4QASA 1M2HA 4YAWA 1DAOA 2AFHE 1V37A 1KJQA 5K3AA 5T6MA 4P80A 3L8MA 4N0EA 1KKMA 4RULA 4PO3X 1P2GA 4CLOA 1IL0A 1RHMA 2DFNA 2VXBA 3OTQA 4OHMA 2IXDA 3X2SA 4EGAA 1A5ZA 1AA9A 1S1CA 2XMPA 2I54A 3BWCA 1Z0KA 3TVTA 1UAAA 1SXJA 1W35A 3IAAA 3VHXA 2ZRMA 4CQMA 1N4AA 1LJUA 4X0EA 5F5NA 3DOUA 5TQ0B 1O87A 1T0PA 2AUMA 5EESA 1JIQA 2EGUA 2O7RA 4EB0A 1GSOA 2IUSA 3RABA 4B4DA 4Q3AA 3H5WA 4BNNA 3H4VA 2EFGA 2YMMA 5AW5A 3BMQA 2JI6A 3GZ4A 3F9IA 3IXMA 1QWSA 1XZEA 1Y9EA 1ZHOA 1EJ2A 3OEEA 1C0KA 4TMWA 4V1CI 4HMPA 2IY7A 1JJFA 2AFHA 2W42A 2PUDA 2A78A 3DOHA 3WWCA 5ENZA 4ZMSA 3PGVA 2QORA 2ZBDA 4JDPA 4KDRA 2CV2A 2Y77A 4OJYA 5H7XA 5YASA 2HEGA 2A7QA 2D4AA 4RPJA 4DZRA 2WPDA 3SFZA 3R9XA 5LUAA 1U6JA 3AM4A 4P35A 3W6UA 3O1HB 1QVWA 2CVFA 1DDIA 2WYHA 4CCWA 2F55A 4U1RA 1CUBA 4ENUA 3KZCA 1GCOA 2DF8A 4CKEB 1IHDA 5ITWA 1L5MA 1LK7A 1HFJA 5C0OE 3GRYA 1RM0A 5AHWA 4Q4JA 2NPIA 2QGFA 2ZI4A 1MOZA 3TLMA 2FH5B 1Z5WA 2BTEA 1N9GA 2EW2A 3GQBB 1WHTA 2I1LA 2JGLA 4WSOA 3GX1A 3UJ9A 3UUWA 3TRKA 4CIVA 1MA3A 4S1TA 1R8QA 4BXOB 1GVNB 3DBLB 4LBWA 4E5VA 1FRVA 2Y66A 2YBDA 3D9QX 1F0PA 1GYQA 2GHTA 5G2OA 2EHJA 2OMEA 3UGTA 3SCZA 1JQEA 1E1MA 4WTOA 2LE0A 3TZLA 1YL7A 4X64B 1UK9A 2Z4SA 1QWOA 3LZ6A 1ZD3A 4RMNA 5KSPA 2IL1A 2L0XA 2PPVA 2CXXA 3FMIA 3SZMA 4O4HF 1P0PA 3EEBA 4BIIA 5GINE 3VGJA 3CXUA 3LHDA 4JLUA 2VHQA 2F8SA 4ZPJA 3ON5A 4LXYA 4NMWA 5FV7A 5EJ6A 4XVRA 1F1JA 5TJHA 3K71B 2V7XA 3W6OA 1RYBA 9LDBA 5KYKA 1ZGBA 4CMIB 3BM5A 5LQSA 2G28A 4GDMA 3EULA 4I0WB 3OPVA 2WJ6A 1CG6A 4URVR 2VC2B 3TZQA 1OB5A 3PLNA 5HF5A 1NXSA 2BHNA 3ROQA 1IIRA 2CJWB 2OD9A 3OLZA 1CUHA 4RYDA 2QRUA 1VJ5A 4ZO6A 5EERA 4YT2A 3WGGA 4DIOA 4YJGB 1FZQA 4EHBA 3I30X 4G36A 4HLDA 2OP1A 3SGLA 5K20A 1WU7A 5FWYA 2IKQA 1EM6A 5LB2A 3T9EA 2FJ0A 4ZHSA 2WEKA 1R0SA 2WUGA 3I2YX 3IOCA 4JP2A 1KC1A 2PUCA 1VLHA 3D2BA 3UT5B 5B12A 2IVZA 3C6BA 4CFSA 2VT7A 1TK2A 1USGA 4UBJA 2CL6X 1RZVA 5A5FA 4PQRA 4PSKA 2VJMB 4D4MA 2A1UB 4O0MA 1UKYA 4YB8A 1FE8A 4LYHA 1LVGA 3DDHA 3HK2A 2G1JA 3TMYA 2XT9A 3AG6A 4GLLA 1MORA 2E48A 4P2BA 3L7KA 3OH8A 4X7PA 3KKEA 2PX3A 1VHDA 2XWQA 3RSCA 4R51A 3HCOA 4NMMA 2QTVB 4XA8A 3ZE2B 3KPUA 5DI3B 1OA0A 1E2QA 1VB5A 2H18A 5CJJA 1RCUA 3T1TA 1A2QA 3QTTA 4R9NA 1NSYA 3SBXA 2HCTA 3QVMA 2IX3A 3UH0A 4J8PA 3P1JA 4ZV9A 1KZ6A 1CEEA 3B9RA 1D6JA 2F43A 2QZSA 1FQKA 1T25A 4Q19A 3UW3A 1XQ9A 4Y6RA 2GHIA 2Q6KA 3EQ6A 1N2SA 2CUZA 4EY5A 1MOSA 1QTRA 5ECDA 2BIFA 3QELA 3FJ1A 1F0YA 2GGSA 4K6CA 1S9DA 3KKOA 3ZHTA 1R7RA 5HZGA 1QU3A 2H51A 2YHUA 1KYIA 2GH1A 2NWQA 5I8ZA 2GN4A 2CDNA 2Z4RA 4B84A 2WVJA 3PXGA 4EEKA 4AP5A 2B34A 1OBVA 2WOJA 4AWAA 4AQ7A 1C29B 4KQHA 3HPQA 4BRUA 3VU9B 2HMAA 5EMJA 1G0NA 1ID1A 1SA0A 3C45A 1AGNA 2HMTA 4YXWD 3KEMA 2I29A 1ZYUA 1X7XB 1A7JA 3CCBA 3EAFA 4H7KA 4CKWA 3QXGA 3NHKA 2B4TO 5IDVA 1C7ZA 3CVVA 4NCNA 3B2EA 3KR2A 4TYWA 4KO3S 4NR0A 4RSHA 2O4CA 2IGTA 1YR1A 3I28A 3OT1A 4JI1B 3E2IA 3WKEA 4Q9IA 3CX8A 4CMAA 1Z4NA 1XRSB 4QGHA 1X7ZB 2PXHA 4G5GA 3D4LA 2HSEA 4DCSA 3HB0A 4ID3A 1A7UA 2J7PD 2MMCA 1KI8A 2QVXX 4IRMA 5B36A 4Y67A 5AVRA 2BBWA 4L4SA 1OXKB 5HX7A 3LIPA 4OI2A 2BBTA 1J42A 4QU0A 2VQSA 2VZ8A 2ET6A 1BXKA 3V4SA 5KX5B 3NAMA 3OCCA 2KLBA 1U9IA 2G7ZA 1ZQ1A 4H77A 1DI0A 2D2FA 4R69A 2FWPA 3E35A 3FMVA 2HK8A 3DAYA 3R23A 3TOZA 3O7MA 3G82C 2M6LA 1KAQA 5AKHA 2OHOA 4CM1A 5KNBA 3FI9A 1XHLA 2YZ7A 1R4ZA 4DHEA 2JNWA 1LBIA 3T0IA 1ADFA 2EQ5A 3WA7A 4RD6A 1LS6A 5JFTA 5H02A 3RWMB 2P79A 5DMXA 3MJVA 4IDOA 3ZQ6A 1RQXA 2GWRA 4P92A 4DZZA 1T5HX 2YXNA 3WTBA 5CBKA 1DPFA 2GS9A 2ODTX 2EEPA 2J9XB 4G2TA 1IE3A 2I87A 3CB4A 3PNSA 3BEOA 2G6BA 2A9OA 1TF5A 2WJAA 4H7IA 4Y2YA 5TMPA 4V38A 4EQZA 1N34B 1XL1A 3NIGB 1K9VF 2GCNA 3M3HA 3P27A 3AQ4A 1KYTA 2XCUA 3COYA 3EEIA 3A26A 3AFIA 3MQ2A 1S02A 1LFAA 2CVHA 2IHYA 4C6TB 4H27A 2FMKA 1J33A 5D1NA 4ZEWA 5ALXA 4KQFA 1BHJA 1U5AA 2H2AA 3GJXC 4BKPA 4DWJA 1WF3A 3E3AA 4R4JA 4QXRA 1H3NA 2O2YA 3C3WA 4BEVA 4Q3EA 3ONFA 4POOA 3RYFA 3L82B 2REBA 4FFPA 5K8IA 3FDJA 2AC4A 3O3OB 5JZBA 5ILOA 1RXVA 2UZIR 3OETA 2IOFA 3GA0A 2ZJ4A 3LBAA 1A9ZA 1BQ3A 3O74A 2WA2A 3C43A 5B4TA 5J43A 4U02A 5ITZA 3VYSB 4WZBE 1O4WA 2VHTA 2XWSA 3G85A 3PDHA 3GJ8A 4L8GA 5CMLA 3IIMA 3U7IA 5KTTA 5BMVB 3Q5DA 2W8ZA 1Z5ZA 1RKQA 2JJ1A 4AN4A 3K15A 1HWYA 3BIJA 2ZS8A 2JLZA 2B4RO 1NRJB 5BWBA 3N7AA 3E8XA 1ADJA 3JCZA 5LWQA 5ECGC 4YJDA 3SHWA 3TIIA 5KKCA 3KUXA 4AJEA 4DR4B 3CLSC 5E1DA 3NYWA 1QYDA 4KQ6A 1L4NA 4QGGA 4IWNA 4CYMA 2J45A 4B87A 4A3SA 4YEDA 4D9NA 1LS1A 2AE1A 4TTQA 3U4HA 1G63A 5TT1A 1N33B 1CY7A 3RVOA 1G59A 2GPSA 4WRRA 2J4DA 1HZJA 3LQ2A 4FK8A 3RVMA 2B35A 1FU4A 1V8BA 3HSYA 4KDCA 5DDIP 4GFDA 2ZAGA 1WCXA 2FKNA 3IGFA 1L4EA 4DNOA 4LTDA 4GYJA 3ACDA 2B5VA 3BUSA 4OD0A 3WISA 2FXIA 4LRTB 1SUAA 4MYTA 2G1UA 4UBOA 3D8NA 3E9NA 5LP6B 4E70A 1FUUA 2FPIA 3RLIA 4A8PA 3CF2A 1CY1A 1TAGA 5ALTA 1CC1S 4FCWA 4G5XA 3U4CA 3QEKA 4R2LA 1KQ3A 1UL1X 3ZV4A 3CLRD 2X9QA 1NQ5A 1ESMA 1OILA 2Z83A 4XWYA 4W5OA 1IJEA 1D6SA 3GFRA 4Q9NA 1JA0A 5JNSA 2EG5A 2OXIA 1UKCA 2PFSA 1S3GA 3PQ4A 4UU7A 4MULA 1TJ5A 2IUFA 3D1VA 5AM2A 2B82A 1XKLA 2JJ8A 3AJAA 1SC3A 3L06A 5BVHB 2CBGA 3K0HA 1M6YA 1NW9B 3OHPA 5AVYA 4HT3B 3K1YA 1SHTX 2B0CA 3SDBA 2OQVA 2CW5A 2ASEA 3KCQA 3ZJUA 2ZDGA 2WIJA 1C9MA 2JH3A 4NESA 2CNDA 1AD2A 1KE2A 5FNZA 4TTRA 5AP9A 2GAFA 5AKIA 3ZCRA 3IOEA 3SFTA 2RHCA 4K6OA 5HK9A 1ECGA 4ESVA 1M8FA 1GNQA 2XE6A 1CR6A 4CNQA 3FB1A 1G55A 3LW8A 3GROA 2QAGA 2Y0BA 3UB2A 3KSAC 2I6XA 1AMOA 3CC8A 4QM6A 1X1CA 3OM1A 2IJGX 2IH5A 2PJDA 1AZSC 2AN4A 3H5VA 4OHVA 3QE0A 1DKQA 2POQX 4TMKA 3B53X 2I1QA 1MLDA 1RHJA 3LQYA 1L6RA 3WYNA 1XD2A 4JLMA 1XWFA 2DBRA 2PMBA 1XALA 2REQA 4I19A 4MR9A 5K99A 2Q46A 1COWD 1D7AA 5CEEA 3NTVA 2HT1A 2GM3A 2DGDA 4Y6PA 2ZWIA 2FAXA 4KVFA 1KEVA 2YV5A 2H29A 4EKDA 2OBNA 5IKOA 3EXIA 2QN8A 2VAWA 4LXTA 1TVMA 2QB5A 2HCRA 4DR5B 2Q2OA 3H2BA 2VSNA 2Q6TA 2VR1A 1QHFA 3X3HA 2X0IA 4YJ2A 5EMHA 3QFSA 4NCIA 4QXAA 1DMSA 4YWHA 2NU9A 3EVBA 1VTKA 2WYVA 3VJLA 1AO3A 3DF9A 2R65A 4URZR 5A9SB 5DZSA 4WQMA 2BN4A 4JU8A 3D0OA 2W48A 4O2BB 4CCYA 1XRNA 3KQQA 3WWOA 1ISIA 3I9NA 4OHXA 2RGGA 2FEXA 4M9ZA 4OQLA 1JIKA 2OZKA 5ALFA 3LUJA 4JFRA 5JCZA 3WLAA 3TFWA 5CVJA 2ES4A 2J7PA 1G9SA 3RC2A 3S99A 5LOVA 4UEQA 3R9KA 4DJEC 3V7UA 4LNUB 1B8UA 1EZ1A 3L4EA 4B6GA 2I3ZA 1BKSB 4PZ9A 2YVAA 1TVKB 1KZGB 1KK2A 3CBQA 5JSHA 5EWJA 3NKLA 2HHJA 2ISSD 2PA0A 4BJ5A 3NO4A 1DMRA 3PK0A 1Z17A 4C14A 4NE9A 3HYSA 1RPZA 3KPJA 4TZ0A 2PX2A 3W2FA 3AVTA 3MA0A 2PH1A 1U9YA 3KD3A 4RGYA 1HQDA 1TYDE 2LRHA 3PCRB 4WKCA 4DBLC 1ENZA 3OOJA 3FF4A 1LDMA 1X3SA 1Z9BA 2EKZA 3A1DA 2OCIA 4JLDA 1F5NA 3USES 1I7QB 3F98A 4KH0A 3AR7A 2X15A 4JC4A 3LX4A 1I2BA 2BW0A 1DOZA 1MDBA 4CN8A 5L53A 1E2BA 1KDTA 1KAGA 2BJVA 3NUZA 1NHGA 1ZUNB 3Q3HA 4PX2A 3KTAA 4KXUA 5I3ZA 4DNPA 1M7HA 2XDWA 3UK0A 3EEOA 3LLCA 5CFPA 3DQPA 1SC6A 5C18A 3QMPA 4MV4A 2O54A 1EQUA 5FYDA 3DLHA 2AEMA 1P44A 2HO5A 4LXIA 4YT5A 4C30A 1J99A 4QBKA 4G8JA 1T5IA 4EELA 4CBVA 4JWKA 2FUG6 5HZKA 3U13A 4Y2UA 3VMMA 2JARA 1PEAA 3B38A 2JHGA 1O94A 3NDPA 1D0IA 1CS4C 3NRCA 4GC5A 3ZJYA 4CQLB 4F8YA 2O8CB 1JIJA 4H1HA 5IYZB 1HTWA 2BFFA 3WMGA 4D4IA 3D7LA 1XD8A 3W5BA 2DPHA 2XTZA 1U7UA 1X70A 5ARBA 3C4VA 3GZJA 3I4FA 2CLIB 2Y68A 3FVVA 1QZXA 3GGJA 3TZCA 3S7ZA 1I3LA 3HBFA 3O4GA 5AIBA 1N5LA 2VP5A 5KNLA 3I6IA 5AOCA 5JXGA 5DM70 4QUDA 3H17A 1NU8A 1EWTA 1IM2A 2DHRA 2VPXA 1PT5A 2XWBF 3JQAA 4B43A 1P81A 4EGCB 1HEYA 2EKBA 3AEXA 1JHAA 1RXEA 3QKRB 1ZVJA 5CLGA 4RORA 1OE0A 3G7SA 1G7RA 2FW1A 5EXDA 3QKSA 4EA6A 4J1TC 4UM9B 1JE0A 2Y1LA 1P6UA 2WT8A 1I4EB 1Z68A 3B6JA 4R84A 2MSDB 1YUBA 2FR1A 3GUCA 3PR3A 4WN9A 3D2CA 5DNAA 4CU2A 2R6R1 4GYKA 3VKFA 4O59O 1NVXQ 2RK6A 3SZLA 4D0GA 1W4RA 3KPYA 1X77A 1KH1A 1UDWA 3MD9A 4FWIB 1XZIA 5ERXA 1DRWA 3Q5EA 4GSLA 4GGPA 2IEYA 1EI9A 5F1PA 1QJ4A 2XUKA 2OV1A 3BK7A 3MGKA 1O6ZA 4JLKA 3VOSA 4W7HA 5CITA 2YUIA 3UVEA 2H92A 4IJ5A 4IQ8A 1O0SA 3FRIA 4C4OA 1FQJA 2HBZA 2IYOA 2CJWA 1A4IA 2EFCB 2I0FA 1GRRA 4BFVA 5I47A 2VQEB 5A04A 3BD9A 3RAGA 3T7DA 1A96A 1O95C 3NX4A 3G2KA 4MMYB 4ZYVA 1DZIA 1ZX1A 3KQPA 3TNLA 3O4VA 1UCFA 2XF2A 3A6HA 3NLLA 4XQ0A 1O96B 1EP9A 2NUBA 1YDWA 4W1RA 2XD9A 2YYSA 2ZJ8A 3R5KA 4ENTA 1PVVA 4JI4B 1DGQA 2ETVA 1T8RA 1N5JA 1FJXA 4FDVA 4KR0A 4UOEA 1AQYA 4TLDA 1G6OA 4QQ8A 1BX0A 2OZLB 2Z5FA 1QGDA 2WKQA 3DW1X 4JJFA 4E32A 4HUTA 3M70A 3SFVA 3KJIA 3OZWA 3BMNB 1EFRD 4YACA 1JFFB 1FRZA 3TJRA 1P0MA 2JJ2A 2VIIA 2ZUBA 4XFJA 3WYAA 4EI7A 2NTNA 5HJEA 2VHCA 1GTG1 2YV4A 4GT1A 3GLHA 3UXHA 1S3FA 2BEWA 3MJ4A 1KZ7B 3L7DA 4HDMA 5K2MA 4C4PA 3MLEA 2W2LD 5BMVA 3P20A 3PHIA 4O3MA 4P6VF 4A26A 2FUEA 5CDFA 1DWPA 1J7KA 1JUDA 3KTDA 3ADKA 2FETA 5AUPB 1BS9A 3TAUA 2D0OB 2VUIB 2VZ0A 2VHVA 4W5TA 4IZIA 4H3KB 4LRWA 2FWAA 3RLFA 5DX0A 1JQAA 1JJAA 3VU8A 5CHYA 1KJNA 4YMWA 3E5NA 3SJCA 3O31A 1XMQB 4JN6B 1U8FO 5DBEX 2V3WA 1E5TA 3DLPX 2DT5A 3MT0A 1JEOA 3HJGA 4N12A 1AO0A 4B3TB 3D3NA 1N3BA 2JCBA 3FPKA 4U7FA 1YZQA 2WHPA 2V5AA 5HHTA 4MPPA 3GG2A 1ZA1A 3HJAA 2O07A 2BFEA 3GOQA 4MMXB 4QOEA 4WLNA 4ZRDA 3ZUPA 6CHYA 3T3OA 3RK1A 3SX0A 3JARB 2ZBVA 4ZOLA 2GF9A 4RFSA 2D5LA 1LVUA 4KSYA 2NT3A 4OAPA 4C0AC 3T3HA 2BR5A 1SBYA 2WAMA 5BUCA 3UHPA 4E5SA 3HR8A 3A9TA 3B8HA 3U3RA 3OOHA 5FI5A 3RFFA 3URMA 1ILWA 5CDFE 2OZPA 1EWRA 4E5PA 1IQPA 3VDMA 5DOVA 1NOIA 4GQBA 4I1PA 1OXVA 5C3MA 1HORA 1Z22A 3IBYA 5DU2A 3C5HA 1LTKA 1X0VA 1K3FA 4FCVA 1JSZA 3QPWA 1RAFA 1Y8CA 4C0HA 1GTRA 5IDXA 1E58A 4O4JF 4J16A 5FQNA 3RSQA 1FTNA 1L1RA 3EH1A 4TKZA 1MTOA 5JTTA 4EG4A 1L5WA 3D0KA 2Q4DA 2FN8A 4XR9A 5JH7A 4DV5B 1XMJA 3E6AA 2SHKA 3QG1A 4CMBA 1NW3A 3ETDA 4MWDA 3OTIA 1ELOA 1DTEA 1CR0A 4AUKA 1BEUB 3DT9A 2PVSA 4HXGA 1MHTA 1WLYA 3WY9A 2XRMA 3QSGA 4MAFA 1GQFA 1XXHA 2BHSA 4HDOB 1AUPA 1KSHA 4OHBA 4KYTA 1QH8B 4AT1A 4NXMB 1RQPA 1PJBA 2IW1A 4XCQA 3PD1A 1ZM4A 3G9XA 1PX2A 4FYKA 1ORDA 1OH6A 2RH9B 3C8HA 4UTZA 2V8OA 4H7JA 1GSAA 4XOUA 1Y0BA 2QE7A 1CZKA 5K0CA 2D74A 5TQVA 3ZU6A 2QIPA 1KDOA 3EGEA 5FEUA 1R88A 3THRA 4WNAB 2MYNA 4PGHA 1V5WA 4TWIA 1L6IA 4B6JA 1PYGA 1OLUB 1U0TA 1QR6A 1J2TA 3KXPA 1UMDA 3BWYA 3C15C 3LBIA 1E5XA 1XQXA 3PI7A 3ZYCA 4M8NE 5EYPA 3S1AA 5BSFA 3DVAB 2XXJA 5JBIA 4ONEA 1OXXK 3PDIB 3QEMB 2IPMA 1NVAA 5DXFA 5EHIA 1KVSA 1GZ4A 2G76A 2IEGA 3GARA 1EX7A 4V3CA 1NUAA 4Z0TA 4CV3A 1NT4A 3H1GA 5BW4A 4XB2A 1EE1A 1QGOA 3E22A 5IMSA 1RMTA 3PITA 1SMKA 3R09A 4FE7A 3OMLA 1FNSA 2RGAA 4F0JA 1V8OA 2UUBB 1H8ED 2IDKA 5LKRA 2NUPB 4OGWA 3F96A 2MIIA 3ZTTA 2MYPA 2PKYX 4TYMA 3R8CA 1Y82A 2MYUA 1KXZA 2OBYA 5JI2E 1CUEA 1WXEA 2ZQ5A 7YASA 5A2GA 5EZSA 1WCIB 3FSJX 3ZHOA 5H81A 3QF4A 3L6BA 3HZOA 1LBSA 5A9RA 4I50B 1ESNA 3DDUA 3W3AA 2DG2A 1BCSB 1Q92A 4CDNA 2XNKA 1BWSA 2IQIA 2AMYA 4R8VA 2Q5LA 5AESA 1F8XA 1FFXA 1ZG3A 2V55B 3PUXA 1Q14A 3O4IA 4ITRC 4JL8A 2DEUA 4RF3A 2F3TA 4K0KB 3NPAA 3DBRA 4RIFA 5LQKA 5K0FA 1AHHA 3EWSA 5CEJA 3D3KA 1XFAA 1WDWB 3BJRA 4BQPA 1E79D 4QKQA 3WYDA 5J5VA 2W2TA 3IQIX 1QHNA 1AGPA 1W59A 4ZREA 4DCOA 2QRPA 1R4NB 5BSWA 1D2HA 2ANBA 3AOGA 2QSUA 3O2QB 1L4FA 2RONA 4UHFA 1ZGCA 5DX8A 3H9CA 1JNXX 4WN9B 4YMSA 3W5JA 2CDRA 4YAGA 3SHOA 2WWXA 2G9QA 4KUHA 4R6XA 2AR7A 5FR1A 5HG0A 4ALIA 1RD4A 5AK5A 2IOYA 2P91A 3EDMA 5L7WA 2ZRAA 5I6DA 3JYPA 3PC2A 3PGMA 4OB6A 4QVGA 1MD9A 2B8EA 1QCDA 4BJHB 1YA6A 1YI8A 1XVUA 3QVOA 4C08A 4YJ3B 3SJBA 3VR6D 1HRKA 1PG2A 3T3MB 2HPHA 4B3MB 4J0HA 5B2EA 1MJNA 1IVSA 1L5SA 1YK1A 1DKRA 5E4TA 1IK6A 2Q07A 2ZYRA 4R1SA 3B1JA 1D7OA 4L0MA 3Q8MA 2PA3A 1T1RA 4YV1A 4NENA 4Z0PA 3W2EA 1PJRA 2GILA 2H2HA 1OKKD 5AK3A 3ZD9A 3IIEA 1KU6A 4CM8A 2PRJA 3ZY4A 2OBBA 3JZFA 3RJZA 3J81A 2RIRA 1JFTA 4FLEA 1S01A 3MG9A 3N7TA 3Q3EA 4NAHA 4AJLA 1SIBE 1TJNA 1SUEA 4J7AA 1Y9JA 2QW1A 3WGZA 1SVNA 5G53C 4JNCA 1FEZA 4L5AA 5ALGA 3S7TA 2OV6A 5LXTA 1Q17A 1KKLA 5FUVA 5FPYA 4UMVA 1JDBC 3I39X 3LUHA 3PC8A 5IEBA 4CG0A 4F3RA 1WMEA 2JGAA 1GGJA 2AF4C 3F9RA 1N32B 4HQLA 1ETUA 3AFOA 3CHYA 3PJGA 2X7HA 2M6RA 4PNZA 2BRUC 5HGXA 1P4AA 3HABA 2ATEA 4S0XA 1T6BY 4CT4B 1PGJA 4ZCSA 1FLDA 3OZIA 4BNYA 2WPNA 1NTRA 5JRDS 3T3NA 1J6UA 4JI8B 4O4JB 1HLPA 1M2NA 1WNTA 5HIJA 4DG8A 2UYQA 4ZDWA 1LSSA 4FFSA 2Q21A 3IAUA 2FQ1A 4X93A 3UIEA 4FMPA 1WP9A 3RI3A 1AKYA 2XYGA 4F4DA 1KQFA 2INGX 3NAQA 3DOJA 2GRJA 3HB5X 3B6EA 4U5XA 1AZWA 1QE3A 4R98A 2AXPA 2R66A 3D5EA 4P32A 1SXJB 4TOIA 4OYYA 4RZ2A 3Q72A 4E5KA 1KOFA 2R4TA 2R1VB 2KQUA 4US0R 1ZD5A 1JYEA 2I6QA 3UK2A 1JVSA 2EHDA 1L3BA 1BA2A 1Q1BA 2ZPUA 3MSCA 4BVHA 5A6VA 3BMQB 1UINA 1NVKA 1CF4A 4OQXA 3GPIA 3T7KA 1OTXA 2H1VA 2VJAA 5ENDA 1T1JA 3N86A 2ZITA 5IH3A 1E6UA 2AK2A 4R2WA 1G60A 4DDMA 1A9XB 4E08A 4X95A 2QAGC 1SVSA 1ZH8A 3AM5A 3IMFA 2D3WA 3QSYA 3PFBA 1BDJA 1RP1A 4WXYB 1Z4MA 3CH7A 5DH9A 5TC4A 4KREA 2GVDC 4N5NA 3L1JA 1KY4A 1VFNA 1IEXA 3CUKA 4P3PA 1XE3A 4MMZB 5KJCA 1NBAA 4ZU6X 3JSAA 3QXJA 4RK1A 1JGTA 3EC7A 1W52X 1NBOA 3H86A 3DP7A 4PYRA 3DH0A 3UTDA 4KQ1A 1BXRA 2MU1A 3VKWA 3QKWA 4N0MA 3VO1A 1DUSA 4ZA2A 3KFVA 1NXWA 4YAJA 1ISRA 3R77A 3M5CA 4G1VA 1OV6A 3AC0A 4B79A 2J3IA 5KQMA 1DU4A 3C6XA 4HUQA 2FZLA 4O1HA 1WUYA 3WBKA 2YIJA 1D8TA 3QWBA 2QN1A 4FHDA 1K0FA 1RZUA 1SCDA 1Q2XA 1V3TA 1EGVB 1Q21A 1VKOA 1GU0A 1U0JA 1ZSNA 4HAOA 4INOA 4G0VA 3KZXA 3RTCA 5DYWA 1RM3A 2VATA 3ESBA 1KF0A 2QUKA 2ODNA 2PNFA 1WHTB 4M0CA 4PYIA 2Q99A 5AKXA 4I3HA 4JI5B 2RHOA 1P2FA 3BQNB 3VDQA 1JAZA 1UXGA 3OD1A 1XA4A 3AT1A 5KOYA 1CNMA 5AVQA 4XLLA 3JVEA 4IUCS 2XMGA 4KEAA 2QMUA 3SHVA 3PDWA 1FTGA 1Q7RA 4YRGA 4OQQA 4OSEA 3DZHA 5A4KA 3CINA 2UYCA 5F9FA 2P9HA 1KBQA 4ZQBA 5E6RB 3EF0A 3MAJA 4OFWA 3JYOA 4D8YA 2V6IA 4WNAA 4X94A 5B37A 4LPSA 4QVIA 3FD8A 1T9DA 2VCYA 3OX4A 1J8YF 4PZLA 3ZVNA 5JLAA 3KQVA 2BGKA 2C1EA 2QG6A 2XMZA 2O8DA 1JB9A 1CJBA 1QXSA 221PA 4EW2A 4HD8A 4JA0A 3PR2B 4RO0A 1KI9A 2G9UA 4W99A 3U3JA 3WB1A 1CNFA 1K8YB 2J9FA 1EUCB 1H6CA 4U7JA 4TVSA 2X4GA 1E1LA 3RC3A 2ENUA 1W85A 2JFVA 2R6GA 4HNTA 2PSEA 5JJKA 5BRAA 4BNMA 3W6ZA 5JXJA 1UDCA 5FPHA 1YTLA 4GXTA 4EB8A 2OP0A 3HKBB 4J0KA 2YQZA 4MS1B 2BBOA 1JEEA 2JEZA 2Q6IA 2YJTD 5T6BA 2WUDA 1CDDA 2GK7A 4H6VA 5FBKA 2B1QA 3V33A 1EJBA 3HDJA 1IWPB 2PM8A 3TBKA 2WAYA 1RPNA 5D84A 4LVOA 3DZCA 1BGXT 2QL9A 1AQUA 1GZSA 2C3PA 5ALQA 2UV8A 3WDMA 4GOMD 3IIIA 1DAFA 1GL7A 1W29A 4AMVA 2XJ4A 3W05A 1VL1A 5BXYA 5JEDA 1VIMA 1ZJ5A 2VT2A 1IC6A 2H54A 1U65A 3DBHA 1N7JA 3EGCA 3MMPA 3WI7A 2PL5A 4HWTA 1UR5A 1X8XA 3BFKA 5IJ0A 2A92A 3ZQJA 4QRIA 4M36A 4RDIA 1I01A 1K3TA 3FMPB 4OJTA 3U3ZA 4B6RA 3CURA 4G9EA 4EZBA 4Z54A 5AW1A 2AN1A 1E3MA 4PNEA 3CG4A 1I8TA 4NOJA 5DWVA 3DCNA 3GDFA 5L9AA 5BVGA 5F12A 1XZLA 3LDUA 4QQFA 3UATA 1WX1A 1SG9A 1Z6YA 4RX1A 4WPGA 2D5BA 1GFWA 3QXSA 2YWEA 4KFTA 1Z2OX 2VJYA 5EY5B 4AY2A 3JAKA 1GRQA 3THXB 2JGEA 2OMKA 3RH0A 4WZBB 3WL4A 5CXUA 2GPJA 3CE6A 2FN7A 1BG6A 1U4OA 1XCJA 3I23A 4YDHB 4OQMA 1QG6A 1SUFA 3HDGA 4KWHA 1W30A 3M9WA 4G9GA 1BX1A 1N7GA 2YWJA 1GUZA 3KR0A 3LLSA 4KVGA 4P7BA 4ZOLF 5ES3A 5T4HA 2QYTA 3V1UA 4BN0A 5JEEA 3P97A 2GM9A 2GBLA 1NYLA 4NH4A 3GRZA 1JAIA 1U1GA 1M8JA 2G7MC 3OQMA 4F93B 2H0QA 1NLMA 3TNFA 5IT0A 1N6NA 3PP8A 4C0BA 2ZW9A 3ORFA 5C7LO 4A36A 4F3TA 2REOA 3KOXA 2R8PA 4OFZA 2IVFA 4RS3A 3EB9A 5DGCA 1DTWA 1P7ZA 2Q1SA 1GU7A 4CR7A 2K7FA 3B1ZA 1AHIA 3QVKA 3K3PA 4I3FA 4A1OA 1HNNA 4MQ4A 3ZOZA 4W8OA 1XO1A 2BY4A 3AV0B 3OZCA 4KR6A 3OY7A 5FADA 1Y37A 1RWQA 1Z7BA 3CVXA 1GPDG 2PZLA 3HGTA 4RLHA 2Z9BA 3OKCA 2E37A 4JT4A 5K09A 3H6HA 3I62A 1WZUA 3IMEA 2F00A 4QYTA 4XD7D 1TUIA 2D5IA 4TZKA 1TEHA 4XIJA 1G5QA 4NG5A 1Z5VA 2PQ0A 3A9RA 3SVTA 4NV1A 4X8HA 3O8BA 4LXQA 4B3JA 2WK1A 1DXHA 1MDFA 1WHSB 3EQ8A 1R0RE 3H3JA 4NYJR 4OP3A 4G67A 5EKUA 4F11A 5C8YF 3FDXA 3UH1A 2G1KA 3B12A 2VP9A 1XU4A 2WTEA 4IVQA 5FNVA 4B33A 4CF6A 5A0TA 3KDSE 5IJ9B 4ABTA 4Y6OA 4RXMA 1ECCA 1XTTA 1DAGA 4E22A 1Z2EA 3HJUA 1PUIA 5ALWA 2FNAA 2QTZA 3BRSA 3FHLA 4FFMA 1UOOA 3ROXA 3UUFA 1RYFA 1YFKA 1BOFA 2PS3A 3CMCO 3EHDA 4IMPA 1I30A 1E2KA 2E7ZA 2PUWA 3H2KA 4HUJA 4F4HA 5D1HA 5JS1A 1XP5A 1EBFA 1DSSG 3B36A 2HNBA 2EFEB 3ZK9A 1VA4A 3ZN2A 2G3YA 1P4GA 4MEBA 5DLPA 5LQMA 1G7SA 2O3QA 4MUXA 2A86A 4N0PA 3PXUA 5J40A 3GZNB 4JB3A 1YB2A 4QLBA 4FFOA 4D99A 3SSMA 1WXDA 4P31A 3ZWQA 2RD2A 4LTNA 4MPRA 2EW8A 1HMYA 3L0CA 4CEHA 1I2CA 3DKVA 1CDEA 4X8LA 1BU5A 1X9HA 1INLA 1FSZA 1R9GA 4HAIA 3ZWXA 1OFUX 2WP0A 2R87A 3K2QA 3P2KA 4UFOA 1GG2A 1LLFA 3OKAA 5J2TA 4DT1B 2OQIA 1AK2A 5LMNB 3NONA 1CJSA 4G24A 5EJMA 4RTKA 3OP1A 3FDZA 1KJ9A 1GLVA 2VSYA 1VG1A 4A82A 4JYCA 3Q4GA 1FTYA 1PYOA 1SCNE 3F90A 1B8OA 3MWEA 3AF3A 1THMA 2QVCA 2ZUCA 5AR1A 3COJA 1P1RA 3FZNA 3TRIA 1WZEA 3DNPA 1WZNA 3VZPA 4DR3B 4MHTA 2CC2A 1H5NA 1T3HA 3BGIA 4RD3A 4OJKA 4DV0B 3ZR4B 2NW6A 1II0A 4D57A 4DMMA 5EZQA 3E53A 1CUCA 1DQRA 1HEIA 4GG1A 3O8OB 3M1LA 4JJ6A 4JQCA 3KLNA 4GVPA 1G17A 1JAHA 4JB8A 2IPLA 3ZV3A 2B4KA 5GTDA 2YQ5A 2ZI3A 4RE5A 3JRWA 4MNTA 3WWZA 3R3ZA 1ZI6A 5EYPB 3UW1A 3G89A 1YGYA 2C98A 3QTLA 1IJKA 1PKEA 1D1TA 4FGSA 3SS9X 4EBBA 1RACA 2B8NA 4QQNA 1KO8A 3OEHD 1UBMS 2W4QA 2A33A 4WOKA 3W8EA 4OAQA 4EFKA 3JW8A 2ZUEA 2BP7A 2ZWPA 1N8SA 1A82A 2BSQA 3R7BA 1HE3A 4G0MA 4YBZA 2HA2A 1G42A 4YJGA 5JDIC 1J5EB 2JAHA 1MO2A 3VR4H 2CFSA 5HVNA 5KNDH 4GMFA 3EGXB 1UM8A 4RHUA 1N0VC 1O08