1Z0FA

Gdp-bound rab14 gtpase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
167
Chain Sequence
NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAB14, member RAS oncogene family
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 58
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z0fA01
3SQWA 4PO9A 3JVVA 1KSGA 2ZSDA 2W2TA 3GLFA 3EZ2A 1G3UA 1BMFD 2C96A 2QMOA 1Z6GA 2ZI3A 3EC1A 4A8JB 4EPWA 2CHGA 2YOGA 1DBSA 4EPYA 2CCKA 2FX3A 1Z2AA 3MAAC 4M1OA 4KBGA 1G7CA 4Q9IA 2I4IA 1LY1A 3KTAB 4TZ0A 1AGRA 1U0LA 4Z8XA 3C14C 1P62B 1W48A 4AY2A 4I1OA 1YR7A 2ZJ2A 1ZUIA 3ZYCA 1XD8A 3MUFA 1NVVR 2P67A 4AURA 1E1QA 2XXAA 3AKYA 2C9YA 2J9RA 4I81A 2R62A 4Q02A 1E9SA 3TKLA 1UKEA 3GFOA 3H4MA 2HJVA 3VU9B 4TL8A 1LV7A 1W46A 1FNMA 5FR2A 2H16A 2BBOA 2MSCB 2KB0A 5TV2A 821PA 2VP5A 4PHGA 3RRNA 2DYKA 5J4LA 4LYFA 4CEHA 2EFDB 3RC3A 4JLMA 1WMSA 4OHXA 1JJ7A 3E5HA 4II7A 1IY2A 1G6OA 2JEOA 2AD1A 2BVNA 4Q19A 3DDCA 2BDTA 1XCGB 2IT1A 1XFAA 2ZJOA 2CJWB 1LTQA 3QXXA 1IOZA 1OFUX 3TJZA 2P2LA 1UEIA 4C3ZA 2PCLA 3L43A 4NDZA 4RCYA 3AVVA 2EYUA 4QGGA 3VKHA 1WB9A 2XZLA 1E6CA 1G4AE 2Q3MA 1IONA 4F4IA 4IXMA 4AKGA 4QGHA 4GL2A 3HDTA 4IDHA 5A5GA 2NO9A 2XNDD 5JRZA 1OE0A 1IJFA 3FTQA 5DHFA 3LDAA 4LV5B 2V7QA 1S1CA 4LJAA 2V1XA 2J0QA 1RPZA 2YKGA 5FL7A 1L4YA 3OEHA 4H1VA 4TYQA 5HKKA 3BD9A 1SQ5A 3DKPA 2QP4A 2GXUA 2IXEA 5CITA 2IEYA 2WJHA 3CO5A 1XD9A 5JMTA 3OEED 4M9ZA 5LDDC 2QRNA 3GLHE 4HI0E 2P6NA 2QNRA 3U7HB 3VR6A 5TMPA 3L0PA 4OHVA 3X2SA 4C0BA 2QRZA 2X77A 1F2TB 2QMEA 3DEFA 3Q5EA 3ZS8A 1EESA 1T9HA 2YWGA 3QEOA 1J2JA 2RGBA 3H86A 1MO5A 2F1IA 1PLJA 3KXIA 3DOEA 5K8IA 1CIPA 3IQWA 2D74A 2ZEJA 3V00A 3C4JA 4GP7A 4BGDA 3CPJB 2O8BB 4LOAA 5DI3B 1H8EA 5FOSA 1AK2A 4YONB 3UG7A 2VBCA 2NZJA 3KFVA 1IN8A 5A4JA 4TYPA 4DUGD 1RW4A 4OK6A 1XEXA 3KDSE 2ZYWX 3NKVA 3AF3A 1G8GA 1Z6YA 3SJAA 4OYHA 2HLDD 4DCUA 1RRGA 2ZS7A 2XOKD 4JVMA 4MYTA 2ZR7A 4XOIA 4A15A 2KWIA 4RVCA 1HURA 2G1KA 3ADBA 1DAKA 4BFZA 4B74A 5FPTA 1KI3A 2CE7A 5E7MA 4URWR 1OH7A 1W44A 4M9XA 1Z3IX 3ZVMA 3U4QA 3LD9A 4KLZA 2QBYA 4OHWA 2J7KA 2JDIA 4UXIA 5FBQB 4LGMA 1QHSA 1DS6A 2FF7A 2G0TA 2E1RA 2V7QD 4JLNA 1ETUA 3SNHA 3U3RA 2JJ2A 4Q4HB 3HP1A 3I72A 4KVAA 1TF2A 1D9XA 1SXJC 5FBWB 1ZM3A 1W36C 2J59A 2BEKA 3BBPA 3CH4B 3RLFA 2AXNA 2IK8A 4DLYA 4F4CA 2FEMA 1NKTA 4ZKDA 3SHFA 3FDIA 4KCGA 1JJVA 3LVQE 5ANRB 3GMTA 2CNWA 1MRSA 1M1YE 3THXB 3M4YA 1LFDB 1XMVA 2REBA 5FTNA 1ZC3A 1II8B 4JBYA 4W5WA 4B47A 4DLSA 2IHBA 4LYHA 1Z22A 3QXSA 1D6JA 3WNDA 1F2TA 2OILA 2EYQA 1Q44A 2A5JA 4JLBA 3RSOA 5EE9A 4E22A 4IHQA 4M0LA 4YMVA 2B8WA 3IBGA 3LBIA 1ZD1A 2WIBA 5IRCD 4RD1A 2ZJBA 4B2PA 2B92A 3BJIC 3TR5A 4V02A 1G7TA 2J0UB 1T0HB 3BB3A 1OPXA 1X3SA 3GJ3A 3X1DA 2GWHA 4B2IA 4BASA 4C0JA 3BS4A 4M1SA 2VIIA 2VP4A 3NHAA 2J7PA 1WP9A 4YMUA 4QKQA 1KGDA 1KY2A 1TEXA 1R2QA 4A92A 4WAUA 1P9WA 1F3OA 3PEYA 4AG5A 3T15A 1XMJA 2ZS8A 3CH5A 3L0OA 4Q18A 2GCPA 1NN3A 1XF9A 4F7WA 1E2MA 1KSFX 5FTMA 4JKYA 4B35A 2X19A 1A5TA 4IVQA 1QVAA 3M1IA 4OI2A 1N25A 1KI6B 4TYWA 2W6ID 1VG9B 2JLUA 5DIFA 4TLDA 1M7GA 1P72A 3KB2A 2YV5A 4B73A 3SFZA 3TNFA 4ESVA 2D06A 3IPYA 1FNNA 2RKOA 5IK2D 1E2LA 4HZIA 2QQ0A 1TMKA 4Q00A 4D81A 5BXQC 1OW3B 5IT5A 1MT0A 2GJSA 3NH9A 3CPHA 1NKSA 4P32A 4AK9A 3MD0A 3UIEA 2BJVA 2JGNA 4CT4B 4LBWA 2V55B 4QBFA 2CK3A 2LKCA 4HUQB 4MKHA 4RZ2A 2HF8A 3BH7A 4EQ6A 1A1VA 2WOJA 4HDQB 4IDNA 4V0LA 1NVXQ 3M0EA 2JJ1D 3AEZA 2C9CA 3W3AA 4MGYR 1JAIA 1LS1A 1SVSA 2IUTA 4CDGA 1NMYA 1DAIA 2BBSA 2QPAA 4HEJA 4RKFA 3JVUA 1JALA 1JPNA 1JXOA 4S35A 4U7DA 4Q7KA 3W3ZB 2WWGA 1Z06A 1N6RA 4A8JA 4B3FX 2RGNC 1ELOA 2VP9A 2PJZA 2RHDA 4M1TA 1G41A 4UKDA 5JEDA 2IS2A 2ZVQX 3UATA 3QVUA 4EPVA 2CLCX 4LYAA 4FCWA 4PHHA 5DH9A 1AKYA 2ZRGA 1Z47A 2JLRA 3UK6A 1JBKA 1XZQA 3AP1A 3KX2A 4HDCA 4ACAA 5B57C 1N0WA 4R7ZA 3DPUA 3QKSB 1KY3A 2YINC 4EFNA 1AIPA 3VR3A 2OXRA 1E2PA 2BM1A 2HYIC 2IF2A 1DADA 2RH5A 5AK0A 1CR2A 2ZI5A 5CM9C 4LK2A 4HUTA 2D62A 2GZHA 4AYXA 2PEYA 2P65A 2H7VA 1M6NA 1MH1A 5KSYA 5L3QA 2WVJA 4DDWA 3Q7QA 2BBTA 2CXXA 3EPLA 3VHLB 2PL3A 1Q1EA 1ZU5A 1HQYE 2H18A 2ZUDA 3CX8A 1FZQA 4CGZA 4QBIA 5BYKA 4N1AA 1XTRA 4LJ6A 3I62A 1JR6A 2CHVA 3ND9A 1G5PA 1DAMA 2ZI6A 1HT2E 3DMDA 1F6BA 1CJVC 4HB2A 4V0NA 4TLAA 1WF3A 5JJKA 1Z63A 4PZZA 4LUCA 2F43A 4HUQA 3T61A 2CL6X 1NI3A 3SJBA 1OH6A 2NTYC 3TMKA 1TPZA 1R8QA 4M2LA 1HV8A 2GK7A 4QJ5A 2VTKA 2DFKB 5KTYA 4D0NA 4NYJQ 3WMEA 3KXKA 4URUR 2XTZA 3WRYC 5CIWA 2DWPA 2ZRAA 4NYIQ 1IY0A 3IHLA 3AF0A 3NH6A 1A2KC 1FQJA 1ZNZA 2O8EA 2IXFA 1NLZA 1W2GA 5BN4A 1KO4A 4DCTA 1MKYA 1F60A 2DWQA 2OAQ1 1CKEA 4ITRC 3BB4A 4BZXA 3FMFA 2X2FA 2QA5A 5AWFC 1KNQA 2A30A 1GL7A 1XPOA 1OYWA 2UKDA 4G3XA 1WCV1 3KQLA 2ZQ5A 4FMDB 2W6JA 3OE7A 3UG6A 4US0R 1SVWA 1IQPA 3H84A 1G8PA 1NIPA 4W7SA 4MH0R 1WE2A 4RCZA 1CU1A 4P4UA 3Q72A 4XTRA 2WWHA 4C7OA 1HUQA 4MA4A 4TN1A 1VG8A 1NNEA 1KAOA 1WQ1R 4A9AA 1QHHA 3FKSD 4DBLC 1RFLA 4Q7LA 4W5HA 2WKPA 2LKDA 4NTZA 3UPUA 3CBQA 2G9NA 5GVRA 3GLGE 1X1RA 1AM4D 2YHSA 4IRUB 5FUXA 3WP0A 1P2VA 2ZITA 4JT2A 3O8CA 4KYIB 2GCOA 3BB1A 4KITB 1QHIA 2ZRLA 1ZD8A 5JBQA 221PA 3A4NA 3WBJA 3CNNA 3DHWC 3EIQA 4OL0A 3WBKA 4B43A 5H8WA 3QPWA 1ZNWA 3ICEA 2WKQA 1WBDA 1MV5A 2OCAA 5EXSA 1Z07A 2VP0A 2EFEB 4XIGS 3PXGA 1WA5A 3SC3A 1T6NA 4GPTA 3W9YA 5F9HA 1SHZA 4KLNA 5CLLA 3ZVRA 3GLIE 2PBRA 1JXMA 2Z4SA 3UMRA 1D9ZA 3AKEA 2WV9A 4KV9A 2CMKA 2V8OA 4KFTA 3LW7A 1T4GA 1S0UA 3GFTA 3FGNA 5D3MB 1EX6A 3OESA 5JJIA 4TMVA 4D82A 2D4HA 2GJ9A 2GZAA 3MJHA 2XITA 3MMPA 1ZM7A 1E0JA 3Q85A 2L0XA 1ZW6A 2GEUA 5IF9A 1BYIA 4F38A 1AS0A 4ERNA 4AWXA 1VCMA 3MCAA 2X8AA 4M21A 4NCJA 1LVGA 1OIXA 2IA5A 4RJLA 1Z29A 3BFXA 4TSFA 1KJWA 2VF7A 2V6IA 3QKUA 1DG3A 4GZMA 3CF0A 1XEXB 4PAOA 3EARA 2XB4A 2HV8A 5KDOA 3GLIA 4PPFA 1M74A 1N6KA 3EXAA 1KZGB 4DB4A 1G1MA 3CWQA 1D2NA 1OB5A 2NOAA 3SI7A 3TLXA 4MRSA 1T8TA 1OXUA 5EUMA 4EUNA 4B33A 1IXRC 2XJ4A 2YC2C 3U5ZB 1IXSB 2F1HA 5J4VA 4Q66C 5LB4A 4KHZA 1LB1B 3VTKA 4MUAA 2Z6VA 1SVOA 4TQAA 1GNPA 2PX0A 3DM5A 2KJQA 3GJ7A 4R2IA 2D2EA 1UF9A 1VG0B 4JLOA 4B71A 3JZMA 5LD2B 4AKHA 3U3JA 3PUVA 1VCIA 1FP6A 4A1FA 4YXWD 1CJTC 2ORIA 4AD8A 4MDFA 2CLSA 5DYIA 5FPYA 4EDHA 4JYBA 4L4UA 1CR1A 4HLUC 4PAMA 2PH1A 1ZINA 2N1BA 2ZSEA 3CB4A 2CBZA 1E99A 5LPNA 2XNSA 1GG2A 2A5GA 2OCBA 1UM8A 5CB6A 2W83A 5JI2E 2RGAA 1CXZA 3ZZUA 4BFXA 4KSBA 1CLUA 2E87A 3QF7A 4RSGA 2XZPA 4AYWA 5JFGA 2IYYA 1G8HA 4QL3A 3SN6A 3SDZA 1NLYA 1X86B 3P27A 5FTJA 1NVUQ 3TR0A 2O8FA 2VEDA 1KYIA 5AJVB 1MABA 2ODEA 4TL7A 4MRRA 1R8SA 1N0UA 1QZXA 1QHYA 2ODBA 4Q1AA 3GFPA 1W0JD 2JASA 2I1QA 1YZLA 4Q7JB 3EAQA 3CONA 2W6IA 4LHXA 4JLJA 1JQLB 2RGCA 3NBZC 2C78A 4RD4A 3SS8A 2WAXA 1F5NA 1XPRA 2N42A 1TADA 1AS3A 2NZ8A 1X8JA 4X8OA 3UMFA 4FMCB 1SULA 2XB2A 2PLFA 4Q21A 2AFIE 3SYKA 4PC3A 5F2EA 3VKWA 4E5UA 4MRPA 1CS4C 2CL7X 4I99A 2CCJA 4P3YA 3Q8XB 1E2FA 1SHKA 4XJXA 5GJBA 4TSFD 2F1JA 1JR3A 2GZDA 3TK1A 2WWYA 1E0KA 1N3BA 2J3EA 4BRUA 4CEIA 3GLIB 1OKKA 3GEHA 4RFSB 3U6BA 3K09A 5LD2C 4LBZA 2EU8A 1CEEA 1EK0A 1Q1BA 3QE0A 4BEJA 2OSBA 1Z0KA 4RD6A 5GJVC 1C1YA 1O87A 3HPRA 2JCSA 2DBYA 4ZCMA 1GL9B 4HLCA 4PHTA 3CNLA 2J45A 1SXJD 1XTSA 3CRRA 3GJXC 4TMXA 5EXPA 1KK0A 2V54A 3ONWA 2A7QA 2P0EA 3QI2A 4A0HA 1N5IA 1NSTA 5TY0A 2GNOA 4OBEA 3IIKA 3PEWA 2XTMA 5E3HA 1ZMXA 3BC1A 5DGXA 3CR8A 1FTNA 3GLFB 1GVNB 4PC6A 3A1WA 4IVPA 1OXTA 2AFHE 4MRVA 4R2HA 3UWOA 2PCJA 4Q01A 4CEIB 2Z43A 5DN6A 1Z0DA 3EZ9A 3EPJA 3K53A 4UJ5A 2ZXUA 4WZAE 2C03A 1E1RD 1WRBA 4FWIB 1UDWA 4LJ5A 3RNLA 2Q9AA 3FFBA 1N6IA 1QVRA 1E2KA 4MITA 4KVGA 2O8DA 1KSJA 4QC2A 3B1ZA 1II8A 4Z8YA 5EP1A 2EFCB 3BERA 3RS7A 1UFQA 3THXA 721PA 2QQEA 4DCVA 4EJSA 3V4RA 1GM5A 2ZPTX 3G82C 2NPIA 4JL8A 4MQBA 1T0JB 3KKPA 3W34A 3VR5A 4AIIA 3VKGA 2NQ2C 3GJ0A 1S3GA 1KKMA 1VCOA 5B2ZA 1KI4A 1EX7A 2AKAB 1EFHA 3TUJC 4WVFA 3W8RA 2QG6A 1DO0A 2A5DA 3CNOA 4QGAA 1NG9A 4AI6A 4DT1A 4ARZB 4B3DA 2VHJA 4Y0AA 2HLDA 4OHZA 1HYQA 3A58B 5FPSA 1RZ3A 4BLQA 5DNYB 1HY3A 1Q1QA 3L8YA 4P31A 3IBYA 4G1UC 5D3MA 1DPFA 1ZBDA 2B21A 4OK5A 3T5DA 1G8FA 2RMKA 2H57A 4PQYA 2FH5B 1OH8A 1L2TA 3B9PA 3C8UA 1AGPA 3KJEA 2GESA 3UKDA 4KJZA 3U3MA 1GRRA 1IHUA 1TAGA 2BIFA 3AB3A 4UJ3A 1OIVA 4GT1A 5EJEA 3T06B 2FFAA 3CPEA 2AR7A 3E2IA 2ATXA 1GILA 4HLUA 1RJ9B 3B1XA 1XEWX 2FOLA 4B76A 1G291 1OXSC 1YQTA 2CNWD 1G3QA 4DLTA 2JLXA 3ZD7A 1G21E 1VMAA 3T35A 3GLGA 4DDUA 5C4MA 1FUUA 1Z6AA 3R20A 4RZUA 4C4PA 3NDPA 2IWHA 3B2EA 2Q21A 5L3RA 1OYYA 1TF5A 4KYUA 3UANA 1BOFA 1X8KA 3K0AA 2OZEA 4TMWA 2B6HA 1J70A 2GA8A 2P3SA 1HTWA 4HAZA 5HCIA 5AJZA 2F1RA 2CE2X 3TVTA 2FPMA 4QFMA 4JIMA 1TQ2A 1E2IA 2D7CA 2QPTA 3DZDA 3KTAA 4N3NA 2QM7A 5KNCA 5EZ5A 1KJYA 4RD2A 5C18A 3IHWA 1G3RA 4NU0A 4RFVA 3L0IB 2E9SA 3MGCA 5JLJA 4TQUS 2Z0MA 2RB4A 2GXQA 3OIUA 2ODWA 4TWZA 3ZDQA 1E2NA 5JHGB 4BLPA 4TTRA 1KTVA 2QY9A 3GCGA 4UXHA 2MSEB 4U02A 3OAAA 4LDJA 3GLGB 2FJUA 3K0EA 4KFRA 3H2YA 1CJKC 4GBMA 4JYCA 4Q03A 1K6MA 3FFAA 2F3TA 3RSLA 4TT3D 2IYWA 4ZPXA 2J0VA 4I4LA 4L9SA 3NC1C 1OHHD 2FFHA 4BLRA 3RANA 1TUEA 1Z6XA 3K9NA 4ON9A 3KKMA 1CJUC 1UBFA 3OEHD 2NGRA 1XXHA 3U3OA 3WNBA 3VNVA 2WSSD 3CX6A 4PSAA 3O8RA 2GCOB 4PQFA 2VF8A 3QG1A 4JLVA 2IX3A 1OXXK 1BIFA 1KOFA 2FN4A 4Q9JA 3W8NA 5EP3A 3VHXA 3AV0B 2F55A 1IAQA 1Z0AA 4JBWA 2IHYA 1YZKA 4TYYA 2KBFA 3AQ4A 2GJ8A 1VG1A 5G40A 2PMKA 2WHXA 4MGKR 1MRNA 5J40A 1KJZA 1NL3A 1COWA 4U5XA 4ZDIA 2ZTSA 3T5GA 1T91A 5CK4A 2QENA 4BFVA 4KFSA 1P9NA 3EWAA 4KODA 5AUOB 1NLFA 2AK3A 4DLUA 2R6CA 1P3JA 5KUTA 1XCMA 5CYOA 4HATA 4QHTA 1NG1A 1G9XA 3WHLA 2GJAA 4AG6A 1SKYE 1F48A 5FR1A 1FQKA 4C0HA 4C0SA 2O8CA 3RWMB 4U00A 1IN7A 3EPHA 3RS5A 5EP2A 1KDTA 4YQFA 1LF0A 2HXYA 4NBSA 3SQXA 5J4HA 1AS2A 3D3QA 4TQ9A 3D31A 2P5TB 1NMXA 1J99A 2FG5A 3V9PA 3U3KA 2GK6A 3RVBA 1DARA 4BZPA 2CCGA 2ZYUX 3N2IA 3ND8A 3EWSA 2O8EB 1W49A 2BHRA 3QBVA 2GAAA 1KI9A 2V4ZA 2IXGA 4UXJA 3QG5A 4TTQA 2GBLC 4IOLA 2VHUA 2PX3A 3KUCA 3PUZA 1ZAKA 2MMGA 3GJ4A 2VH5R 2TMKA 2ZETA 4EPRA 1OSNA 2Z4RA 3TIFA 1AQYA 1KO8A 4FINA 4LBVA 1B23P 1A2BA 2WSSA 5KNBA 2VP6A 3OZXA 2GETA 2ZUBA 4K46A 1ONBA 2RCNA 3AKDA 2WM9B 3WXMA 1RVDA 5FOWA 2AHOA 2GXSA 5KSOA 1E2EA 4PHFA 4JVLA 4TT3A 1U0HC 1WBBA 3IILA 2FWRA 3HU1A 2FSIA 1U0JA 3QXHA 4GI7A 1DELA 1NVVQ 3SYLA 4D2IA 2VL7A 5DYGA 4ACBA 5DI9A 3RRZA 4QGFA 4POAA 3VFDA 3IKJA 3ADDA 5SZHB 3PUXA 2C8VA 1MO3A 4D25A 4HDOB 2BV3A 2GEVA 4EQ6B 2AD5A 1TL7C 3ZD6A 3EASA 4EJSB 1N6OA 3B1YA 5HE8A 1N0VC 5JWRA 2ZRMA 4Q4JB 4LHYA 1KMHA 2BM0A 3NEYA 2IYXA 3QUSA 2ZUCA 1GRNA 4Q4AB 1E2DA 2QAGA 4YMSA 4GOJA 2R6GA 2IW3A 4DSNA 3GEEA 4PX9A 2SHKA 1J90A 3HU3A 1YRAA 3U2QA 3IO3A 3PG5A 2H8KA 1IJEA 3EA0A 1R5NA 3KXLA 1VTKA 1G4UR 2B7BA 1W7AA 2OV2A 2OHFA 3ZQ6A 4DC9A 1S8FA 1P7CA 2JAQA 2KE5A 3CRQA 4EIWA 3N2EA 5D3QA 5BN5A 3LQQA 1H65A 2ANBA 3F0TA 1QG4A 4IDQA 4AKEA 5JSZA 3IEVA 2GVDC 3CX7A 1SXJB 4G5RA 1W36B 3KKNA 3O8DA 3PEUA 1FX0A 2O52A 3H0KA 4HZUB 4D4JA 1FUKA 3MG9A 4OI0A 5KYKA 1T3SA 4GMDA 3I73A 3C15C 3BXZA 4MKFA 3B1VA 4A8JC 3ASYA 2AN9A 3BIFA 1L8QA 3MWKA 5J4KA 1BH2A 3CLVA 4X8MA 1N2CE 2OCYC 5EE3A 4RFSA 2EQBA 1VHTA 2HCJB 2VPPA 2BMEA 1CBUA 2VRWA 4IOKA 1BO6A 1NN1A 4EKDA 3I5XA 1BKDR 3TUZC 1ZUHA 1CF4A 1RRFA 4WZ6A 2OBNA 1VHLA 1KDRA 5LBIA 4MKGA 4NCIA 3QJYA 5DE3A 1K5GA 2ZAOA 1HQCA 4K81B 4EPTA 4MDEA 3QPVA 4HSEA 3K9GA 3U60B 1PVOA 3LX8A 1RRCA 4QBGB 3ZVNA 2OFXA 1XNJA 1M7BA 3DM9B 4A2WA 2ZRFA 3PIRA 1JEDA 4NKRA 3AVOA 3EZ7A 3R9WA 3QKTA 4UNNA 3NC0C 3SBDA 1XCPA 2H17A 4ZCIA 2ERXA 3QF4B 4NL4H 2CVHA 3B7GA 3DMNA 2QM8A 3VR2A 2BEJA 3CZQA 2UZIR 1U9IA 1NP6A 4XWAA 2W2XA 2ODNA 1CR4A 4K8OA 4TMKA 3TAUA 3WMGA 1OV4A 1ZC4A 3B5JA 4Z51A 1DEKA 3B9QA 1DAFA 2YOHA 1LF5A 5FUYA 3OIWA 3KKOA 4IEIA 1RKBA 1AQUA 2XAUA 4Q1BA 4DJTA 2Q9CA 2QI9C 3FKQA 3U44A 2QAJA 1DTSA 3NEJA 4IFEA 1R6BX 1FMLA 1EFUA 4DLWA 2HDNB 4NYMQ 3DKVA 3Q3JB 4LZZA 1CULC 5JWOA 4TL6A 1CJMA 1E98A 3NBXX 2G77B 5CB8A 2BCJQ 1WXQA 3NHBA 4LC0A 2D3WA 4CEHB 2DFTA 4GSYA 4LY6A 3CW2A 3JZAA 1KIMA 2ZJYA 4QHSA 1TF7A 2OE2A 2IS6A 4G0NA 4F91B 2QORA 4DCNA 4C2UA 2R8RA 1OKKD 4B3BA 3LWNA 4Q47A 4RY2A 3R8FA 3LBHA 2GILA 1SXJE 2WJJA 1PUIA 3L2OB 5M04A 2CK3D 1I2DA 5CLQA 1FFHA 2IYVA 3C41J 4FN5A 4O3MA 4GMXA 4DIDA 4E09A 4WBSA 2EFHB 1ZCAA 4Q9HA 1NBMD 4HLDA 1U8YA 2FZLA 2GEDA 2QMUA 2QBYB 4B6FA 1FL9A 2WWFA 4OJKA 3SR0A 2ZIAA 1G16A 2J87A 4PC7A 3VR1A 2FDCA 4Q1EA 3CKLA 2JLYA 4R9UC 2P6UA 1Z8FA 3K70D 1G5TA 3BH0A 5F9FA 2O5VA 2ZYTX 3QF4A 1V43A 1KNXA 5CYPA 2WJVA 5DISB 4A6PA 1TTTA 1FTSA 2Z5FA 2VP2A 3K1JA 4MGZR 4RKEA 5KOYA 4XVQA 1JEEA 1KO5A 1US8B 2W0SA 5DN6D 2NIPA 4IJMA 2NPFA 5C46F 1M8PA 3OHMA 2F7SA 1XDBA 4DSTA 3SYNA 5KHOC 3A1SA 1KK1A 4R71A 1HH4A 2ZJ5A 1W0KD 1KAGA 1NIJA 2CJWA 4JL6A 2BCGY 1HA3A 5GJWC 1E9CA 4A0FA 3UMSA 1E2GA 5B30A 2DWOA 1Z08A 4HYYA 2VHTA 1G6HA 1COWD 2FNAA 2A78A 5JS7A 5JZVA 4N0EA 3KQHA 1XU4A 3HR8A 4NONA 1OT3A 3FHOA 4NYMR 1E1RA 3GEIA 4BECA 4CRWB 1XEWY 1A82A 4D4MA 3GJ6A 4XH9B 3QQ5A 1Q57A 4OQMA 1U99A 4J0QA 4D0GA 1KZ7B 1IM2A 3TW8B 4BFWA 2VSFA 4A82A 1Y3AA 2A5YB 3NG1A 4C7OB 1EFRD 2HXSA 5A0FA 3CRW1 2GAOA 2ZE7A 1LS6A 3H1TA 4ZDJA 1G3MA 3EIEA 1TNDA 2GCNA 3PEVA 1IXZA 1X1SA 2IYUA 3PV0A 4PPNA 2VQSA 2J7PD 3CF2A 1P61B 3CWZA 5EUQB 4DB2A 4QOSA 3NWJA 1UDXA 4DIEA 1U94A 1YZQA 3AVTA 1P75A 1XBTA 3KB1A 2YJTD 4TLBA 5HE9A 3AVPA 4M9SA 1Z83A 3IIMA 2HEIA 4C2TA 1IN6A 4D26A 1UKZA 1GNQA 3EIHA 3S1AB 2RGGA 4PR0A 5G53C 4GRAA 3VR4A 4BRWA 1FW6A 2RGNA 3ZIAA 1N6NA 4MYCA 3M6AA 4IOMA 3TRFA 3TVDA 1J8YF 2QPOA 3F5FA 1C4OA 5E4FA 5E7JA 3W6PA 4DXAA 5JJLA 2IYZA 5SZKB 2ZRNA 4CZ2A 4OQLA 4FCVA 1I2MA 2ZU6A 2W00A 2ECKA 5K8UA 2J41A 3W6OA 4A6XA 2ZU0C 1ZD9A 1KMHB 4LC1A 2O8CB 1UBEA 1XXHE 1UPTA 3WY9A 4Q4JA 2A3RA 2QUZA 3VX4A 2IC5A 3C5HA 4EAQA 3IIJA 1WDTA 2GRJA 1NJFA 4Z1MA 2VSOA 4JJKA 4JKIA 5L3VA 4IXNA 3TSWA 5E95A 1ZP6A 4ZCLA 4D80A 2KSQA 3TE6A 5TVKA 4DHEA 1PUJA 4HB0A 2KBEA 2P5SA 2XJ9A 5BN3A 1U8AA 4CT5A 1N5KA 4LRWA 1QHXA 1TU3A 2QMHA 3FYHA 3P20A 4I1UA 4LJ8A 4M53A 1UJ2A 1QG2A 4LHWA 5FL7D 4D4LA 1JI0A 2ZRCA 5GVSA 1EG7A 1R5OA 1XWIA 4CYMA 2GXAA 3K0AB 2CEAA 2AX4A 3OFND 1T5IA 1KSHA 5FTKA 2IYRA 5FOXA 4I1SA 4M1MA 2QTVB 2HT6A 3RABA 4DVGA 3RC8A 4M1WA 1QBKC 4JZKA 2AL7A 2DFNA 1JB1A 3LV8A 1G7RA 1XJQA 2XEXA 1E2QA 2RGXA 1E79A 2VO1A 2OO7A 1JQJC 4PO1A 4CF7A 1XJCA 2JJ8A 3I1FA 4B6EA 3FVQA 3QKRA 3AP3A 2BMJA 5KO2A 1UEJA 5FPHA 1XEFA 3PR1A 3ECCA 1PV4A 3Q9LA 5HTKA 5EXTA 4CW7A 1E4VA 2Q9BA 4NH0A 5JI3E 2WTUA 5CJ2A 1TEVA 3K70C 1U9IC 2VYFA 2Q6TA 3KJHA 4DUGA 4YMWA 3T12A 1ZNXA 4C30A 4WXRA 5C2JB 1E96A 1AJEA 4PAQA 1W2HA 2RGEA 3IO5A 4LPKA 5KSZA 1P6XA 5KPDA 5G3YA 1ZU4A 1XRJA 2ZM5A 2F43B 8OHMA 1PZNA 3PCRB 2WPDD 2IBMA 5TDHA 4LI0A 4FD2A 3TQFA 1KO7A 3RRYA 2QZ4A 2W2VA 1KI8A 3SBEA 4DT1B 4KI0A 3HYRA 3LVRE 3LXXA 4GOKA 2QEQA 4WOPA 1MR3F 1W5SA 5EE5B 4F93B 4URVR 5BWMA 5J4YA 4IW3B 4L8GA 4P4SB 4HB3A 2PZGA 2R9VA 1GWNA 3ADCA 3MRSA 3R7WB 4W9MC 1FPMA 3A36A 4TMZA 2UVQA 1P2UA 3K9HA 2QSYA 3R8CA 4JVNA 3U7EB 3R9XA 1Z6TA 4NYJR 2O8DB 1XPUA 5K8TA 2YVUA 3BK7A 5FH9A 5KSPA 3OAAD 3D8BA 3K0FA 3BOSA 3E70C 5FOUA 4BPBA 1R7RA 2ZRHA 2ZSAA 3SZRA 1F2UA 3IUYA 2QGZA 5FOTA 1MO4A 2BMFA 3B6EA 2ZI4A 2R6DA 5HR5A 4XSHA 3EC2A 4RZ3A 3W90A 5FOVA 3GPLA 1II0A 4JMPA 2A5FA 1KDPA 4JS0A 5JCZA 2C95A 4CEJB 1US8A 4PZLA 3B78A 2GF9A 1QF9A 3SHWA 1GUAA 2QN6A 2ZJZA 1YHNA 3K70B 5BQ5A 4QG7A 2J46A 4QXAA 3GLFE 4TZ6A 2NG1A 4GFDA 2WWIA 1XTIA 3F3YA 1XJ0A 3AUXA 5AJYA 1R0WA 4TMTA 5ELXA 4NZYA 4CEJA 3G5UA 3LQRA 2K5UA 2BBWA 1RE0A 1AZTA 1AZSC 4B3GA 4ZIRB 2FGKA 2ZE6A 1S9HA 2DPXA 4UNPA 1QHNA 1RIFA 2OLJA 1F2UB 3O47A 1E1QD 2YC4C 3A8TA 4XSGA 5AUPB 2QE7A 1NN0A 1O3YA 1W5TA 5DI3A 1W4AA 2V9PA 2FEOA 1X8LA 3PUYA 3QPUA 4PC1A 2IYLD 1NBME 1YJ5A 3KL4A 1Q3HA 2MSDB 2WJIA 1YZUA 5FTLA 4ESHA 1YZGA 2P6RA 3REFA 2ZRKA 3MWJA 1QDEA 4FCTA 4D0LB 4JT4A 3L8ZA 2WKRA 1TU4A 4DWJA 4LV8B 5KNDA 2AWOA 5FUVA 5IDVA 1RYFA 4M1YA 4TL9A 3W5IA 1ZRHA 2WJGA 3SEAA 1E9AA 3U44B 2ORWA 1G19A 2REXB 2ZE5A 2FA9A 2H5EA 4IVRA 4JL5A 3B8HA 5JHHB 2WIAA 3TUIC 3B1WA 3X1XA 5BYJA 3K0CA 4ZV4A 2QSZA 3KJIA 1ZJ6A 3LLUA 1KMQA 5FUWA 3VAAA 1MABB 2X1VA 3B60A 1NSFA 1OFHA 3A6PC 3P4XA 1GITA 5K8LA 4GDFA 3PQCA 3U7FB 4PPGA 3TW4A 4ARZA 2FE4A 3P26A 2HJGA 2GBLA 1XZPA 2G0NA 2XX3A 1GIAA 2G6BA 3EX7C 2AXPA 4MYHA 1P4SA 4OQFA 4IKEA 4FIDA 4C9BA 4Z1MD 4TLCA 1UAAA 2OG2A 5EE0A 2IEZA 3MWLA 4BLTA 3OIVA 3QXCA 1CR0A 3RS3A 4DEXA 2ZREA 4XD7D 3T1VA 5FL3A 1E0SA 2ZRDA 3I92A 1DO2A 3TSZA 3ZLJA 2V3CC 3GQBA 2F9MA 3B85A 1CRPA 3OFNA 1OH5A 1GL6A 5EXXA 4G5QA 3FHCB 4LCBA 2FFQA 5JEEA 4PXAA 4H9GA 2OBMA 1VYUA 4Q9LA 4ZIRA 2WOOA 4ZI2A 3KQUA 5TXGA 3C7KA 2O0KA 4JLAA 1S9DA 4LSGA 2ZE8A 4NYIR 5B58C 5DHAA 4OJQA 3DVLA 1GSIA 4PO8A 2O0JA 3HWSA 4G5GA 5HZKA 1U2RA 1M7HA 2XXAB 2OEPA 3RS2A 3G0HA 1Z2CA 2DR3A 4BFYA 4DLXA 1OXVA 3MFYA 1JPJA 2PMDA 3PITA 3I8XA 1LW7A 4US2R 3J81k 2WJYA 3LW8A 4R98A 2PZEA 2R6FA 4B34A 3BWDD 5KDDA 1W4CA 2X2EA 4HAVA 3AM1A 3A37A 1W0JA 4ZI3A 2OFWA 2OM2A 4BZQA 1P9RA 2FSHA 3PFIA 2RHMA 4MKIA 1ZVQA 3AVYA 4FWTA 3U61B 1J8MF 1E2JA 2JLVA 4PPQA 4E07A 1AN0A 1GKIA 4KO8A 3T34A 4LX0A 1SZPA 3ADKA 2ZSFA 4LBYA 3ZJYA 2DB3A 3PJRA 5EE1A 3CR7A 5H1YA 621PA 3I8SA 5C4GB 4TLEA 1NVWQ 2FSFA 1OLOA 4GZLA 4Q1CA 4ZKEA 4FMBB 4G01B 4LHVA 3FMPB 2DY1A 2ZROA 4NHOA 2R6AA 2XSZD 5E7IA 4HLQB 1C9KA 2QAGB 2BKEA 2KI5A 3LO5A 3LXRA 1AKEA 3PUWA 4LWZA 1D8TA 1UBCA 3QBTA 2V1UA 4B75A 1NY6A 2HCBA 2Q0HA 3LBNA 4LJ7A 4V0OA 3T1TA 5AUNB 1GRQA 5P21A 2WZQA 2ZVPX 3NBFA 3VQTA 3REGA 1FP7A 1KKLA 3A1UA 1EWQA 3KZ1E 1E69A 1E0AA 4NCNA 3THWA 2ZS9A 5KPJA 5KDLA 1Q1ZA 2IUUA 2GJKA 5CDFE 1P73A 4QHYA 5FBVB 2IF0A 4HB4A 5JCPA 5H68A 1FOEB 3TH5A 3C16C 4X8HA 2AWNA 2O8FB 3EG5A 2WBLC 3FKSA 3GD7A 1T5LA 3FE2A 1YKSA 3ZZ0A 4A0RA 2VHQA 1EFTA 4FMDF 2FMXA 3WP1B 2AKYA 3AF4A 4DLZA 3A1TA 1N6LA 4MYUA 4O25A 2FZ4A 3CM0A 3FOZA 4LV6A 3QOFA 4ABYA 1VECA 4MGIR 5G41A 2OCPA 3UXMA 4QBHA 3C5CA 1P2TA 3DZ8A 2C98A 2WSMA 1GNRA 4B32A 1E9RA 1Z0JA 2C77A 3A1VA 3A4LA 5AR1A 4C0LA 1HE1C 1E9FA 1ZM2A 2DHRA 1E79D 3HJNA 3AGPA 5FPKA 1G7SA 2FPLA 3AVQA 1M2OB 4L15A 3E1SA 2JLWA 1OHHA 3UWKA 2LWIA 1OB2A 4JSTA 1U8ZA 1XMIA 3N5CA 2ZANA 3AVXA 2IWRA 4X8LA 3ZZTA 2XZOA 4JBXA 5L3SB 3P1JA 3ZVLA 3FPAA 2FGJA 2PT5A 2QAGC 2HF9A 1XD2B 3BH6A 1GKYA 3I3SR 1ZIPA 3ZS9A 4OI1A 3NXSA 1D2MA 1A4RA 4QNRA 4DCSA 3X1YA 5FBLB 3AF2A 5SZJA 1S2MA 3MSXA 1GKUB 4UNSA 3EPKA 1VKJA 1KO1A 1JAHA 1TX4B 2QL6A 4BLOA 4C0QC 1IN4A 1S4QA 3I4LA 2D2FA 2O0HA 4RD0A 1GOTA 3BGWA 2XSZA 1ESMA 3RDPA 2PJRA 2WICA 2IYQA 2ANCA 2NO7A 5JS8A 1W36D 1ZIOA 1W1WA 4A4DA 4QM6A 1G8YA 1K5DA 2OAP1 2G83A 1ZUNB 2PEZA 4DKXA 2ZRPA 3BFVA 1RRPA 1RJ9A 1E9EA 2IUSA 3RYTC 1R5BA 2EFGA 4S2EA 4YDHB 4V0KA 4PTLA 1HE8B 1IN5A 2C9OA 1Q3TA 2OUKA 2ZI7A 1KI7A 2F6RA 4Q4LA 2FU5C 1W4RA 1G18A 1MOZA 3IDQA 2GHIA 4G5OA 4V0MA 5CM8B 3NIBA 3OIYA 4N0DA 1A7JA 2EW1A 2ORVA 1DOAA 4Q9KA 4LPSA 1P2SA 4FXPA 1JECA 2N46A 3WNCA 1VYVA 4WIAA 2IS4A 3L0SA 4UNQA 2JDID 1I4DD 3L82B 1KK3A 2R44A 2R2AA 5L8VA 1XMSA 2ZR0A 1DE0A 1W0KA 3LAWA 3I61A 5DO9A 4QNMA 1NMZA 2EVWX 1R0ZA 3LH5A 2VHCA 3OF5A 1QHHB 1SVMA 3HYTA 2H92A 5F3WB 2BKUA 2NO6A 3AH8A 3EA5A 3KQKA 2QP3A 4PFSA 1YVDA 4IDPA 4BFTA 4O2RA 4RD3A 4L5BA 2ERYA 3QSYA 4C0AC 1G17A 2HT1A 4JLKA 3AF1A 2J1LA 1T3LA 1G5RA 1ZM9A 4A0GA 5F98A 1VDZA 1SGWA 1UKVY 2QP9X 1II9A 3SJCA 4ZDKA 2CL0X 3QKSA 2ZRBA 3LFUA 5CDFA 1SKQA 1EFRA 2C99A 2CLDX 3NDBB 2QT0A 3W5JA 4FMCF 3K8YA 3MWYW 2JIZA 4A36A 1K8RA 1KDOA 1EWRA 3WMFA 2YNMA 5DSZA 3LLMA 3K9LA 1I4TD 2PLRA 3I32A 2ONJA 5AUQA 2C5LA 121PA 1OF1A 4Q1DA 2JLZA 3NBYC 3GLHB 3P4YA 1Z5ZA 3QY0A 1KI6A 4US1R 2Z83A 5J5CA 1FX0B 2JA1A 3U7GA 2JJ2D 2MMCA 5AJXA 5TB5A 1ANKA 3ASZA 4OHYA 2I1VB 1OIWA 3K0SA 1ODFA 2C04A 1G64A 2IYSA 2QT1A 4C0KA 3ZH9B 3T1QA 3K0CC 1BMFA 4B44A 3ZQJA 2GTPA 3ZIAD 2W0MA 1R0XA 3R9IA 4H1UA 4M9QA 1GTVA 2HUPA 3WYAA 5GADl 1S96A 2OLKA 1QRAA 1M34E 1UBGA 2JATA 3QVVA 3EZ6A 3F8TA 2QTHA 1CTQA 1TQ4A 2W6JD 3OE7D 2J0UA 2OBLA 2G1JA 2ZSBA 4Q5IA 4A2QA 3Q7PA 5JECA 5L3QB 3QEJA 1VIYA 5EQTA 1OJLA 3CIOA 2I3BA 2ZI9A 2J5XA 1S3SA 1EGAA 5FBRB 1H8HA 3SE0A 2FV8A 1E9BA 2EWWA 3KUDA 2NMVA 1Z0IA 2BC9A 3BORA 4M1KA 1YRBA 3WRXC 1UKYA 3CRMA 3KFXA 1JR3E 2JLSA 1U81A 1GP2A 5IHPA 5KU1A 2R65A 3A4MA 3LNCA 4MUBA 4F92B 4NCKA 3DO6A 3HU2A 1ESNA 1EXMA 5JWHA 3LY5A 1L4UA 4O0MA 4Q4HA 1Q20A 5CIQA 1YR8A 3NTUA 4ASUA 3RHFA 3BFKA 4EFMA 2YOFA 3CRVA 4NP6A 521PA 1D2EA 4Q1FA 3ETLA 4Q48A 1FMJA 1YR9A 3AGQA 1TUIA 1U90A 2GKSA 2ZJAA 4OQXA 4QJ4A 3EW9A 1E2HA 3KJGA 1T3HA 4QJ3A 5HKKD 5LB2A 1DAGA 2FSGA 2OFOA 1HT1E 4JLDA 3MLEA 3NVAA 2QU8A 2B8TA 3IPXA 4GOXA 4UNRA 1XX6A 2QE7D 2XNDA 3FB4A 4PZYA 1TQ6A 1YZTA 2B7CA 1GDDA 5FI1B 4DZZA 1Q12A 1Z0FA 1P60A 1Z28A 3BE4A 3TSOA 1YU9A 4B3CA 2RGDA 1UADA 2DCUA 1N5LA 2BJWA 4L9WA 1XB2A 1AA9A 5G3ZA 3QNUA 3QIAA 5UKDA 4BEBA 2O8BA 2CDNA 3LX5A 4HAYA 2FFBA 4JVSB 2QTFA 4QM7A 2CVFA 2GVZC 2OESA 4OKSA 4CVNA 4DLRA 2OT3B 1R4AA 1G3IA 2BMDA 1NN5A 2ZAMA 1KI1A 1Y63A 5H70A 2VA8A 3FHTA 2H1LA 3CF6R 3AKCA 3AP2A 3CZPA 3SOPA 4Z54A 2ZRIA 2YYZA 4O2LA 4M4SA 4Q7MB 1ZM4A 4RZXA 4W5JA 2LCFA 1L7VC 3AVUA 3W6NA 3VNUA 2VSXA 2ZR9A 2A2ZA 4LJ9A 5FI0B 3WYFA 4B3XA 2XOKA 4DSUA 4Y0VA 1SVIA 1U98A 3EZFA 4V03A 1ZNYA 1V5WA 4HZUA 1NRJB 1YE8A 3U4QB 3ZGXA 1LNZA 1H8ED 3GJ5A 4KAXA 3FMIA 1E3MA 2G3YA 4XWOA 3HR7A 4BFUA 2J0SA 1VPLA 3WYGA 5JSZB 2W58A 5EZ6B 2WAYA 3QENA 3GLHA 2EWVA 2ASEA 3RAPR 4XVUA 4UQOA 2Q3HA 4P33A 4URYR 1X6VA 2V6JA 4KFUA 4YXWA 4DDVA 1R0YA 4JLPA 4NPHA 4GP6A 4M8NE 4BUJA 3SJZA 2XTNA 4PSVA 1XXHB 3V4FA 4AKIA 1SVLA 1JNYA 1NY5A 4IEEA 4EFLA 4D4KA 4BLSA 3RS4A 4URZR 2GF0A 4DDTA 4WW0A 1XTQA 4FI3C 1XTJA 1E94E 3K09C 2CHQA 3K0FB 3B82A 3WHKA 2ZRJA 4GNKA 3U6KA 3TBKA 1B0UA 2FPKA 3THOA 2VLIA 4KU4A 1IY1A 2ATVA 3P32A 3B13B 5J47A 3DOFA 3IEUA 2WMNB 1YZNA 3N70A 3T1OA 4DEYA 1CRQA 1VYTA 1RC8A 4P4SA 4AC9A 2YWFA 3OEEA 4F4JA 3RWOA 4LJ4A 3BAFA 2ZYVX 4HAWA 1GZSA 3VU9A 2XGJA 1H8HD 1J7KA 1D5CA 4IFBA 4EPXA 1BS1A 2NO0A 1EFCA 1NF3A 2BOVA 3CUEF 4YLGA 5HPYB 4URXR 4V0ME 5TARA 5FFMA 3BRWD 1N5JA 4P0TA 1Q22A 3KQNA 2DFLA 2PT7A 1R10A 4DLVA 5JRJA 1I4LD 4YC7A 3VX3A 4JJZA 4HAXA 4E03A 2WWWA 3O8BA 2A9KA 3TQCA 1SXJA 1JR3D 1YR6A 4I1VA 4NCHA 4FW9A 5CK5A 3THYA 5AJWA 3VMFA 3I5YA 1DAEA 1T8UA 4TYNA 1QHGA 4L16A 1E4YA 4LJYA 3LA6A 2WWXA 2UZ3A 5L3SA 3AUYA 3TGPA 3IGFA 1OFTA 4ZO4A 3AVWA 2OXCA 4CIDA 3Q5DA 3SFVA 1VIAA 2YWHA 1DVRA 2IS1A 3HPQA 4WA7A 2BWJA 5CJPA 4KBFA 3S1AA 1KHTA 1SKYB 3QKRB 2QGNA 2G88A 4PQRA 4YDSA 1GAJA 3DL0A 4OI4A 1KK2A 3X1WA 1PLLA 1TQDA 1KI2A 1E32A 3R7WA 3RRMA 2AK2A 5BW8A 1W47A 1ZCBA 2RAPA 4XD7A 4Q4AA 2ZJ8A 5EP4A 1PJRA 4G5SA 5B64A 4ILEA 2IL1A 3TAHA 2C2HA 1MO6A 3THYB 4IDOA 2YZ2A 4QRHA 5DLQC 3SU8A 5IK2A 4AYTA 4D6PA 2WPDA 2YWEA 3D7MA 3GJ8A 1E9DA 1IBRA 1N6HA 4P4TA 4XVRA 1BYUA 1ZYUA 2JJ1A 1DAHA 4EJSC 4B2LA 2D7DA 1PLKA 1XTKA 1N6PA 4OK3A 3RS0A 2REOA 1P5ZB 2NO1A 4PC2A 4BE7B 6Q21A 3KKQA 4DSOA 4DRZA 4PANA 2QROA 4YMTA 1NJGA 4IOJA 3LRPA 4XTCS 3IQXA 5GJCA 3PVSA 4WXPA 2WMOB 3MJRA 3GP8A 1OFIA 1S1MA 4M22A 1SVKA 1XD2A 4TTPA 5SZIA 3THWB 3FWYA 4JSYA 2Q3FA 1RYHA 1NBMA 1VCNA 4WZBE 1Q0UA 5HZHA 4HAUA 3QXJA 5C1BA 2F9LA 4LHZA 4KSCA 4ASUD 1DG1G 4BQSA 1XP8A 4LYJA 2GDJA 1G20E 4NMMA 4OQNA 5HCNA 3X1ZA 4XWKA 1HEIA 4A2PA 4PSKA 421PA 4B48A 1Q21A 2F3RA 4NE2A 4ZDWA 1CP2A 2PZFA 4KXFB 2JLQA 3FMOB 2HYDA 3ICQB 2Y8EA 2IYTA 3D6TB 2ONKA 3PENA 4MRNA 4BFSA 1GFIA 2JIZD 1W4BA 4BWYA
chains in the Genus database with same CATH superfamily
1KSGA 2JRLA 2P4SA 2ZSDA 4EEZA 2X1HA 3NB0A 2C96A 4TXLA 2D7DA 2ZI3A 4R1UA 1FTQA 4OM7A 1I51A 3COYA 5DM60 2YOGA 5JAIA 3H6KA 4NPCA 2BLLA 2CCKA 2FX3A 2EDAA 4X91A 4CMKA 1YHZA 4Y9UA 4YJGA 1I3MA 4KBGA 2YJ5A 1H94A 1FP4B 3AESA 4GM4A 4Q9IA 4FDVA 1LY1A 2PTGA 5AHKA 1AGRA 2GZSA 2H7XA 1EDOA 1KJQA 3IBFA 4JUIA 1QZ3A 2ZM6B 5L7WA 4WOCA 3C6XA 4QULA 3KB6A 3IRVA 4GMHA 4W5QA 4RENA 2ZJ2A 5GOZA 3WWZA 1ZUIA 4YAJA 1VMEA 3D7RA 4G4JA 1XZIA 2Y0PA 3V33A 1MQSA 1L7NA 1GNSA 3PFFA 4KQ2A 1Z5GA 2QM0A 4I81A 1VHQA 3TKLA 1UKEA 1TE2A 3EN0A 4TV9B 3H4MA 3E1KA 4JH0A 1UINA 3AESB 3F6EX 4TL8A 1W46A 4MJXA 4HZGA 2QVLA 821PA 2QXTA 4TVSA 2F8SA 4HJXA 2DYKA 5J4LA 2JHAA 5G1OA 4WFQA 1T5OA 3P9PA 4G0PA 4LXTA 4LYFA 1UJ6A 5ERXA 4CUKA 3WIBA 5A7FA 4LGVA 4JLMA 1WMSA 1ZY2A 2QLTA 3K96A 1JJ7A 1XA3A 3LSYA 3QK7A 1LSUA 4N6GA 3S4YA 3NCTA 4MMYB 1CZUA 4D3YA 2GA9A 5C7IO 1G6OA 2P0AA 2AD1A 2EF0A 4ETNA 2BVNA 4WL0A 4EHHA 1KFCB 1NVDA 2IT1A 1XCGB 4FZ5A 4QUDA 4S12A 5DGDA 4EY7A 4MVJD 3KOUA 3G85A 5IZCA 4LS3A 5IMSA 4AF8A 3M33A 3SZLA 2P2LA 3PB3A 5D7BA 2YH2A 3SHQA 3LPMA 3FNQA 3AVVA 2EYUA 2YN2A 5BN1A 3QU7A 4IV5A 3OM0A 2O2HA 3F6YA 3TGWA 2HFKA 4RK5A 1IONA 4IXMA 2LRHA 4Q12A 4QGHA 1UBKS 4GL2A 4H4DA 1BS9A 3LT5A 2NO9A 1KMIY 2HRCA 4LRUA 1U0RA 1JAZA 2H4XA 2HK9A 4IV0A 3VI4B 1IJFA 4DGQA 3LDAA 3G3EA 2V7QA 4JX8A 4CG2A 4DJ5X 1DC4A 2PYZA 4N8DA 5L3ZA 3WDSA 3B3FA 3MERA 1KZHA 5FL7A 3BGDA 2LIVA 4LF7B 1KY4A 1VKOA 5TQVA 5EQJB 2IEYA 5K3AA 2ERCA 3TIIA 1XD9A 1ZRMA 1EINA 1JWLA 2QRNA 2P0YA 3GLHE 3WTBA 4BMXA 3QA3E 3VC3A 3L0PA 3PRJA 2ZWIA 5J2TA 4NBWA 1S3IA 2X77A 5LZ7A 1YVRA 3IV6A 3Q5EA 3ZS8A 2RHLA 4EMSA 3QE4A 3NIWA 4IYRA 4XXHA 3SSOA 1Z7YA 2MINA 3P2OA 2F1IA 2GGSA 4EKIA 3INYA 3C3KA 3IMKA 3ECSA 2HLNA 4AMBA 3HCEA 1HE3A 2G1AA 3OZDA 1TI7A 4ZYYA 4LQDA 5H3LA 5CA0A 3JRXA 2D74A 4BMYA 4X1KA 1FSSA 1T15A 2GN8A 1VLVA 1HRDA 2P30A 3E15A 3F3KA 4P4LA 3FDXA 4RVFA 5G0WA 3IS3A 1I5RA 5DI3B 3HFSA 5H0IA 1D2CA 3LE8A 4MR9A 2XKAA 5G4LA 1R74A 3TXXA 3KFVA 4KYTA 1IN8A 1BAPA 2X0DA 4TYPA 3VDNB 1RW4A 4OK6A 3WGTA 2WVHA 3MUNA 1Y1TA 2ZYWX 3NKVA 1Q16A 1I7QB 4AZ3B 2C5GA 5E9WA 1G8GA 3IUNA 2PVCA 1X77A 2AQIA 3BQNB 3H8WA 3HCAA 3NI2A 3SJAA 2XUDA 4DCUA 4EMUA 5JXGA 1JG7A 4GX0A 1R4ZA 2PTHA 4JVMA 4RDHA 3RG2A 4UHDA 1G38A 4HWRA 1HURA 2EKBA 5K2OA 1PNOA 3STHA 3BJMA 1DAKA 4HX5A 3ADBA 1KI3A 1QUEA 1W44A 4XQ0A 1LVHA 2IV7A 3FX2A 5JANA 1TZKA 5I8PA 3HXKA 3ZVMA 3RFUA 5NLLA 3RSQA 4LN1A 3IKTA 2VJAA 2H1SA 4OHWA 1KH3A 2QBYA 3FTPA 1ZVVA 1VMKA 2R6HA 1COZA 4Z7JA 5T67A 3AKZA 4L8VA 3V2IA 4AZ3A 1RWBA 1SVNA 4LGMA 1DS6A 1C3LA 1T8PA 4C3VA 4JLNA 5BWNA 5IZCC 2XW6A 2DFVA 1YK0A 1Z4LA 3TLJA 1SIWA 5AXCA 1EVJA 3FYUA 2QW0X 4K9OA 3HP1A 4KQFA 4Q4HB 1TF2A 1W9HA 2P40A 5G4KB 5FBWB 5LBUA 4EG8A 4H35A 3BWYA 3N1UA 4IDFA 1FLVA 1C3EA 2ZAIA 3PFWO 4B09A 3B9BA 4KKXB 2XBLA 4ZKDA 3CUUA 1TC2A 3N0VA 1JJVA 4LISA 4D9JA 1TLTA 2ODTX 3GMTA 3TI9A 1V1JA 3M4YA 2REBA 1GY8A 1RLOA 2RBGA 4B47A 3NGXA 2V7UA 1GEEA 1PS0A 4LYHA 3UB3A 2C88A 3QXSA 3C97A 2OILA 4BP3A 4H3HB 4NX2A 2PT6A 3M4ZA 1CUBA 2BTQB 4UVHA 2ZBRA 4D02A 2B8WA 1ZD1A 2OZVA 5E3IA 2WIBA 3RODA 1E59A 4GNRA 4RPHA 4B2PA 2B92A 1BD3A 5TSDA 1FTYA 4PONA 3SIXA 4UOZA 4JXXA 1X3SA 2EFJA 2O2JA 1PWYE 1XZEA 4YVFA 4REOA 5I4BA 4BASA 1QAOA 4MW5A 4M49A 1R15A 3ROTA 1M6HA 4M1SA 5AM2A 5LSAA 4RTQA 4DV3B 1QJCA 3BZBA 4FFLA 4B7AA 2EV9A 3HP4A 4JEHA 4HPXB 4EUSA 4QKQA 4YMUA 1KGDA 1KY2A 3PUIA 3S7TA 3ZD8A 1ZJ5A 1R2QA 5B1SA 3UUFA 1P9WA 2X2OA 3HV2A 3LL4A 3B6IA 4J0EA 4AG5A 2CD7A 2G5PA 4HMOA 3FGOA 2HU8A 6YASA 3QW2A 3L8FA 4M0UA 4DDKA 1T6BY 5CDUA 1E20A 1N3LA 1U8XX 1UMCA 5DYTA 2VDNB 4IGKA 1NUPA 1QVAA 4OI2A 1SOMA 2VJPA 1TEHA 5DWQA 2W6ID 1Q84A 3RW9A 2JLUA 3PPYA 4HWGA 1YAJA 3IE1A 4YT8A 1L5WA 5HJ7A 3KZOA 1P72A 3IJRA 3DV0A 2AMYA 3C3AA 1C1DB 1K08A 5L6MB 1PL0A 1ZMTA 2CSUA 5DHUA 1NW6A 1WCYA 2D06A 5CFZA 3HM9A 5TC4A 3UXHA 1QRSA 2UYHA 3ILYA 3IPYA 4UAVA 4YGXB 2RKOA 5GGYA 4DLXA 1E2LA 3G9QA 2QQ0A 2MYUA 2WHPA 3R9XB 1AC5A 1M8FA 1GAEO 2DHEA 4GR9A 2JIBA 2NXCA 3BM5A 3IUBA 3OCWA 1GV0A 5IT5A 5GGXA 1ZHFA 1VJTA 1O94D 1F20A 4P32A 5DLPA 3AINA 4AK9A 3A9CA 2JGNA 1KE1A 2DJIA 2O4UX 4ARIA 3W77A 4QBFA 3UVEA 1DIRA 2LKCA 4M1QA 3KZXA 3C3CA 2P1DA 3DW1X 2C42A 3AR2A 2PYDA 3PNVA 2RHRA 4PYMA 4CQLA 2HF8A 5K3BA 5AVQA 3VO2A 2FPPB 1D6NA 2WOJA 3SKYA 4H59A 4V0LA 1OCEA 1LDMA 1NVAA 2YRWA 3R7LA 3M6MD 3AEZA 1K7EB 1LS1A 4I4TB 3WB1A 1WXIA 3AJ9A 1XVTA 1T36A 4FUTA 2BBSA 2JPDA 3U13A 1BNCA 1N7IA 3GZNA 4HEJA 3INNA 5FCDA 3TLGB 2YFQA 3C48A 3KLNA 5DMHA 3OUZA 1JXOA 4KAFA 4FXOA 4U7DA 1Y0BA 2VI5A 1NULA 4JOBA 4Y2UA 2WWGA 3W3ZB 4CCWA 4A8JA 5CXUA 1P7YA 1ELOA 3EIOA 3OI7A 3GT7A 2WT8A 4BV9A 4C08A 5L9AA 4JUAA 1P1JA 4IQFA 3MMZA 4NBKA 1EK5A 1PWZA 2A0UA 3UN1A 5IH7A 1IC6A 2A3NA 5JEDA 3GU3A 3QVUA 2CLCX 2INGX 4LYAA 2PNJA 2ZZNA 1AO0A 5MGBA 3O4IA 1CUHA 4OXQA 3OHPA 4HDRB 2EIXA 1ES9A 4F4CA 1M54A 3KX2A 4ROTA 4YCBA 1LC3A 2R8ZA 3UK2A 4UULA 4BVHA 4DNOA 2C4MA 1XKTA 5B57C 3IP6A 3RVOA 1BOOA 4UM7A 1TFRA 1OLUB 1B00A 1M66A 3QKSB 3G8YA 4ZOCA 2HYIC 2BM1A 3BWMA 5DM1A 1DADA 1N57A 3P9NA 5AK0A 1LI5A 3IEXA 1V11B 4LK2A 1D0SA 2XB8A 4MULA 4PG8A 2NUTA 3R0IA 1ACLA 4EWLA 4BV2A 4LF8B 2Y1XA 4M55A 1U7TA 1GTG1 1K7FB 2PEYA 2KX7A 5L3QA 1MC4A 1QP7A 3ZG6A 1X94A 1DQRA 3EPLA 3VHLB 3A6GA 5JD3A 4N47A 3JAMA 4F84A 1PWHA 2NUBA 3NTQA 2H2DA 1N4AA 1WXXA 2Z58A 3BSWA 1XTRA 1JR6A 1PGPA 1V35A 2Z5VA 5AJHA 2CHVA 2H1IA 3ND9A 4WWHA 3IP7A 1XHEA 3NUQA 4MGEA 3TBHA 1KU6A 2IEBA 4ZEVA 1F6BA 1TW2A 4HB2A 5KYUA 1G2QA 1I6LA 4TLAA 4U4AA 1QGOA 2IIQA 5KWIA 2VVTA 3J81A 2BAGA 1ESDA 3OTIA 1CVIA 3IT3A 5LYJA 1NI3A 4Z3DA 4TXMA 4JB8A 3CGWA 3SJBA 3TZLA 1OH6A 1N78A 3BULA 1ILEA 4M2LA 5FLEX 4Y1FA 1HV8A 1KYZA 1T2FA 2A59A 2GK7A 4RJKA 3TTSA 3GWZA 2JFHA 1XEAA 4TWBA 2NU8B 3L0CA 3NO4A 4URUR 4GI3A 5LP6A 3ZUPA 1T35A 1IHDA 5CIWA 3QITA 2ZRAA 1IY0A 4IZIA 1M2EA 2ZJ0A 3WTCA 1SCUA 4UTOA 3STUA 3FTEA 1NLZA 2DTEA 1KO4A 4DCTA 3JWHA 1SK8A 3PLNA 1JKMA 1VRWA 1LK7A 2VWGA 4JP3A 5D6OA 3K6SA 4D56A 1G66A 1GYRA 4D98A 1VGRA 3G7SA 4MR7B 2IPXA 3GCDA 2Q28A 4CF6A 3ZDAA 2QA5A 4EF4A 1JT2A 1OX5A 3BWCA 4RYDA 1PWEA 4UEKA 3PFBA 1U2SA 1OYWA 2UKDA 1GZDA 4GSLA 1WCV1 4P6VF 4D44A 1GDTA 4GEGA 1M6VA 1DOHA 5TS2A 2ZDGA 4CCSA 2I34A 1AB5A 3W2HA 1M67A 3LGSA 3CQ9A 5DCYA 3H84A 2B35A 1NIPA 1C3OB 1RTTA 4MH0R 5A6VA 2G9UA 1IK4A 1JEYA 1CU1A 1EP3B 1XWWA 2XUFA 2JK1A 5IVKA 3TDKA 2WWHA 4C7OA 4MW6A 2V7TA 1P77A 1SFRA 1ZN2A 1GLNA 1M34A 1RFLA 1S02A 2YZNA 4I66A 3WRVA 2BRUC 2CHUA 1E7SA 3D4LA 5DTQA 4DZTA 2C4UA 2YVAA 4DNFA 3UPUA 2QAIA 3LT2A 1BKSB 2FOIA 1P0PA 1MTZA 3DLPX 3JZIA 3ZCXA 4JC8A 3WP0A 2HPHA 2PRJA 1C2TA 5FUBA 4DPLA 4FGUA 5F5XA 5IARA 3QNMA 4Q6BA 3G7UA 2AUNA 4RHCA 4JT2A 2O06A 2BP7A 4NR0A 3IT1A 4IYJA 5HWSA 3PXBA 2J3KA 2ZRLA 3TYXA 2E5LB 5K0JA 4XX0B 3PTLA 2FEWB 1N2GA 4WSOA 4YRSA 3JQGA 3EIQA 1TRHA 4OL0A 3WBKA 4B43A 1SCIA 2IBSA 1Y5LA 4GX5A 4BO9A 3HKEB 4H6PA 1O0BA 3ICEA 4LA4A 4UVEA 2QWXA 2VP0A 4MWTA 2EFEB 2PJDA 4XIGS 1YE3A 4HPWA 1KDVA 1W85A 3PXGA 1GUYA 2C97A 1T6NA 3MWEA 2YXBA 2G40A 1VE7A 3KHKA 4OJTA 5BXYA 3JYLA 5DSXA 3OTWA 2VCHA 3A9UA 3AKEA 3PBKA 1ZI6A 2ZBUA 1B3RA 2CMKA 4EUEA 4UZSA 2A9OA 1T4GA 3SPXA 5I7WA 3GFTA 3FGNA 4BO0A 4J1NA 3PRHA 1EX6A 1YS2X 2ZRQA 2GZAA 1SG0A 4YJHA 5DNUA 1QF6A 2QJFA 3OFVA 3UQZA 1ZW6A 1E6WA 1JHZA 4RVGA 1BW9A 1RYZA 5DHPA 1WHTB 3IDZA 2X8AA 4AWXA 2JFXA 4TSFA 3ZV6A 3QU4A 5EJAA 1Z29A 5IM5A 1KJWA 2VF7A 1C0EA 2V6IA 3QKUA 4L0CA 4UVIA 4YUYA 5KMGA 3UWOA 1KYQA 1Q6ZA 3K9BA 3PI6A 4MW4A 2NZ2A 2XB4A 3UAVA 4CIYA 2DT8A 3VC7A 4AUNA 3GLIA 1J5XA 3ODGA 3SZUA 3N58A 4KQGA 4IIJF 1JS1X 2P1ZA 1N6KA 2ZUEA 3EXAA 4ETIA 3O3NB 1G1MA 1K8YB 3LPAA 1UQTA 4RS4A 4IS2A 3VOAA 3SF8B 3BA1A 4MRSA 5BQPA 5EUMA 2WIDA 3NHRA 5F9MA 5DCUA 5SICE 3G1TA 1WDLA 4Q66C 2L2QA 5BSMA 4KHZA 4MUAA 1IZ9A 1PJ2A 1SVOA 5C1OA 5EZYA 1RRKA 1RT9A 1UFKA 2PX0A 1QIJA 2KJQA 3GJ7A 3L7YA 3EDOA 4JCCA 5TPZD 3WSTA 2REQA 2LDBA 1DX6A 5ED0A 1HYEA 4AO7A 3E53A 2PU5A 1Z7GA 2LVBA 3DV0B 3I9KA 3F78A 3P9XA 3PUVA 5AOVA 1VCIA 1YFZA 5KHLB 4GPZA 5KVCA 2ORIA 1U02A 3OQBA 3RROA 2IDJA 3TRKA 1CY1A 2CLSA 3NJRA 2O2ZA 3FETA 5DYIA 3VVMA 4FHGA 1MB0A 1C4KA 3IQFA 1Y4SA 4OGGA 1YR3A 4HLUC 4DR4B 1C30A 1FU8A 1ZINA 3KBOA 2ZSEA 2WG2A 1P1KA 4AJ4A 2AJCA 1YBFA 2CBZA 7MHTA 3R5JA 2Y0CA 5CVUA 2GD2A 2OCBA 3ID6C 1XQVA 1KQNA 2O6HA 4LDAA 1IIBA 4BFXA 4WPGA 4ZYZA 5JI2E 2HJ9A 4L4RA 2ZDQA 1K0FA 4RSGA 1WVIA 2XZPA 3BXEA 4WNCA 4A10A 4AYWA 1RBMA 3QV1A 4QL3A 2ZP1A 3SN6A 3TN7A 4ND8A 1V41E 2B1QA 4YQEA 2FJ0A 3B2QA 1L4EA 3R7BA 2A86A 2X86A 3L8HA 5DTIA 7REQB 1DEXA 2RKBA 1Q83A 1YGPA 5LQKA 2ODBA 4Q1AA 5ALPA 1F6DA 1W0JD 2HK8A 4L1KA 1JFFB 3L01A 5IJ9B 3KFLA 1G8SA 3MW8A 2W6IA 1PJ3A 4LHXA 4GD3Q 2RGCA 3HXLA 1N2EA 1AU9A 1Z75A 3SS8A 2FK7A 1F5NA 4U8GA 1G20A 1CZRA 1TADA 4IG4A 4DIFA 1D3AA 2NZ8A 4JELA 4JNCA 1ICIA 1U2TA 4GVPA 1TEZA 2C4HA 4P5EA 2MJLA 3HGTA 2PLFA 4G36A 4BNXA 2AFIE 4E5UA 3MGKA 2DQSA 3VKWA 1LRLA 5FWYB 3CH7A 5LZ8A 4AN4A 4MVJP 2XD9A 3CVYA 2A1IA 3NC4A 1SHKA 3Q8XB 3KCQA 3OIFA 4G1FA 4R0VA 5L40A 1T9KA 2GZDA 3TK1A 5GJBA 2DQ4A 3F6CA 3S3TA 3ZHVA 1I0LA 3F67A 3ZJUA 3FB1A 1G6KA 1SCDA 5KYYB 5FNVA 3U6BA 4CM1A 3KUXA 2ZPUA 3DE0X 1WD7A 3I9FA 3IAAA 1NUSA 4XR9A 3ZYZA 1CEEA 4RE5A 2FRDA 2Q27A 3DWIA 2DR0A 1Y89A 3KELA 3KR1A 4BEJA 1Z0KA 4C5BA 3ZV5A 4DAOA 1VLZA 5PGMA 4F56A 2JCSA 4Y3UA 1ISMA 2C7BA 2PPLA 3DE1X 4HLCA 4PHTA 1RP1A 3IMGA 3KLOA 4TMXA 4FX2A 3VKUA 3HVJA 1KK0A 3MJDA 3ONWA 2P0EA 4A0HA 3OCVA 4XIYA 3FWPA 1AUQA 3I0MA 3QMPA 3IIKA 1TDJA 4OBEA 4U3JA 3LBAA 4X44A 3R7NA 4DRXA 3LKDA 5A5VA 1PNVA 5E3HA 4D1YA 3HUFA 1FK8A 3CR8A 4BN0A 2FQ1A 4RX1A 1FTNA 1GVNB 1EAYA 4PC6A 3E82A 1M5RA 1JGTA 4G8JA 4R3NA 5IS2A 1RI2A 1WLSA 1PR0A 2ESRA 2R751 4Q01A 3AB7A 4ZVVA 4AG3A 4CQJA 5KYXA 5LR6A 3CSUA 4S3MA 4Y67A 4YXFA 3EVDA 1UBRS 2XCQA 2YQ5A 3K53A 3MT8A 5LUAA 3DBIA 1MLDA 2BGRA 1N1DA 1J4AA 5U9CA 4O4HA 1RXVA 5A3SA 1QP8A 1UDWA 2HRZA 4MS3A 3RNLA 4W6QA 3FFBA 3N7AA 3H17A 3PNQA 4M88A 3WLIA 2FAXA 1KARA 4QQRA 4MITA 1T0PA 3ZV3A 3SVTA 1KR5A 1SBIA 1U80A 2HWYA 3ZHOA 4NS1A 3D7KA 8GPBA 1D2AA 4DARA 1II8A 2ET6A 4Z49A 2WYHA 2EFCB 2BZGA 3FJYA 1QYIA 4IL5A 4RKYA 1KF0A 2BP7B 3EGEA 5HEKA 3RS7A 1BFDA 1PVVA 3EVNA 3FSJX 3MTJA 3VI3B 5DKFA 3ZJ4A 1YTUA 5JG7A 3NEAA 3LWZA 4KOAA 3CLUC 2C20A 2ZPTX 3C3MA 3M8KA 1SBYA 3KUKA 4NESA 4OSPA 4O2AB 1F7VA 1PJ8A 3EHDA 3GDWA 4I3HA 1YI8A 4KO4S 3NHSA 1K97A 3OM1A 2JD1A 3GJ0A 2JZOA 5B2ZA 1KKMA 2C1EA 1F8GA 3G1UA 1U7PA 4GSKA 1YOVA 2JL1A 1E3TA 4WVFA 2OQRA 3LRXA 5DDIP 1B1AA 4AI6A 1U2QA 1CJSA 4GMFA 3WC4A 4I5IA 2OB2A 1D1PA 2VHJA 2HLDA 2P2NA 1ML4A 1HYQA 1S2LA 1UBLS 5HTOA 2V7VA 3ZKAA 4BNLA 4UW9A 1PZGA 4CMBA 1SURA 3CCBA 2WY2D 4AXXA 4G1UC 3EVGA 2WW8A 1SOWA 1SM4A 3H9BA 3WGYA 2PV0A 3F5SA 2B21A 4OK5A 2D4AA 3WLMA 4P38A 2H57A 2LBPA 4WOBA 2X7XA 3R7AA 1A2QA 2P77A 3B9PA 4L4SA 2CWWA 4YR9A 4QUGA 3UKDA 3U3MA 3KEGA 2I66A 1HTBA 1JUDA 2UUCB 1OIVA 5F7ZA 1JQEA 1WY7A 2D54A 3FZNA 3IP3A 4I4NA 4X6YA 5EJEA 2HBRA 5JSFA 1U6IA 3DC2A 5IT0A 1KMNA 2QL5A 2JFPA 4XB2A 4IDBA 2R60A 1ENOA 4KMSA 2PAFA 5AI4A 4XPZA 1YNOA 3DPSA 3DYIA 3ZOKA 1CUIA 4BEVA 1PJQA 4Z4GA 2GB4A 4Q7QA 1OXSC 2CXQA 1A5SB 1VMAA 4A3SA 5EKDA 4UD6A 4DDUA 2COUA 3JARA 4JGIA 4RZUA 4J0IA 1QIIA 2WMDA 2QUAA 3NP9A 4QGBA 4BC0A 3HG7A 3Q11A 1J2TA 1VSQA 1OYYA 1Y6QA 1Y34E 2BELA 4KYUA 2RGYA 4HVAA 3SLRA 5BUZA 1BOFA 1Y42X 4ZARA 1X8KA 3BRSA 3DCNA 4JJFA 4PZ9A 1E64A 1SBQA 1YS9A 1ZZEA 4PYQA 3GLRA 4WBXC 3B1KA 2G9RA 4E2XA 1XF1A 4NU5A 4OMDA 3QBJA 4WN3A 3IAXA 2VZLA 5HOQA 3ER8A 5BN3B 5K51A 2BSXA 4JIMA 1HMYA 1E2IA 1P4AA 2QPTA 3DZDA 1L5RA 3H18A 2CFCA 1FP4A 2R00A 2GBCA 3PYMA 1H0RA 3N28A 1K9VF 3ND6A 3R5FA 4AMZA 3EGOA 4G0MA 5C18A 3N2ZB 3RYCB 1PS9A 3VYTB 1XGKA 4JQCA 1G3RA 3PWZA 1C3OA 2E9SA 3C4VA 4JKOA 5AXBA 1YWGO 3VHXB 4CIWA 1DXOA 1XQYA 2H4WA 2P9TA 1D6MA 2GXQA 3OIUA 4TWZA 4XR4A 3H3XA 2VDKB 2C4VA 4PICA 4JYAB 1QWOA 3PR3A 4C04A 3QBEA 2VYVA 4UXHA 2MSEB 3AL3A 1VI6A 2CDCA 2CLOB 2FR8A 4LDJA 1HKHA 4PIVA 3KAPA 5BNFA 4Q03A 4DCSA 3FLAA 4GBMA 1K6MA 3FFAA 3LT0A 3P5SA 1ULSA 1Q0QA 2F90A 2IYWA 2J0VA 2QK4A 3H99A 2IE0A 1CUFA 4K5QA 3EXFB 4L9SA 2DE0X 1NPDA 1OHHD 2FFHA 2WFLB 4H7IA 4AMYA 1TUEA 3CR3C 4F3RA 3WAJA 3GD5A 5GINE 2PLAA 1UBFA 3NAZA 1KR2A 1TVKA 1U7DA 2FI1A 3OEHD 4IICA 5AKXA 3WNBA 3RUAA 5KOIA 5JS1A 4O5OA 4J0FA 3LQYA 4ZVQA 2AIRA 2HSEA 2VF8A 3QG1A 3A3OA 1BIFA 2FN4A 1ID1A 2F55A 1XZLA 2IY8A 4UUOA 4ZODA 4Y6OA 1Z0AA 1ECBA 5JOQA 3DL7A 3G9UA 3H9JA 1MAHA 3AQ4A 1EE9A 1MIHA 2OP1A 3FTDA 3WFJA 4I9UA 2JFYA 5AP9A 4RTKA 1KJZA 1NL3A 5DOZA 4H7PA 3QTBA 4V3BA 5BWOA 1LSOA 4EZEA 2ZTSA 3T5GA 1T91A 4FDUA 5FYQA 2QENA 5BV7A 4KFSA 4ALJA 5ICGA 5AUOB 5BR8B 2GPBA 4OO3A 4X24A 1IRXA 2QRVB 3KPVA 2R6CA 3CKKA 3TG2A 1B6TA 1CUEA 1RI5A 1L5GB 4QHTA 3GBVA 1NG1A 4ZO8A 3WHLA 6GPBA 4RA6A 2GTIA 3GNLA 4ZFNA 5JLJA 4LY3A 4E31A 1EXNA 1F48A 5FR1A 4C0HA 2DPLA 3R3JA 1XN1A 4KBYA 4U00A 1KA9H 2DHDA 4AMUA 3DXXA 1ZKMA 1KDTA 1Y8AA 3EEQA 3G2MA 4JB3A 1RS0A 4OFBA 3WGNA 1LF0A 1UBNA 4YQFA 5AW7A 2I2FA 5AW5A 1MEOA 4PN3A 3SQXA 2XI4A 3ZLBA 2HBQA 5J4HA 4TQ9A 4BQFA 4ZYWA 1NMXA 4II2A 4V38A 1I80A 4YFYA 3JAKA 4MIYA 3H9EO 3FM9A 3OBIA 1H5NA 3A1FA 4MA0A 2XQKA 1XZAA 5CHEA 3B89A 4Z0NA 2O8EB 2BHRA 3QBVA 4KTVE 1WKVA 3CEPB 1JPVA 3L8CA 4UXJA 3DUWA 4JFAA 3BG5A 4G9GA 2BFBB 4X41A 2VHUA 3HR4A 2NT3A 3KQSA 5TJHA 4WKCA 4WXYB 2NU8A 2B4YA 4IF4A 2VH5R 4C4SA 1FZTA 5CBKA 2ZETA 1GSOA 3H2GA 5KTMA 1G2IA 2W4IA 3S2YA 1JIUA 2WIGA 3TIFA 1KO8A 5EJ7A 1B23P 3C6BA 4JJIA 3W2GA 2WSSA 3T3HA 5KZMB 1WV1A 4ID3A 2FF5A 4R8SA 3FCYA 2I5PO 3EFEA 1ONBA 3VR4D 2P2CA 2FPOA 3GIWA 3WXMA 2PNFA 4LZOA 4WESA 5TGZA 1B8VA 4B82A 1PDVA 4XQCA 4QDJA 5I9SA 2AHOA 1RQRA 4NECA 1D7OA 2G5CA 2ZTVA 3Q4GA 3VZDA 5BNIA 2X4DA 3JS5A 4TT3A 5KNCH 1FDSA 4G23A 4PYIA 1KPGA 2VRCD 3IILA 4L6CA 4R1LA 1PT7A 5HUQA 4I1PA 3TTWA 4KYVA 1L4FA 2B99A 2ZWOA 1KEUA 1CY6A 3Q7TA 4OXYA 5AOAA 3BPSA 2VL7A 5DYGA 5IAJA 3ZTYA 3ABOB 5DI9A 4QGFA 3VFDA 5FBHA 1Z4QA 3NWPA 3PGKA 4GO1A 5F73A 3PUXA 2C8VA 3ADDA 1YL7A 5KQGA 1J1IA 1D4FA 1C8KA 2NZVG 3EFOA 4PX5A 4BVLA 4HDOB 4EQ6B 4C6TA 5H9WA 4E3ZA 4B3MB 5L7TA 3EASA 3NV7A 1N6OA 3B1YA 3CNHA 3HZZA 1HK7A 3OLCX 3LC0A 3O83A 3QLVA 3PFNA 1RTKA 4KQ6A 4RF5A 1H3NA 3T7AA 4IGEA 5TGDA 4CM4B 1WKBA 3N0XA 2BM0A 3NEYA 4KRFA 3FWKA 1T2UA 5JJCA 1C14A 2CFOA 3A3YA 4HQLA 4PEVA 4QWWA 3ZXUB 1B1CA 2ORYA 5SYAA 3NTRA 4X85A 4YMSA 3S8YA 3EHEA 3SQMA 4DSNA 3GEEA 4PX9A 1MNAA 1TKRA 2H59A 2WF5A 4P8RA 1HBJA 1U3DA 4PFKA 1WAMA 3U2QA 2B4KA 3EA0A 3RK0A 1VTKA 2B7BA 1YS6A 1W7AA 2OHFA 3VZSA 3WLEA 5LP1A 2QHXA 2NTJA 2ATIA 2QLJA 3RUCA 1S8FA 4B8WA 3V8BA 4LI3X 2KE5A 3N0RA 3VVCA 4ADSG 1SEVA 4E4RA 3UHFA 1I13A 4J7UA 5IJ9A 4UPDA 4WZAA 3C70A 2X5KO 1QGUA 1FPQA 4MS4B 3C1UA 3GMDA 3THSA 4NOLA 3IEVA 1OLSB 3BX1A 3DHVA 3ECAA 3FUUA 3L9WA 3SNKA 2PXAA 4F6CA 4YYEA 4L3WA 4ZVMA 1PDOA 4FFRA 1HXHA 2CDRA 4L0QA 3KKNA 3N0TA 4FQ5A 5IT9A 1WZUA 3O8DA 3PEUA 3S7ZA 3K7EA 1BDMA 4QIHA 3WKCA 2CW5A 3UMVA 3WO1A 1T3SA 3IAFA 2M6RA 4GMDA 2XD4A 3C15C 3BXZA 3BMXA 4MKFA 2QF7A 3QMWA 3B1VA 4PRKA 4YJ3A 4GWLA 4KL8S 4YLYA 2AN9A 4IIFA 5CVEA 1L8QA 2J3LA 3BFJA 3CLVA 2QZPA 3LVBA 3OCJA 2AG0A 4X8MA 5DLDA 4RFSA 1VHTA 1K7XB 2HCJB 3FF4A 5BUQA 1V8OA 2VPPA 5A71A 4N01A 4UDNA 5IYZF 1MHPA 3ELYA 1HETA 1G0NA 2QNBA 1ZRNA 2Q5HA 3EGVA 4S24A 4YNBA 3VR6H 1ZJJA 1U3FA 1NN1A 1W1IA 1Y7LA 1PEYA 2OK7A 2GM3A 1TYZA 2W90A 3F6PA 2O7NA 2YS6A 2QD4A 3TX2A 2OBNA 1VHLA 4GGOA 1QTQA 1KDRA 4R51A 2P78A 5IJXA 2OG1A 3DE5X 4MKGA 4NCIA 1VJ0A 3GJRA 4GYKA 4QVGA 1K5GA 5DE3A 2JGRA 4AO8A 2XUOA 3FA2A 4K81B 2WQ7A 3IQHX 4GG1A 5C8VA 4MDEA 3NORA 3QPVA 4HSEA 1BEZA 3CLRC 2AHRA 2HV9A 1ULUA 4C6TB 3LX8A 2BGWA 1RRCA 1U3UA 1QONA 4D74A 2OFXA 1XNJA 2IIVA 1U6JA 4F2DA 2CBGA 4RQUA 4B6PA 4Z4HA 3PIRA 4LNUB 3VR5D 3KNZA 1ATIA 4AZ0A 3BEDA 3AVOA 5T5QA 3EDRA 1MB9A 2DM6A 3QKTA 3TD2A 4YUXA 1FMFA 5IJ0B 2P35A 4QU0A 5DM70 5EPOA 1NASA 3P96A 1U5CA 2H48A 3QF4B 4NL4H 1NF9A 3NTXA 4MVJA 2GYUA 4Q0MA 2V0CA 1L3BA 2W8BB 3CZQA 3VDQA 3R09A 3V1NA 5C34B 5JH7B 1NP6A 2ODNA 1CR4A 1UAGA 4TMKA 1SUEA 1I4EB 1C9DB 4JJ6A 4A6EA 4RF3A 1W9MA 4Z51A 5EMKA 1DEKA 4PNEA 1G59A 3GDFA 4AU1A 2D13A 3KKOA 4ZAYA 1AQUA 3BMQA 3PZBA 4JGGA 3VSEA 5H3CA 5LXTF 2D7JA 2J09A 2QX7A 3G1WA 3M2PA 5EWMA 2QI9C 3X43A 4FJ2A 3KXDA 2PKCA 2GRUA 4KQIA 3ZBPA 3LUKA 1IN1A 1YCGA 2JAUA 3NEJA 3LDUA 1R6BX 4BO2A 2I9PA 4HDAA 3BMNB 2CXUA 3I9V1 3TOSA 1HNWB 2QUBA 4JBGA 2PUHA 2V7EA 4OIMA 1Z2PX 1SK9A 3UT5A 2SICE 4TL6A 1T4DA 2WJ4A 3T1NA 1CJMA 2HHHB 5CB8A 3LP6A 4WD3A 1RPTA 1WXQA 2BCJQ 2O07A 1IULA 2FXIA 2DFTA 2VSNA 4LY6A 1L3CA 4NEHB 4LFCB 2GN2A 3NVDA 2KYRA 3WK4A 3IR5A 4X94A 1U0NA 1V7CA 3KOZA 3OCUA 1JMKC 4G0NA 4TV8A 3Q7IA 4XCQA 4AJ2A 4EW2A 1X70A 1ISRA 4YMLA 1G20B 3AFMA 4DQUA 2AMJA 2AC4A 3PGMA 1KYVA 4M8LA 4EJFA 3R8FA 2GILA 2YYYA 1PUIA 4G65A 4N4AA 2CK3D 1B2LA 5CLQA 2XGSA 1FFHA 2IYNA 5TPWB 4EHJA 3W8FA 3N9IA 2E4YA 2WAMA 2EFHB 1ZCAA 4Q9HA 4HLDA 5SV2A 5A3QA 3DE4X 5KIAA 5LOVB 3UMMA 1XO1A 1NKVA 2FZLA 1CF2O 1BFKA 2FQXA 2ZVJA 1W30A 5HG0A 3SR0A 3UTDA 2AZTA 4C7BA 2ZIAA 3UBTA 4IXWA 1VE1A 2YZKA 4XWGA 5EFOA 4UHEA 3ZTWA 4S2UA 2AVDA 3PC8A 3WGZA 3K5HA 2K87A 1CZNA 3DONA 2W4QA 1GR0A 4YRGA 1U3CA 3O0DA 3GRYA 3HK2A 3H3FA 1EVZA 2PH3A 2VSQA 3QF4A 4NARA 5ICEA 1KH2A 2WJVA 1P31A 4CTKA 5CEJA 2VP2A 1C3VA 1FVHA 4OQYA 4ND5A 4BX3A 3PDWA 4I50F 1US8B 4XVQA 5LU8A 5KOYA 3LTNC 1JKIA 1LPPA 2QTNA 2NIPA 1IE3A 1HLFA 3D8SA 4IJMA 4MUXA 3USCS 5K6RA 3CKMA 1NU6A 2C9BA 1V16B 2EXXA 1P0CA 2EEPA 1HH4A 4DTIA 1W0KD 1AQLA 4FM9A 1PGQA 1ORRA 1UBOS 2CLMB 4CTOA 1E9CA 3H8SA 3WIVA 5IAOA 4X7BA 1Y8RB 2AYYA 5CW2A 3UMSA 5BRAA 2I3DA 3BKXA 1SHUX 1JG1A 1I30A 2YN4A 3DAOA 5B30A 1UMKA 1KE2A 3IUEA 2XCTB 3H2SA 1GPMA 1TVCA 2A78A 1MJ5A 2R87A 2HJRA 4N0EA 3C8ZA 4WHMA 2BDUA 2OXIA 1UOOA 3KQOA 2O8CA 3WL6A 1HSZA 1JDBB 3HR8A 2C4TA 4NONA 3SIWA 3ESAA 4MKXA 5B1DA 1EA7A 2EG5A 1M2VA 3CUKA 1NI4A 1E1RA 3ESQA 4BECA 1XEWY 4KXVA 4BWVA 5I45A 1G5FA 4ER6A 1MIOA 1WXEA 4JODA 2L82A 2HTEA 3R8XA 1U7OA 4HYQA 4WK4B 5CAEA 3AILA 4JB2A 4QPDA 4D0GA 5HBRA 2UXDB 1XMPA 3KU4A 4H08A 2VSFA 2BFWA 4JR0A 2O3UA 2ZBVA 2A5YB 4A82A 4HTFA 1KKUA 1EFRD 1UKBA 5HFNA 2HXSA 3ZY4A 4ECEA 4F4UA 3H1TA 1G3MA 5EINA 1ZL0A 1LRKA 5BOSA 5F2KA 1JLMA 1Z6PA 4HSGA 1IUKA 3KR9A 4GP9A 2ILTA 1L4BA 1F7UA 3E9CA 3O4HA 4G85A 3PV0A 1NJ5A 2F4NA 2R7AA 1P61B 4H27A 3TTUA