1ZD9A

Structure of human adp-ribosylation factor-like 10b
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
SKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like 10B
publication title Structure of human ADP-ribosylation factor-like 10B
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 57
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zd9A00
2C78A 2GVZC 2AL7A 5FBRB 1PVOA 4DCUA 2G0NA 4K8OA 4XVUA 1WBDA 5DI9A 3OZXA 2PEYA 3OAAD 4KV9A 3BJIC 4Q4JB 4AURA 2YNMA 2ZR9A 1R4AA 4UNNA 1ZCAA 1Q1QA 1XPOA 2AX4A 3W3ZB 1OYYA 1W49A 2GF0A 1S3SA 1TQDA 1U0HC 2O5VA 1DTSA 5LD2B 3JVUA 3C41J 2QP3A 1U8AA 1RRGA 2IA5A 1YZLA 1ZU5A 4B34A 3KKPA 2RHDA 4CT5A 3EPHA 3QOFA 4IVPA 5HCNA 4BFTA 3R9WA 3CUEF 1VG8A 2ZTSA 4OKSA 3MJRA 4FMCF 1QG2A 1XTQA 2BKEA 2WAXA 2FE4A 3QXHA 5JBQA 2J59A 4CEIB 1GUAA 4GP7A 1E9AA 3QBTA 2QT0A 2QRNA 3B60A 4YDSA 3EX7C 2OCAA 4Q1DA 1G18A 4DLVA 5ELXA 3P32A 3A1VA 3QG5A 3NBFA 4NYMR 3FKSA 2ZJYA 1OKKA 1E2HA 1I2DA 4URWR 2R2AA 1RJ9B 2FPKA 1NJFA 2EFDB 3MFYA 3WRXC 2WPDD 3AB3A 3DM9B 5J4YA 3GLGB 2X2FA 1P73A 1R0XA 3IKJA 4MUBA 1R0WA 1L2TA 1M7GA 1OFIA 1HY3A 1WA5A 3I72A 3TSOA 4MKGA 1ZNYA 4EFNA 4R2IA 3KQKA 4M4SA 2C9YA 5FOXA 1WBBA 1JNYA 1NY6A 2DFKB 2HCBA 3C5CA 3RRMA 3SOPA 2WWWA 3SN6A 3I32A 2WJIA 1O3YA 2XTNA 5CIQA 3CZPA 1TEVA 4QHTA 1CJVC 3BOSA 3QBVA 4HAZA 2C77A 1G8HA 3RSLA 5EXXA 1N6HA 2P0EA 1Q3HA 2BDTA 3DZDA 4R71A 3U7HB 3ZIAA 1Z83A 2IBMA 4URYR 4AC9A 2ZREA 1GSIA 3GEEA 1CR4A 1OHHA 4E03A 4B6EA 1YU9A 2FSHA 4P33A 3PUWA 1NMXA 2BKUA 4HB4A 1Z07A 4Q5IA 4NU0A 1AGRA 4CVNA 2P65A 1S9HA 1DAIA 3IUYA 4MRNA 3ZZUA 1OFHA 2GTPA 2OCBA 2EFHB 4BFSA 1AKEA 4OI1A 1G8GA 2QA5A 5FPSA 2XX3A 3WP1B 1R0YA 4X8OA 1E4VA 1KJZA 4P3YA 2FGJA 2J5XA 4QBFA 4LYAA 2C04A 2QNRA 5JSZB 3AEZA 1DO0A 3OFNA 4TT3A 2HT6A 2WSMA 2J0UA 1DE0A 2V4ZA 5EE3A 3ND9A 4LHWA 1G3QA 2HF8A 5FTJA 3W6NA 4EFLA 2IS6A 5FFMA 2WIBA 3RYTC 2FU5C 4Q47A 1YE8A 2NO1A 1E0SA 1G5TA 3GFTA 3AP2A 1AZTA 4PC7A 3PUVA 4WOPA 3TAHA 3ZH9B 2DFTA 2FPMA 1DELA 2AD1A 4JVNA 3GLHB 4M1OA 1P9NA 5CIWA 1MO5A 1TQ2A 4URXR 1G8YA 2W0SA 1Q3TA 1CJKC 4Q00A 5IT5A 1QF9A 1I4LD 4G1UC 5JI3E 3Q7QA 2XJ9A 4IJMA 4BRWA 4II7A 3B9QA 1IXZA 3IEUA 1FX0A 3AP3A 1ZC3A 5GVRA 3TQFA 2ZJZA 2ONJA 5LDDC 1T9HA 3CRW1 1BS1A 3QXXA 3GPLA 1IN8A 2WIAA 4TSFA 5DIFA 4N1AA 1E2FA 1G6HA 2KBFA 5P21A 1X6VA 5FL3A 3T1QA 2AFHE 3FHOA 3LV8A 3P26A 2O0HA 2VP4A 4N0EA 1IHUA 1D2MA 1KKMA 4GL2A 4PC2A 4V0NA 4Q02A 1OXSC 2DFNA 4F4IA 3X2SA 3BB4A 4JLNA 2QROA 3NHAA 2MMGA 1VCNA 1AA9A 1S1CA 2F9LA 2NO7A 3HPRA 1Z0KA 3K1JA 4UNPA 3TVTA 1SXJA 4WZAE 3VHXA 2FFAA 1G5RA 2ZRMA 3A4MA 2B7CA 4XIGS 2RAPA 3RANA 1II8B 1O87A 4D4LA 4CEJA 4JS0A 2BCJQ 2IUSA 3RABA 3O8CA 2BVNA 4M9SA 3NDBB 4TZ6A 1OXTA 3KQLA 2EFGA 3GQBA 5H8WA 2W00A 3BB3A 1BO6A 4JVMA 3T5GA 3AM1A 3W6PA 4ZCLA 3CPEA 3OEEA 4TMWA 1ZW6A 2VF8A 3EC1A 2ZJ5A 3A1UA 4HB3A 4GOXA 1Q12A 4AIIA 1UAAA 4M1KA 4DLYA 2A78A 3CNLA 4BGDA 3LVQE 2QORA 3CNOA 4TSFD 5DHFA 2A7QA 3WYGA 4A2QA 2WPDA 4HLUC 2C96A 1ZAKA 3SFZA 2J3EA 3R9XA 2YOFA 5CK4A 1XEXB 2B8WA 2CVFA 3K09A 5KDLA 2F55A 4PQFA 1KJWA 1II9A 1ZUHA 2GEVA 4O25A 2VSXA 2JLWA 2IYSA 4Q4JA 4GZMA 2NPIA 2GBLC 4RZUA 2ZI4A 1MOZA 3OF5A 2FH5B 3F0TA 1MABA 1HT1E 4E5UA 2P6RA 5FPKA 2G83A 1NG9A 5CB8A 1TX4B 1R8QA 1VYUA 5HZHA 1GVNB 4LBWA 4WBSA 3KXLA 4KVAA 1GNPA 4JBXA 2OFWA 4KI0A 5CLQA 5EE5B 1WB9A 2JIZD 1S2MA 2IW3A 3U4QA 1E9RA 4QJ5A 4PHGA 3AF1A 5BWMA 2JLVA 1ZU4A 4B74A 2OFOA 2Z4SA 4CEIA 5KSPA 1IXRC 4A2PA 2IL1A 2L0XA 2CXXA 3FMIA 1UBGA 1UDXA 4BFWA 1DG3A 1NLFA 4FW9A 5IK2A 1VG9B 3Q3JB 1G7CA 1UKZA 2VHQA 3NH6A 4Z51A 5HE8A 1CBUA 3ZS9A 2C99A 4XVRA 5KNDA 3T1VA 3ADCA 3W6OA 5KYKA 4DXAA 3O8RA 3L0IB 3LLUA 3QF4B 4XSGA 1DS6A 5DYIA 1TNDA 1ZD8A 3B5JA 4URVR 3PQCA 4RCYA 4DDWA 1OB5A 1E0AA 4G5QA 2ORWA 1XD9A 5KPDA 2CJWB 1VIYA 4RKEA 3T1OA 3OE7D 1W46A 4QHSA 1FZQA 4D4JA 2QP4A 5FR2A 1KI1A 1UPTA 2NOAA 4HLDA 2X8AA 2HF9A 2J0QA 2VO1A 3ZIAD 5LB2A 3I73A 2NO9A 1D5CA 1UBCA 3NTUA 3LDAA 1Z6GA 4UJ3A 1T4GA 3TIFA 4PPQA 1SKQA 1PLJA 3HP1A 1EFCA 2CL6X 3OEHA 4PQRA 4PSKA 5EUQB 4D4MA 2HLDA 4O0MA 1UKYA 1UBEA 4LYHA 4Q9KA 4IKEA 1LVGA 1RRFA 2G1JA 3QIAA 4B3CA 2ZSBA 3ZGXA 1KHTA 2KI5A 1JQLB 2WOOA 2HXSA 1Q1EA 2PX3A 3B1VA 5HKKD 5FUYA 2VRWA 3NEJA 4NMMA 1DAKA 1Z0JA 2QTVB 4CIDA 1FW6A 5DI3B 1E2QA 2A3RA 3C7KA 2H18A 3T1TA 3GJ5A 3GP8A 2NIPA 4AD8A 2IX3A 4BWYA 2W2XA 4D25A 2VSOA 1G7TA 3P1JA 1XPRA 1CEEA 2Q3FA 1D6JA 2F43A 1FQKA 2VYFA 4Q19A 1GRNA 2GHIA 2BIFA 5CYPA 1S9DA 3KKOA 5GJVC 1R7RA 4MGYR 1KYIA 1Z2AA 1UKVY 2CDNA 2KBEA 2Z4RA 3OIWA 4LJAA 3TR0A 2WVJA 3PXGA 2WOJA 2QM7A 2ZEJA 4PAQA 4US1R 2ZANA 3WHLA 4DDTA 3HPQA 4BRUA 3VU9B 2CL0X 3EZ9A 1W0JD 5LBIA 4O2LA 1QG4A 2Q9CA 1P2VA 4YXWD 1XRJA 1ZYUA 1A7JA 3HU1A 3LRPA 3EPLA 2GXAA 5IDVA 4NCNA 3B2EA 4ZCIA 2GAOA 2R9VA 4NCHA 5DNYB 2WMNB 4TYWA 1M8PA 5M04A 1XXHE 1IOZA 1QRAA 3E2IA 3CX8A 3NXSA 4Q9IA 5BXQC 2ZPTX 4QGHA 4W5JA 1GM5A 2A5DA 1Z3IX 1NMYA 3QY0A 3SR0A 4G5GA 4KYIB 2EWWA 1AS0A 3PIRA 4DCSA 4Q1EA 3AF4A 1NBMA 1YZTA 3VX3A 2J7PD 2MMCA 1KI8A 1YZGA 2BBWA 1R5OA 4S2EA 3ICQB 4WA7A 4OI2A 2BBTA 2EYUA 3CH5A 2VQSA 4HAYA 2EVWX 4AKEA 3I5XA 4JKIA 1N6RA 1U9IA 4R7ZA 1UADA 3KXKA 5TXGA 2D2FA 4BLRA 3G82C 4JKYA 5KNBA 1IY2A 4J0QA 2Q3HA 4B35A 4DHEA 4ZI2A 4B76A 4RD6A 1LS6A 2KE5A 4PSAA 4RJLA 4A92A 1A4RA 4TL8A 3RWMB 2JLRA 4IDOA 3HJNA 3ZQ6A 4B47A 4DZZA 4P4UA 1XTSA 1DPFA 2LKCA 1E4YA 2CEAA 1VKJA 3CB4A 3K0AB 5TMPA 2G6BA 3CF0A 1TF5A 5FTNA 2FFQA 3R9IA 3T61A 2GCNA 3P27A 5AJVB 3AQ4A 2CVHA 2IHYA 2OCYC 4C9BA 5FUWA 4ZV4A 3GJXC 4DWJA 1WF3A 3HU3A 1OXUA 3S1AB 3ZDQA 1S96A 4IFBA 2VA8A 2NGRA 3K0CA 3L82B 2REBA 2ZRHA 2JAQA 2D62A 2Q3MA 4BECA 5K8IA 4M1YA 4Q9HA 4TQ9A 2UZIR 4NYIQ 4ZKEA 1XEFA 3PEYA 3B82A 1Z6XA 1WCV1 1XWIA 1KGDA 1ZM7A 3KJHA 4U02A 1YZKA 4WAUA 4WZBE 2VHTA 3SHFA 3GJ8A 4L8GA 3WNDA 3IIMA 1P61B 4TTPA 4IEIA 3Q5DA 5JCPA 1Z5ZA 2JJ1A 1NN5A 3MGCA 2O8DB 2ZS8A 2JLZA 1NRJB 4PQYA 4MYUA 1CULC 4PO1A 4LX0A 2VP6A 3SJAA 1ZMXA 2FFBA 3BE4A 3PEWA 1P9RA 4QGGA 4N0DA 4CYMA 2J45A 4YLGA 1LS1A 2AKYA 4TTQA 5KTYA 3BFXA 2V7QA 4ZKDA 1K5GA 4B3GA 1W0KD 4RCZA 4C0QC 3QVUA 2EWVA 3QNUA 1GOTA 1G16A 1KI7A 2YOHA 1G5PA 4GFDA 4IOJA 3IGFA 3TRFA 5GJWC 2ZRBA 4S35A 2WTUA 1W7AA 4RD1A 4MYTA 3BIFA 2BMJA 4Q4AA 1ZRHA 4PC3A 1XTJA 1FUUA 1XB2A 2GJKA 1ZC4A 3CF2A 3ONWA 1PV4A 3DKPA 1TAGA 2YINC 4FCWA 2W6JD 5DHAA 1TF2A 3LBHA 4JVSB 4C0AC 1ESMA 1KK3A 2Z83A 1KNXA 1X8LA 1WRBA 1IJEA 4CW7A 1HURA 3CKLA 3EG5A 5FOVA 1S3GA 2Y8EA 3AKEA 5KO2A 2JJ8A 2XXAA 2HLDD 2ORVA 1E0KA 4XWKA 1GTVA 2D06A 4G3XA 2ASEA 4LK2A 4EQ6B 4NP6A 5TARA 4TTRA 4KODA 5B2ZA 4ESVA 1HT2E 1GNQA 2WJJA 4LV8B 3SU8A 2ZJAA 3LW8A 1J70A 2QAGA 1TADA 1ODFA 1P75A 1XCPA 3AVVA 4IOMA 4QM6A 3LFUA 1EFUA 3T34A 2ZVQX 3L43A 1AZSC 3KXIA 3QQ5A 4OHVA 2F7SA 3LXRA 3QE0A 2N46A 5EXPA 2G9NA 621PA 4TMKA 4LC1A 3K8YA 2VP0A 2OLJA 1R0ZA 1Q57A 2I1QA 1U8YA 2DWQA 5J4LA 4RFSB 2REXB 1XD2A 2DFLA 4JLMA 4LJ4A 4L5BA 1M1YE 1LFDB 2ZJOA 1Z63A 1COWD 1ZNXA 2PZFA 5KDDA 1P2UA 2IXGA 3PENA 2HT1A 1F2TA 3VTKA 4EPWA 2YV5A 1G64A 4KLZA 4EKDA 2OBNA 2BEKA 2ZYWX 2W6ID 5FL7D 4PPGA 3UK6A 5J4VA 1F60A 3NBZC 5AJZA 3AUXA 2V1XA 3VKHA 1E2NA 1OB2A 4EIWA 2Q6TA 1QHHA 4JT2A 1NF3A 4NCIA 2P2LA 5LD2C 3EIEA 4QXAA 2JIZA 1YVDA 2ZJBA 1VTKA 3LVRE 4OI0A 3UMRA 2R65A 2GXQA 3EIQA 4URZR 3I5YA 5TB5A 4A0RA 3A36A 4C7OB 5SZJA 4Q9LA 5H1YA 4RFVA 5HCIA 4OHXA 2RGGA 1KI6B 1P62B 2OSBA 4M9ZA 1XDBA 4OQLA 3EASA 5JCZA 2OE2A 5LPNA 2J7PA 4DC9A 1CJMA 4Q03A 4KFSA 1G8PA 1KK1A 4IW3B 4V03A 1G3RA 3OAAA 3REGA 2QMHA 2FFHA 1KZGB 1KK2A 3CBQA 4I1UA 3A6PC 3DMNA 3ZLJA 4BLOA 1E9FA 4PPNA 4OQFA 1IBRA 5JS8A 3CM0A 1RPZA 1M6NA 3ICEA 4TZ0A 1JR3A 2GJAA 3U61B 4I1VA 3AVTA 4MA4A 4PC6A 1E2MA 2PH1A 1NIPA 4U00A 4DBLC 3PCRB 4TL6A 2VLIA 1ZIPA 2VHUA 4B48A 1X3SA 4HZUA 3QF7A 1CRPA 4JLDA 1F5NA 2O8BB 3T15A 2A5FA 3VR2A 4LWZA 3PUYA 4FXPA 3IPYA 1KDTA 2N1BA 1KAGA 2BJVA 1ZUNB 2RH5A 1Q0UA 3KTAA 4GSYA 1M7HA 4I81A 1G21E 4MDFA 3QI2A 1E1QA 2IYXA 5CM8B 5C18A 2JDID 5C2JB 1ZD9A 2QPTA 1QVRA 4C30A 1J99A 1T5IA 1LNZA 2YWGA 4B2PA 4AWXA 1GL9B 3FYHA 3H1TA 5HZKA 4Z1MD 5BW8A 2YOGA 4I1SA 3NDPA 1CS4C 1P3JA 3E1SA 3ZJYA 1HYQA 2O8CB 4NHOA 1HTWA 3WMGA 1MH1A 1IJFA 1XD8A 3M4YA 2XTZA 3TGPA 2D2EA 2QI9C 4LBVA 1PZNA 2YWFA 3FMOB 1QZXA 2PZGA 1G4UR 1N5LA 1XMVA 2RGCA 2VP5A 3LWNA 1AS3A 4KAXA 2BCGY 2AFIE 2QBYA 2QAJA 1KDRA 2DHRA 1IM2A 2WBLC 4JVLA 1GP2A 4Q66C 4B43A 5JWHA 2JJ1D 3QKRB 2BEJA 1OE0A 1G7RA 3QKSA 1XCGB 1XTIA 2MSDB 2CBZA 3THWA 1NIJA 3TUIC 1NVXQ 4D0GA 1ZUIA 1W4RA 4YC7A 4YXWA 1UDWA 3VR3A 4JIMA 4FWIB 3Q5EA 2GCOB 4Q1BA 4A0FA 4US2R 1EX6A 3I3SR 2IEYA 2HDNB 3U44A 4A8JB 4JLKA 3BK7A 5FBWB 2OBLA 5H68A 5CITA 1MO4A 2O8CA 3KKNA 2H92A 4TN1A 2CNWD 1RFLA 3Q7PA 2DBYA 4NTZA 2QPAA 1FQJA 4JLAA 2CJWA 4DRZA 1MRSA 1MV5A 2EFCB 1GRRA 1YR8A 1L7VC 4BFVA 4Q21A 5AUOB 3AVPA 3BD9A 4Z1MA 3VNVA 2OAP1 3ZD7A 3V4RA 2QBYB 3H0KA 5FTMA 3OFND 1JB1A 721PA 4ARZA 1OJLA 1U2RA 3DO6A 4D82A 3HR7A 5AJXA 3BORA 3D7MA 4TQUS 521PA 5E4FA 2ZJ8A 4LJ6A 3K9HA 5TV2A 3IHLA 3QPUA 4EPVA 1AJEA 1R2QA 4KJZA 1N5JA 5E7MA 4AYWA 1AQYA 4TLDA 2PJRA 1G6OA 3E5HA 2Z5FA 4RD4A 2WKPA 1SKYB 1CU1A 2WKQA 4HUTA 2GJ8A 3SFVA 3F5FA 1KDPA 3KJIA 2XOKA 1US8B 1EFRD 2J0UB 2XSZD 2LCFA 3WYAA 2ATXA 2JJ2A 2VIIA 2VHJA 2ZUBA 4EDHA 1L4YA 3K70C 4CRWB 5JLJA 3ND8A 2VHCA 4GT1A 3GLHA 1NBMD 2QE7D 2ONKA 3M6AA 4WXPA 3I92A 3CWQA 1DAEA 1KZ7B 1T8UA 1NY5A 3CPJB 4C4PA 3MLEA 2FX3A 4F91B 1D2EA 1MKYA 3P20A 4A0GA 4O3MA 2IT1A 1JPNA 5CDFA 3JZMA 1J7KA 2VH5R 3KX2A 5KDOA 1GL6A 3ADKA 4A8JC 5AUPB 3TAUA 3L0PA 4ZO4A 4KCGA 1GNRA 4GRAA 4LRWA 2E9SA 2WWIA 3RLFA 1ZJ6A 2K5UA 3GFPA 1KNQA 3K09C 4YMWA 3SJCA 5DN6D 3IO5A 2QPOA 2IYTA 2WWHA 1FNNA 4JSTA 2VF7A 3KJEA 5JFGA 3VU9A 1N3BA 1U98A 1X1RA 2QQEA 4TL7A 1WMSA 1YZQA 3FPAA 2I3BA 4DSTA 2ZRPA 2A5GA 4PHTA 4TMTA 3C4JA 2ZM5A 2IYRA 3LQRA 4DSOA 3SYLA 2GF9A 4RFSA 2A5JA 3B1YA 4ON9A 4M21A 1NMZA 3HR8A 4FCTA 2B6HA 2CHGA 2PLFA 3B8HA 1VCOA 3U3RA 5BN4A 1N6LA 5CDFE 1EWRA 1IQPA 5JRJA 1OXVA 1Z22A 3BC1A 3IBYA 3C5HA 2IK8A 4FCVA 4DSNA 3QPWA 3VMFA 4C0HA 1E6CA 1FTNA 4JLPA 4XH9B 3GJ3A 5B58C 1ONBA 1XMJA 3QG1A 2SHKA 3BH7A 4EJSA 1B0UA 5C4GB 2O8FB 1ELOA 1CR0A 2WHXA 2OUKA 2ZI6A 2OBMA 3Q8XB 1E9SA 3EZ7A 3VQTA 4NH0A 3WY9A 5SZKB 1WE2A 1HE8B 1E1RD 3SQXA 1XXHA 1YRAA 4HDOB 1KSHA 2FG5A 1XEXA 4IEEA 3MUFA 3D6TB 1W2GA 1U8ZA 4AKGA 1ZM4A 3SC3A 3REFA 4B44A 1XP8A 1OH6A 2DWPA 4TYYA 2V8OA 2QE7A 2D74A 3GFOA 3VR5A 1KDOA 3OE7A 5G3ZA 4BUJA 1V5WA 1KMHA 1CJTC 2VBCA 3LBIA 3GLGA 3NKVA 4LJYA 1SULA 3C15C 3ZYCA 4A15A 4M8NE 3S1AA 4MRSA 1RJ9A 4H1VA 1OXXK 3TH5A 1PUJA 4GI7A 821PA 2BC9A 1LB1B 1EX7A 4TT3D 1JALA 4V0LA 5B30A 2GCPA 3PITA 4LPKA 2IS4A 4NKRA 2RGAA 2V1UA 1XXHB 1H8ED 3GEIA 2B92A 1D9XA 3R8CA 1ZINA 3SYNA 5JI2E 3G5UA 1S8FA 2ZQ5A 3I8SA 1W44A 3QF4A 1NVUQ 1ESNA 4M2LA 1H65A 2O0KA 3W3AA 3VNUA 2ZJ2A 2WMOB 4IFEA 1OIXA 4WVFA 2V55B 2RCNA 3PUXA 3K9LA 4ITRC 4JL8A 2H57A 1E2IA 2F3TA 2ZRKA 1HQYE 3V00A 5IHPA 3EWSA 4B3DA 2JLXA 1XFAA 4Y0AA 5L3VA 1E79D 4Q7LA 4QKQA 1SVKA 2W2TA 1KO4A 1QHNA 2B8TA 1AGPA 2GEDA 2QRZA 4UQOA 3UXMA 3JZAA 1OLOA 2X1VA 3LD9A 4TYQA 2ANBA 3U6BA 2ZSAA 5JZVA 2GZAA 1Q1ZA 4C2UA 1N25A 1YRBA 3W5JA 4YMSA 3TK1A 4CF7A 2AKAB 1ZD1A 2WWXA 4XVQA 1E2LA 2AR7A 5FR1A 5A0FA 3U5ZB 2J41A 2Z0MA 4PPFA 5KSOA 4NE2A 2ZRAA 4ABYA 5JSZA 2Q0HA 3K0SA 3MD0A 2QSZA 1SVWA 1SHZA 5L3RA 4AI6A 2IS2A 3U60B 1Q44A 2P5TB 3SJBA 2G0TA 1LY1A 4JLJA 1A1VA 3ZS8A 1YR7A 5FL7A 3AVYA 1G20E 4N3NA 3FKQA 4R9UC 2VP2A 5L3QB 2GZDA 1PJRA 2GILA 2ZSFA 1OKKD 4L4UA 1IY1A 3KZ1E 2BMDA 4K46A 5JWOA 2QN6A 3MG9A 5UKDA 2J9RA 3X1WA 5G53C 1G291 3QEJA 1KKLA 5ANRB 5EP1A 5FUVA 5FPYA 3IEVA 1NVWQ 3BH0A 2QUZA 2F43B 2AN9A 2PCJA 3BWDD 2GDJA 3QENA 1E99A 1V43A 4UJ5A 3B1WA 1ETUA 1KY2A 2WSSD 5FTLA 2ZS9A 5FOTA 1SVMA 4NYIR 2C9CA 4LV6A 3THYB 4CT4B 2H16A 4JLVA 3EAQA 1HV8A 3UWOA 2VSFA 1I2MA 3KB2A 4F4JA 1JR3D 5CM9C 4JLOA 1JI0A 2EQBA 2JATA 4ZDWA 2LWIA 1F2TB 1CTQA 1FL9A 1I4TD 2HEIA 2Q21A 5J4KA 3UIEA 3B85A 4HB0A 1WP9A 4L15A 4TYPA 3AVXA 1AKYA 3RRNA 2QENA 1N0WA 2GRJA 2P6UA 2A5YB 1T6NA 2WKRA 3B6EA 4R98A 2AXPA 4U5XA 3R20A 4P32A 4ZIRB 1SXJB 2R6FA 4RZ2A 3Q72A 3U7GA 1KOFA 1JEDA 2IC5A 3W5IA 2GJ9A 3WP0A 1GKIA 1II8A 4US0R 1G41A 4B73A 1WXQA 1S0UA 4D6PA 2FZ4A 1Q1BA 4B3FX 1CF4A 2OV2A 1MT0A 2D7CA 3R7WA 1Z0IA 4OQXA 4CEJB 1VCIA 1L8QA 3TSZA 2ZITA 2AK2A 3RVBA 1BYUA 4TWZA 2QAGC 4MRRA 1SVSA 4LHYA 3GMTA 5JMTA 3MRSA 2D3WA 3QSYA 1R6BX 1UFQA 4JBWA 5DH9A 2FJUA 2GVDC 5D3QA 4YONB 2CHVA 5L8VA 1I4DD 3N5CA 3QXJA 1CIPA 5IRCD 2BM1A 3SBEA 3H86A 3HYTA 4FWTA 4TMXA 4POAA 2OAQ1 4PFSA 4LJ9A 1J8MF 2P6NA 4OHZA 3VKWA 5AK0A 2J1LA 1IN5A 1GKUB 3KFVA 1OH8A 2ZAOA 2YHSA 4BPBA 1GIAA 3FMFA 3GLGE 4HUQA 2FZLA 3TR5A 3GJ0A 3KL4A 3WBKA 1D8TA 1MRNA 2F1HA 3QVVA 1Q21A 2RGEA 3OESA 5C4MA 1U0JA 2XB2A 2IHBA 1G4AE 1MABB 4RKFA 2ODNA 4LYFA 2ZYTX 1IAQA 2JGNA 4DLWA 2AWNA 5H70A 3X1DA 3DDCA 2QMUA 3LAWA 1T0JB 3EPKA 4JZKA 3RS3A 1XJ0A 2IYVA 3IDQA 5F9FA 3K0EA 3PR1A 3A1SA 3P4XA 2NQ2C 2V6IA 4LPSA 4PZLA 1J8YF 2CLSA 3ZVNA 2W83A 1NSFA 2QG6A 2O8DA 1KTVA 5F2EA 1YQTA 221PA 4HUQB 2R44A 4LCBA 3U3JA 1KI9A 2KB0A 2CL7X 4PSVA 3O8DA 3RC3A 2PLRA 1FMLA 2R6GA 2H17A 5JJKA 2QGZA 3WMEA 4CGZA 1JECA 4D4KA 5FPHA 2ZR0A 1NN1A 3THWB 2BBOA 1JEEA 2YJTD 5DYGA 4DIDA 4EPTA 1DOAA 1NN0A 2GK7A 1LTQA 3FFAA 1OH7A 2YZ2A 4IOLA 1PLKA 1XBTA 2WAYA 2H1LA 3TBKA 4D0LB 1DAHA 4XSHA 4ZPXA 1AQUA 1GZSA 3RS7A 4V0MA 2DWOA 2OO7A 1DAFA 1FOEB 1GL7A 1RRPA 2XJ4A 5CLLA 3AGQA 5JEDA 4E09A 5EXSA 3MMPA 4ERNA 3CO5A 4V0ME 1KK0A 5FH9A 1XCMA 3MAAC 3R8FA 2XXAB 1VDZA 3BFKA 3AVUA 3ZQJA 3FMPB 4Z54A 5FBVB 1E3MA 4M1MA 4KXFB 4OQNA 4M9QA 3HWSA 2D4HA 3UATA 1W5TA 1OV4A 4MKHA 2ZRNA 2UZ3A 3RHFA 1Z6YA 4Q18A 3QXSA 4DB4A 4DVGA 2YWEA 3K0FB 4KFTA 1W0JA 2R8RA 4DIEA 4AY2A 3GLFE 1FP6A 1GRQA 3THXB 2UKDA 1T8TA 4KYUA 2IS1A 4YDHB 3VFDA 4OQMA 2OLKA 1Z2CA 4NBSA 5KSYA 3BGWA 4KVGA 5JHHB 5GADl 5JEEA 4XOIA 2DB3A 4PHHA 1H8EA 1BH2A 2NPFA 3MCAA 2GBLA 4MGZR 1JAIA 1SHKA 2RGBA 2W58A 5GVSA 3CH4B 4U7DA 4F93B 4B71A 3FKSD 1G3MA 1A2KC 1SZPA 3PEVA 3TLXA 3TNFA 2ECKA 1N6NA 4C0BA 2CCKA 1UKEA 1AM4D 1YHNA 4A36A 2REOA 2ZYUX 4DKXA 2OXCA 3P4YA 4NCKA 4DCTA 3N2IA 2CMKA 1XEWX 1W47A 3B1ZA 4IRUB 3DM5A 4P4TA 4CZ2A 1YKSA 2IXFA 2JJ2D 3AV0B 4LSGA 2OT3B 5G3YA 1XJCA 4QGAA 3T5DA 4BFZA 5HKKA 5EP2A 2GEUA 3I61A 4KLNA 3I62A 4JT4A 4LDJA 3A4NA 3WRYC 4XD7D 3MWLA 1TUIA 4HYYA 1VHTA 1KI6A 2BMEA 4KU4A 4X8HA 3O8BA 1P7CA 2G77B 2IYYA 1FPMA 3KB1A 3BH6A 4I4LA 4NYJR 2G1KA 2VP9A 1XU4A 4IVQA 4I99A 4B33A 2WV9A 3KDSE 1HH4A 3GEHA 2JLSA 2VPPA 2GXSA 1DAGA 4NCJA 3HYRA 4E22A 3JVVA 1PUIA 3G0HA 1M7BA 2FNAA 2XGJA 2ZRGA 1RYFA 1BOFA 2IYLD 2XZLA 1E2KA 5E3HA 1N5IA 4NPHA 1JR3E 1R10A 2XNSA 2EFEB 1W36D 2G3YA 1G7SA 2NG1A 2P5SA 4JLBA 5JRZA 5J40A 2Q9AA 2MSEB 4P31A 3EC2A 4F4CA 1SKYE 4MYHA 4CEHA 4EJSB 3TMKA 3DKVA 4QNRA 1EWQA 4X8LA 5EXTA 1YR9A 4BFYA 3Q85A 1E0JA 2ZROA 1OFUX 5JJIA 3HDTA 4OJQA 1GG2A 3AH8A 3FVQA 4DT1B 1AK2A 4LBZA 1S4QA 3A1WA 4AG6A 4GBMA 2RB4A 4A82A 1VG1A 4JYCA 2ZRDA 2ZE5A 3AF3A 1OSNA 2FEMA 2ZUCA 5AR1A 1F3OA 3SS8A 2YVUA 3PUZA 2X2EA 3ZVRA 4AKIA 1T3HA 4RD3A 2GESA 4OJKA 2EU8A 1TU3A 1II0A 5JHGB 4GOJA 4JSYA 1E9BA 1HEIA 1KSFX 4BZQA 2FSIA 3AUYA 3SYKA 1GILA 1G17A 3QKTA 1JAHA 2YC2C 1B23P 2FPLA 5FOUA 2VTKA 2QY9A 2ZI3A 4RD0A 3OIYA 1Z6AA 3LX5A 2C98A 3SBDA 1N2CE 1ZNZA 1KO8A 4C0KA 3OEHD 3A4LA 4Q1CA 4LGMA 3NIBA 2FOLA 4PC1A 2BV3A 1A82A 1NVVQ 4PR0A 4GNKA 2IF2A 2NTYC 3UG7A 1OIWA 3UWKA 4C0JA 1NBME 2GCOA 4GMXA 1UM8A 3QKUA 1N0VC 4TL9A 1WDTA 3BBPA 1Z29A 3FHCB 2CHQA 1E9CA 4UKDA 1SXJE 2AXNA 3WMFA 2GJSA 3AVWA 4RVCA 2ERXA 4QBHA 1Z06A 3AF2A 4MGKR 5GJCA 5LB4A 3T12A 2DPXA 3QPVA 2H8KA 4ASUA 5D3MB 3WYFA 3U3OA 3FHTA 3X1XA 1NG1A 4A4DA 1E98A 1SXJD 2X19A 3LQQA 3MJHA 2W6IA 1OYWA 1K6MA 2ODWA 4Z8YA 4PO8A 1U0LA 1P4SA 1F6BA 2J7KA 1XJQA 4MUAA 4W7SA 3TE6A 3KFXA 4OI4A 2E87A 2CK3D 2ZXUA 3V4FA 3W9YA 1UEJA 2PMKA 2F9MA 2C03A 3KKMA 3VX4A 3KUDA 5A4JA 2WSSA 2XTMA 4F7WA 1FX0B 2ZU0C 3CRVA 3GLFB 3EZFA 4B32A 3EZ2A 1JJVA 1TF7A 3L0SA 3EXAA 2E1RA 2YC4C 1QHIA 2ZSDA 1E69A 2I4IA 4BLSA 4DLXA 2GZHA 1RIFA 1CXZA 3DEFA 2ZR7A 1RRCA 2IYWA 2EYQA 4TLCA 1VHLA 1YJ5A 4LV5B 3ADBA 2GNOA 3CONA 4QC2A 4Z8XA 1AS2A 1DEKA 1EFHA 1QHXA 1N6OA 2WJHA 2AHOA 2ANCA 2QAGB 4M0LA 1KJYA 5HE9A 4YMUA 4TYNA 5EUMA 1IN4A 1Q22A 3RS2A 1TUEA 2OILA 4HZIA 4AK9A 4QJ3A 1N5KA 2PT7A 4QJ4A 2PEZA 1FTSA 1WQ1R 2QZ4A 2ZSEA 1DO2A 4XWOA 5B64A 3VR6A 2PBRA 1S1MA 1TEXA 3L0OA 4URUR 4KFUA 3TQCA 3D8BA 4IOKA 1ZM9A 1NI3A 1G19A 2PMDA 3ETLA 3OEED 4IXNA 4KHZA 4MQBA 5J4HA 3SDZA 3SQWA 2B7BA 3NEYA 2P67A 3J81k 3UPUA 5K8UA 1P5ZB 3LH5A 4OL0A 1QHHB 3U3MA 2RGNA 2ZU6A 1HA3A 2BWJA 4YQFA 1HUQA 2ODBA 2UVQA 4QL3A 2CK3A 2QMOA 2VL7A 3GJ6A 1NLZA 3CIOA 3LXXA 4RZXA 3K9GA 1OH5A 1VECA 2V9PA 4XJXA 5IK2D 3K70D 4PZZA 1MO6A 1GKYA 2ZUDA 2C2HA 5DO9A 3IQWA 2WWYA 3CR8A 4LHVA 3VAAA 3ZZTA 4Q4HA 4MGIR 2GA8A 5BYJA 2JCSA 1E2EA 5KHOC 3V9PA 1JPJA 5G41A 4WZ6A 3L2OB 4LHXA 4ACBA 2PT5A 1EFTA 3F3YA 4LUCA 2IEZA 5G40A 3BERA 3WBJA 2DR3A 3UKDA 1ZNWA 3OIUA 5K8TA 5FUXA 4FMDF 1E9EA 3A58B 4BFUA 4DSUA 4Q7MB 2KSQA 4PHFA 4XWAA 3FB4A 1W2HA 1W5SA 1T0HB 3BFVA 4HZUB 4BLPA 1XF9A 3OIVA 1Y3AA 5AJWA 4BFXA 5L3SB 3KUCA 3KKQA 5DSZA 2H7VA 4G5RA 1X8JA 1T5LA 4DDVA 3EA0A 121PA 4UXHA 5HR5A 4MKFA 1CR2A 2OFXA 4FI3C 3W8RA 4YMVA 3BAFA 1TPZA 2XNDA 4V02A 4WIAA 4MDEA 4L16A 5JS7A 5EP3A 4C2TA 1K8RA 3FWYA 3U7FB 5KNCA 1XZPA 1XMIA 2V54A 2OCPA 3L8YA 4Q4HB 4BLTA 3VHLB 1A5TA 2WM9B 3L8ZA 1E2DA 1SVIA 3GCGA 2QTHA 1W4BA 4M1SA 1LV7A 3GJ7A 2ATVA 1CRQA 2IUTA 2OZEA 1JXMA 1MO3A 2F3RA 2P3SA 4DCNA 3X1YA 1G9XA 4RSGA 4GDFA 3N70A 2AK3A 2QTFA 4AG5A 4CEHB 2GWHA 1RVDA 4OYHA 2V7QD 1CR1A 4Q1AA 2A9KA 2AWOA 2WJYA 4DUGD 1QBKC 4HLUA 3LW7A 3C8UA 1QHGA 5JECA 4LY6A 2GXUA 2HYDA 2OM2A 3CZQA 2RMKA 4OHWA 1KSJA 4TMZA 3B13B 3DPUA 4W9MC 6Q21A 4PZYA 2O52A 3NHBA 1P6XA 1CKEA 5C1BA 4DCVA 4HAVA 3QJYA 2QEQA 4A6XA 1KO7A 4EPYA 3U6KA 5EP4A 1PLLA 1TL7C 5EE1A 1GWNA 3C16C 4PX9A 4A8JA 2OHFA 4G5SA 3AGPA 1E79A 1R5NA 1R8SA 1ZBDA 4MITA 4PXAA 1W1WA 2C95A 3C14C 2TMKA 3KQUA 1U90A 5DI3A 2NMVA 1N6PA 1SQ5A 2MSCB 2FWRA 1NKSA 1H8HA 1E2GA 5A5GA 1Z8FA 2ZI5A 4Q01A 4D0NA 1ANKA 3AVQA 2PJZA 2JLQA 4E07A 3BS4A 2RHMA 3RS5A 4ASUD 4MYCA 5BN5A 1KO5A 2W2VA 1OPXA 1LF0A 3SEAA 2ZYVX 4ARZB 1VYVA 2OG2A 4G5OA 2O8EB 1IN7A 2XITA 3CRMA 1VCMA 4O2RA 4NYJQ 4EFMA 8OHMA 1F2UB 1JQJC 3M0EA 4D81A 1W4AA 2JEOA 4L9SA 4FN5A 2AD5A 1E2PA 1Z08A 2GKSA 1TQ6A 3EZ6A 4R2HA 2XNDD 4F38A 3B9PA 5EE0A 2Z43A 4YMTA 4TMVA 3PEUA 5F3WB 2YWHA 3IO3A 3RRZA 4LZZA 4MKIA 4QNMA 3A8TA 5FOSA 1OT3A 2BMFA 2HJGA 1G8FA 1K5DA 5EQTA 5L3QA 2V6JA 1GAJA 4Q9JA 2CLCX 3KQNA 2WZQA 3EA5A 1EESA 1EGAA 2NO6A 2ZE6A 3B78A 4KBFA 2FMXA 2F1RA 4LOAA 3D31A 1VPLA 2ORIA 4B3BA 2IYQA 3K70B 4DUGA 5CJPA 1TU4A 4HAXA 4FIDA 3ZVMA 2WWGA 4JL6A 3Q9LA 3ASZA 4JBYA 2I1VB 1RW4A 4FMCB 1EXMA 2BOVA 3IIJA 2OEPA 3MSXA 4B2IA 1Z0DA 5KSZA 2QSYA 4QFMA 3W90A 2ZE8A 5FTKA 2QL6A 4B2LA 4MRPA 1NKTA 1T3LA 4NL4H 4PAMA 4IHQA 1P2TA 1IONA 5E95A 2C9OA 3ASYA 3EIHA 5E7IA 2FSGA 2FF7A 4W5HA 2QU8A 1Y63A 3TW8B 2HUPA 3AVOA 2XB4A 3GD7A 4P4SB 3RRYA 3FDIA 4LHZA 1DBSA 4M53A 1RYHA 2DYKA 1YR6A 4ZDIA 3QUSA 3H2YA 3K0AA 1UBFA 4IDNA 3UMFA 1E32A 1GFIA 4M9XA 3VR4A 4Q4LA 1F48A 4DLSA 3FOZA 3KTAB 1D2NA 2O8BA 5FPTA 2RGNC 1X86B 2J0VA 1BMFD 1TMKA 4D80A 2CE2X 3GLHE 2BJWA 5CK5A 1QDEA 3SZRA 4BZXA 2QGNA 2R6DA 4GOKA 3TW4A 4ESHA 2R62A 1UF9A 4XTRA 1KIMA 2PZEA 1MR3F 2CNWA 2ZRCA 3DOEA 1SXJC 1UJ2A 4MRVA 1UEIA 5BN3A 3U4QB 3TUJC 3H84A 4P4SA 1QHYA 5EZ5A 3THOA 4L9WA 2DY1A 1R5BA 2ZRLA 2QT1A 2JA1A 1HQCA 2BM0A 1NJGA 1BMFA 3A1TA 1EK0A 2G88A 3I8XA 4UNSA 3ADDA 3IHWA 3WNCA 4G01B 3IPXA 5KUTA 3RSOA 1KAOA 1CLUA 2FSFA 1CP2A 5FBQB 5L3SA 1P9WA 4A2WA 2C8VA 1FP7A 2KJQA 1M2OB 5BYKA 1ZP6A 3LLMA 3ZVLA 3QKRA 4ZCMA 1IY0A 421PA 5IF9A 1Z0AA 2NO0A 1W48A 3CPHA 1EFRA 3QKSB 2FN4A 2ZE7A 2R6AA 3MWKA 1KY3A 2CCJA 3VKGA 2F1JA 1J2JA 2J0SA 5TY0A 3RS0A 4DEYA 3WHKA 1LF5A 5HPYB 4EPXA 1VG0B 1Z0FA 2X77A 1P60A 3B7GA 3NBYC 4QGFA 1J90A 4HAUA 1BKDR 1DVRA 4AYTA 2PX0A 4C0SA 2IXEA 1ZVQA 3A37A 5DISB 3U44B 1KI2A 1RC8A 3RAPR 2LKDA 2RKOA 2RGDA 3UG6A 3LY5A 1SGWA 4LC0A 4HAWA 3DZ8A 1ZCBA 4V0OA 4DDUA 4Q7JB 4FMDB 3BRWD 2QMEA 4PTLA 4KITB 4NYMQ 4EPRA 3AF0A 3B1XA 4HDCA 3W34A 3NBXX 4EQ6A 3X1ZA 3PV0A 3ZZ0A 5FI0B 2XEXA 4DLUA 4GZLA 4RD2A 3WXMA 4OHYA 4IXMA 1DARA 1U99A 3CLVA 4UNRA 2HCJB 3CRQA 2KWIA 1HE1C 4AKHA 1Z47A 2ZRJA 4M1WA 4D2IA 4PAOA 1YZUA 1Z6TA 5AUQA 4OK6A 1D9ZA 2B21A 4Q7KA 2WWFA 3GJ4A 1XPUA 2HXYA 1NN3A 4LYJA 2FGKA 3FFBA 4B6FA 1XD2B 1VYTA 2IWRA 2QP9X 1C1YA 3AP1A 4W5WA 1W4CA 3VR1A 2NZJA 1FMJA 3T06B 4UXJA 2FEOA 3TUZC 1M34E 2ZRFA 4H9GA 3GLIA 4QRHA 3M1IA 1SVLA 5E7JA 5FI1B 2WJVA 3THXA 1C9KA 1KO1A 2W6JA 1JJ7A 5KU1A 3GLFA 1N0UA 1E94E 2O8EA 1XNJA 1T91A 4IDQA 2NZ8A 4TLBA 3FTQA 4HSEA 5AJYA 2D7DA 1IN6A 2BBSA 5DLQC 4ZDKA 1F2UA 1JR6A 4EJSC 3IILA 4Y0VA 3CWZA 4HLCA 4WXRA 4QM7A 1AN0A 2FDCA 1KMQA 2JDIA 3DL0A 1E1QD 2PCLA 4C3ZA 4QG7A 4TLAA 2VEDA 1Z28A 4NDZA 1A2BA 1U94A 1TTTA 1DAMA 3IIKA 3EPJA 1QHSA 5B57C 4LJ8A 3RNLA 2ODEA 1FNMA 4QBIA 4C0LA 3LX8A 3THYA 4JYBA 4B3XA 5JWRA 4KO8A 3RS4A 3EW9A 5F9HA 5DE3A 3GLIE 1Q20A 4F92B 1XMSA 2IUUA 3GLIB 4NONA 5SZHB 4TLEA 2HV8A 4EAQA 4TQAA 1JXOA 3DMDA 3O47A 1RE0A 3NWJA 4DB2A 5FBLB 5F98A 3SI7A 2IYZA 4JL5A 4BQSA 4FMBB 1NVVR 3BB1A 3LO5A 4DLRA 4QOSA 1ZIOA 4DEXA 3N2EA 3RWOA 4H1UA 1GDDA 4ZIRA 1W0KA 4GP6A 4A9AA 2CCGA 3NH9A 5KPJA 1NLYA 4OK5A 4GMDA 2QQ0A 2RGXA 4ILEA 1XZQA 4HI0E 2YKGA 1U9IC 4V0KA 2HYIC 3K0CC 2O8FA 4KSCA 3R7WB 4PANA 2ZS7A 2DCUA 2ZAMA 2JLYA 1RZ3A 3LA6A 2ZVPX 2N42A 4HLQB 2XAUA 1XTRA 5CJ2A 1OHHD 4JJKA 2IF0A 1XX6A 4BZPA 3RDPA 4ACAA 1H8HD 2C5LA 4QHYA 4MH0R 4HDQB 2H5EA 3U3KA 5DGXA 1COWA 1KMHB 4LI0A 4KFRA 3TJZA 3NG1A 4DT1A 1M74A 5EJEA 1LW7A 4HATA 4IDHA 4X8MA 2CLDX 5TVKA 3TSWA 3BXZA 5BQ5A 3H4MA 4DLTA 3W8NA 5EZ6B 1G3IA 3IQXA 4BEBA 2JLUA 4KSBA 1JBKA 2ZETA 5JJLA 1OW3B 4HEJA 2Z6VA 4UXIA 5GJBA 1U81A 1P72A 4IVRA 1ZM3A 4Q48A 2XZOA 4HB2A 3CRRA 2GETA 2XOKD 3NC1C 3MWJA 5HTKA 5FOWA 3NVAA 2FV8A 5AUNB 5AWFC 1N6KA 2ERYA 4JMPA 4EUNA 3UMSA 1NL3A 1G3UA 2WJGA 3FGNA 3MWYW 3K53A 4IDPA 4RY2A 1L4UA 2ZIAA 3CX6A 4LJ5A 4BLQA 3AKYA 2XZPA 1SVOA 4WW0A 1X8KA 1E1RA 1KI3A 1FFHA 3CR7A 4BEJA 4CDGA 4M1TA 2BHRA 1EG7A 1XEWY 4Q4AB 1TQ4A 1W36B 2O0JA 3KJGA 2EW1A 4B75A 2R6CA 4DJTA 5K8LA 3DOFA 1NP6A 3E70C 4GPTA 4OK3A 4A6PA 4A1FA 3DHWC 3D3QA 2ZI9A 3U7EB 3TKLA 4OBEA 1FUKA 1OF1A 4UNQA 1KSGA 2W0MA 3CW2A 4BASA 5EE9A 2J87A 1VMAA 4BE7B 1US8A 4LJ7A 5D3MA 4DLZA 3LNCA 2OESA 3DVLA 3QXCA 1IXSB 2F6RA 3EWAA 5CB6A 5TDHA 1X1SA 4LBYA 2QM8A 2A30A 4ZDJA 3SHWA 1OIVA 4P0TA 3CNNA 3CX7A 4M22A 4KBGA 2V3CC 3U2QA 3TVDA 3RC8A 2F1IA 2J46A 2PL3A 3SJZA 5J5CA 4FINA 1XTKA 4JJZA 2Q9BA 4Q1FA 1OFTA 2YYZA 3CF6R 3PJRA 1KI4A 4FD2A 2OXRA 3ZD6A 1G1MA 3IBGA 1P2SA 3F8TA 4XD7A 4XTCS 4I1OA 3SE0A 1T3SA 2CE7A 3WNBA 2HJVA 3OHMA 2IYUA 4K81B 1RKBA 2XSZA 3QEOA 3EARA 3LBNA 4QBGB 1YZNA 2FA9A 1VIAA 5SZIA 3I4LA 1W36C 4NZYA 3HU2A 3NC0C 1E2JA 1DADA 1E9DA 2GK6A 2A2ZA 3AKDA 3PG5A 3K0FA 2JASA 1BYIA 1QVAA 4G0NA 3I1FA 1E96A 4ZI3A 3PFIA 1CJUC 1N6IA 3K9NA 4C7OA 1BIFA 5CYOA 5KOYA 3FE2A 2ZI7A 1DG1G 3AKCA 3SNHA 1AIPA 2IWHA 1GITA 1NNEA 5C46F 3KQHA 1C4OA 4PO9A 3PVSA 5DN6A 3T35A 1NSTA 3UANA 2GAAA 3ECCA 4RZ3A 2ZRIA 4AYXA 1ZM2A 2WICA 4A0HA 4D26A 5J47A
chains in the Genus database with same CATH superfamily
3H2JA 4H4CA 4BFTA 3ABRB 3V8MA 1PVOA 3DO5A 1YB6A 4MV3A 1OYOA 2AYZA 3LY8A 3DTVA 2G0NA 1ZDMA 3R0ZA 3WRXA 4K1LA 2RI0A 2W2LA 3HMQA 4Q4CA 1CUUA 2UZ4A 3QX9A 4GKKB 1FQOA 2Z9CA 3E7DA 3OFVA 4Q4JB 3L0ZA 3NGMA 2YNMA 3GFGA 4N3AA 1R16A 1R4AA 1H0KA 4GI2A 5JFOA 1P4RA 4CLRA 1TI7A 1W49A 1NRXA 1L4KA 2ZJ6A 4BV9A 1PSDA 2O5VA 4DN6A 1ISGA 1RRGA 1S2GA 4KQWA 2G9VA 3QOFA 1JE1A 4IVPA 3PIIA 4E3ZA 1XTQA 1K2WA 1E1DA 2VNIA 3BDIA 1P6QA 5A9TA 3JRXA 1AKNA 1Z12A 2OY0A 3DULA 3ZU4A 1T4DA 2QT0A 2VDPB 3B60A 2G5TA 1MX5A 3K0KA 3KV3O 1FJ2A 3LYUA 3PNMA 1LSJA 3NHSA 3IB3A 2A1TS 3EEQA 2O5RA 4H17A 4NYMR 4AZWA 1DT5A 3D4IA 5GOTA 4BQEA 2I80A 4X6XA 1RJ9B 3MFYA 5HWSA 2EFDB 3SSOA 3V6LA 5I5GA 3AB3A 3DM9B 3ZDDA 1QTIA 3F4LA 1Z18A 4AL4A 2IZ5A 2X2FA 3ZIDA 3GLGB 5T3YA 2Q5OA 1WY5A 1JKJA 1O89A 2XMSA 1OFIA 3JQCA 4C0XA 8ADHA 3A25A 1V8ZA 5BY2A 3GRUA 4QPCA 3RVJA 4CCSA 1O0CA 4B80A 4MRAA 4D3FA 3G5AA 3D2AA 1L1EA 1ZNYA 3TSOA 4R2IA 4TUYB 4EFNA 3GLIB 2X1MA 3PQEA 4BO5A 1TZMA 3DB1A 4GLOA 5NULA 3RUDA 3C5CA 1H69A 2DPMA 4RHTA 3SOPA 3P71T 4EA9A 2WWWA 1OJ7A 5DLDA 4LF8B 1L7NA 1LTHR 4H3SA 2XTNA 4L1KA 1TEVA 4G1EB 2IS2A 2CVQA 3GLQA 4L4XA 4NMXB 3IQHX 2Q5FA 4QHTA 4WESA 1P1KA 3TPZA 4FQ7A 2JEYA 3WR5A 4HAZA 1IG3A 1JVNA 1G8HA 2XGMA 3LO8A 4KIGA 3C85A 2P9YA 2BDTA 4DWVA 1CQZA 4KK3A 4NC9A 5AFSA 3F78A 2ETXA 2OV4A 4URYR 3GGCA 3A31A 3RVLA 5DNUA 3WS7A 2E6KA 4BWFB 2AX3A 2OM6A 2ZZKA 1H3FA 2H52A 3A1CA 5DT9A 3PUWA 4HB4A 1Z07A 4NU0A 2DKFA 4Q6WA 4CVNA 3E3NA 1T2NA 1DAIA 1E7MA 1YWGO 3DQQA 3ZZUA 5JZMA 2NVBA 1MC5A 1ULTA 4M3NA 2XNJA 4IGEA 1DRUA 1B1CA 2D8MA 1G6Q1 1SOAA 2DTDA 2GTPA 3FUWA 2EFHB 4IV5A 3LHIA 2FMUA 4NATA 1XZKA 3NTQA 3O4JA 5FPSA 1ZWKA 3CNQS 1LC3A 3I09A 5IVPA 1RWPA 2PKEA 3A9SA 3WP1B 2JFNA 1UWLA 1YB7A 2GF2A 2ISQA 2YXEA 1KJZA 3BILA 4RMIA 1NVTA 2FGJA 1UKAA 5L45A 3LUAA 2J5XA 4LRYA 2UYYA 4IJQA 4PIPA 2HT6A 4HEHA 2J0UA 3RJTA 3EFOB 3G2HA 4EP1A 1K9SA 3FFWA 3WLOA 1W25A 2R5WA 3BE6A 3W6NA 2IS6A 2NU6A 3O3MB 4ZANA 2WIBA 2Z56A 3T41A 1DV1A 2VLBA 4Q47A 4DYVA 5BQ3A 1UOPA 4YT8A 1ZOSA 4U2CA 1ZHFA 1WD7A 4B83A 3AP2A 3TAHA 5TMBA 4DJ5X 4L6CA 4GD3Q 4CKWB 3TOCA 1PFVA 1QH1B 3WO1A 4IILA 5IP5A 2DHEA 3WSTA 2AD1A 4JVNA 4BZWA 1R0LA 1QYVA 2W90A 5CIWA 4J3NA 3UWMA 1QGUA 4Q16A 4RJJA 1YSCA 1Q3TA 2NO4A 4F5ZA 5CFZA 5C53B 2PFGA 4OBBA 4U7HA 1D4AA 1OAOC 4DCMA 2RC6A 3HL0A 3AONB 2O7SA 3QW2A 2BFPA 3Q7QA 2YY5A 1QAOA 4IJMA 1FSFA 1GPYA 2FI1A 4BRWA 1YQ9A 1EFVA 3AF6A 2OB1A 1JAXA 1E2UA 4U2FA 1FX0A 3ENQA 4B0PA 4I4TB 2OGZA 3TQFA 2ZJZA 2AQ8A 2C5SA 1KZ1A 2PWYA 5JZ9A 4L0QA 1RZRD 3QA9A 1PQ4A 3GPLA 3PFCA 3T7AA 4HS9A 1HTTA 4TSFA 1GN9A 1G6HA 4J1SA 4WLOA 1P7YA 2BTOA 1X6VA 3GNQA 5FL3A 4QASA 1M2HA 4YAWA 1DAOA 2AFHE 1V37A 1KJQA 5K3AA 5T6MA 4P80A 3L8MA 4N0EA 1KKMA 4RULA 4PO3X 1P2GA 4CLOA 1IL0A 1RHMA 2DFNA 2VXBA 3OTQA 4OHMA 2IXDA 3X2SA 4EGAA 1A5ZA 1AA9A 1S1CA 2XMPA 2I54A 3BWCA 1Z0KA 3TVTA 1UAAA 1SXJA 1W35A 3IAAA 3VHXA 2ZRMA 4CQMA 1N4AA 1LJUA 4X0EA 5F5NA 3DOUA 5TQ0B 1O87A 1T0PA 2AUMA 5EESA 1JIQA 2EGUA 2O7RA 4EB0A 1GSOA 2IUSA 3RABA 4B4DA 4Q3AA 3H5WA 4BNNA 3H4VA 2EFGA 2YMMA 5AW5A 3BMQA 2JI6A 3GZ4A 3F9IA 3IXMA 1QWSA 1XZEA 1Y9EA 1ZHOA 1EJ2A 3OEEA 1C0KA 4TMWA 4V1CI 4HMPA 2IY7A 1JJFA 2AFHA 2W42A 2PUDA 2A78A 3DOHA 3WWCA 5ENZA 4ZMSA 3PGVA 2QORA 2ZBDA 4JDPA 4KDRA 2CV2A 2Y77A 4OJYA 5H7XA 5YASA 2HEGA 2A7QA 2D4AA 4RPJA 4DZRA 2WPDA 3SFZA 3R9XA 5LUAA 1U6JA 3AM4A 4P35A 3W6UA 3O1HB 1QVWA 2CVFA 1DDIA 2WYHA 4CCWA 2F55A 4U1RA 1CUBA 4ENUA 3KZCA 1GCOA 2DF8A 4CKEB 1IHDA 5ITWA 1L5MA 1LK7A 1HFJA 5C0OE 3GRYA 1RM0A 5AHWA 4Q4JA 2NPIA 2QGFA 2ZI4A 1MOZA 3TLMA 2FH5B 1Z5WA 2BTEA 1N9GA 2EW2A 3GQBB 1WHTA 2I1LA 2JGLA 4WSOA 3GX1A 3UJ9A 3UUWA 3TRKA 4CIVA 1MA3A 4S1TA 1R8QA 4BXOB 1GVNB 3DBLB 4LBWA 4E5VA 1FRVA 2Y66A 2YBDA 3D9QX 1F0PA 1GYQA 2GHTA 5G2OA 2EHJA 2OMEA 3UGTA 3SCZA 1JQEA 1E1MA 4WTOA 2LE0A 3TZLA 1YL7A 4X64B 1UK9A 2Z4SA 1QWOA 3LZ6A 1ZD3A 4RMNA 5KSPA 2IL1A 2L0XA 2PPVA 2CXXA 3FMIA 3SZMA 4O4HF 1P0PA 3EEBA 4BIIA 5GINE 3VGJA 3CXUA 3LHDA 4JLUA 2VHQA 2F8SA 4ZPJA 3ON5A 4LXYA 4NMWA 5FV7A 5EJ6A 4XVRA 1F1JA 5TJHA 3K71B 2V7XA 3W6OA 1RYBA 9LDBA 5KYKA 1ZGBA 4CMIB 3BM5A 5LQSA 2G28A 4GDMA 3EULA 4I0WB 3OPVA 2WJ6A 1CG6A 4URVR 2VC2B 3TZQA 1OB5A 3PLNA 5HF5A 1NXSA 2BHNA 3ROQA 1IIRA 2CJWB 2OD9A 3OLZA 1CUHA 4RYDA 2QRUA 1VJ5A 4ZO6A 5EERA 4YT2A 3WGGA 4DIOA 4YJGB 1FZQA 4EHBA 3I30X 4G36A 4HLDA 2OP1A 3SGLA 5K20A 1WU7A 5FWYA 2IKQA 1EM6A 5LB2A 3T9EA 2FJ0A 4ZHSA 2WEKA 1R0SA 2WUGA 3I2YX 3IOCA 4JP2A 1KC1A 2PUCA 1VLHA 3D2BA 3UT5B 5B12A 2IVZA 3C6BA 4CFSA 2VT7A 1TK2A 1USGA 4UBJA 2CL6X 1RZVA 5A5FA 4PQRA 4PSKA 2VJMB 4D4MA 2A1UB 4O0MA 1UKYA 4YB8A 1FE8A 4LYHA 1LVGA 3DDHA 3HK2A 2G1JA 3TMYA 2XT9A 3AG6A 4GLLA 1MORA 2E48A 4P2BA 3L7KA 3OH8A 4X7PA 3KKEA 2PX3A 1VHDA 2XWQA 3RSCA 4R51A 3HCOA 4NMMA 2QTVB 4XA8A 3ZE2B 3KPUA 5DI3B 1OA0A 1E2QA 1VB5A 2H18A 5CJJA 1RCUA 3T1TA 1A2QA 3QTTA 4R9NA 1NSYA 3SBXA 2HCTA 3QVMA 2IX3A 3UH0A 4J8PA 3P1JA 4ZV9A 1KZ6A 1CEEA 3B9RA 1D6JA 2F43A 2QZSA 1FQKA 1T25A 4Q19A 3UW3A 1XQ9A 4Y6RA 2GHIA 2Q6KA 3EQ6A 1N2SA 2CUZA 4EY5A 1MOSA 1QTRA 5ECDA 2BIFA 3QELA 3FJ1A 1F0YA 2GGSA 4K6CA 1S9DA 3KKOA 3ZHTA 1R7RA 5HZGA 1QU3A 2H51A 2YHUA 1KYIA 2GH1A 2NWQA 5I8ZA 2GN4A 2CDNA 2Z4RA 4B84A 2WVJA 3PXGA 4EEKA 4AP5A 2B34A 1OBVA 2WOJA 4AWAA 4AQ7A 1C29B 4KQHA 3HPQA 4BRUA 3VU9B 2HMAA 5EMJA 1G0NA 1ID1A 1SA0A 3C45A 1AGNA 2HMTA 4YXWD 3KEMA 2I29A 1ZYUA 1X7XB 1A7JA 3CCBA 3EAFA 4H7KA 4CKWA 3QXGA 3NHKA 2B4TO 5IDVA 1C7ZA 3CVVA 4NCNA 3B2EA 3KR2A 4TYWA 4KO3S 4NR0A 4RSHA 2O4CA 2IGTA 1YR1A 3I28A 3OT1A 4JI1B 3E2IA 3WKEA 4Q9IA 3CX8A 4CMAA 1Z4NA 1XRSB 4QGHA 1X7ZB 2PXHA 4G5GA 3D4LA 2HSEA 4DCSA 3HB0A 4ID3A 1A7UA 2J7PD 2MMCA 1KI8A 2QVXX 4IRMA 5B36A 4Y67A 5AVRA 2BBWA 4L4SA 1OXKB 5HX7A 3LIPA 4OI2A 2BBTA 1J42A 4QU0A 2VQSA 2VZ8A 2ET6A 1BXKA 3V4SA 5KX5B 3NAMA 3OCCA 2KLBA 1U9IA 2G7ZA 1ZQ1A 4H77A 1DI0A 2D2FA 4R69A 2FWPA 3E35A 3FMVA 2HK8A 3DAYA 3R23A 3TOZA 3O7MA 3G82C 2M6LA 1KAQA 5AKHA 2OHOA 4CM1A 5KNBA 3FI9A 1XHLA 2YZ7A 1R4ZA 4DHEA 2JNWA 1LBIA 3T0IA 1ADFA 2EQ5A 3WA7A 4RD6A 1LS6A 5JFTA 5H02A 3RWMB 2P79A 5DMXA 3MJVA 4IDOA 3ZQ6A 1RQXA 2GWRA 4P92A 4DZZA 1T5HX 2YXNA 3WTBA 5CBKA 1DPFA 2GS9A 2ODTX 2EEPA 2J9XB 4G2TA 1IE3A 2I87A 3CB4A 3PNSA 3BEOA 2G6BA 2A9OA 1TF5A 2WJAA 4H7IA 4Y2YA 5TMPA 4V38A 4EQZA 1N34B 1XL1A 3NIGB 1K9VF 2GCNA 3M3HA 3P27A 3AQ4A 1KYTA 2XCUA 3COYA 3EEIA 3A26A 3AFIA 3MQ2A 1S02A 1LFAA 2CVHA 2IHYA 4C6TB 4H27A 2FMKA 1J33A 5D1NA 4ZEWA 5ALXA 4KQFA 1BHJA 1U5AA 2H2AA 3GJXC 4BKPA 4DWJA 1WF3A 3E3AA 4R4JA 4QXRA 1H3NA 2O2YA 3C3WA 4BEVA 4Q3EA 3ONFA 4POOA 3RYFA 3L82B 2REBA 4FFPA 5K8IA 3FDJA 2AC4A 3O3OB 5JZBA 5ILOA 1RXVA 2UZIR 3OETA 2IOFA 3GA0A 2ZJ4A 3LBAA 1A9ZA 1BQ3A 3O74A 2WA2A 3C43A 5B4TA 5J43A 4U02A 5ITZA 3VYSB 4WZBE 1O4WA 2VHTA 2XWSA 3G85A 3PDHA 3GJ8A 4L8GA 5CMLA 3IIMA 3U7IA 5KTTA 5BMVB 3Q5DA 2W8ZA 1Z5ZA 1RKQA 2JJ1A 4AN4A 3K15A 1HWYA 3BIJA 2ZS8A 2JLZA 2B4RO 1NRJB 5BWBA 3N7AA 3E8XA 1ADJA 3JCZA 5LWQA 5ECGC 4YJDA 3SHWA 3TIIA 5KKCA 3KUXA 4AJEA 4DR4B 3CLSC 5E1DA 3NYWA 1QYDA 4KQ6A 1L4NA 4QGGA 4IWNA 4CYMA 2J45A 4B87A 4A3SA 4YEDA 4D9NA 1LS1A 2AE1A 4TTQA 3U4HA 1G63A 5TT1A 1N33B 1CY7A 3RVOA 1G59A 2GPSA 4WRRA 2J4DA 1HZJA 3LQ2A 4FK8A 3RVMA 2B35A 1FU4A 1V8BA 3HSYA 4KDCA 5DDIP 4GFDA 2ZAGA 1WCXA 2FKNA 3IGFA 1L4EA 4DNOA 4LTDA 4GYJA 3ACDA 2B5VA 3BUSA 4OD0A 3WISA 2FXIA 4LRTB 1SUAA 4MYTA 2G1UA 4UBOA 3D8NA 3E9NA 5LP6B 4E70A 1FUUA 2FPIA 3RLIA 4A8PA 3CF2A 1CY1A 1TAGA 5ALTA 1CC1S 4FCWA 4G5XA 3U4CA 3QEKA 4R2LA 1KQ3A 1UL1X 3ZV4A 3CLRD 2X9QA 1NQ5A 1ESMA 1OILA 2Z83A 4XWYA 4W5OA 1IJEA 1D6SA 3GFRA 4Q9NA 1JA0A 5JNSA 2EG5A 2OXIA 1UKCA 2PFSA 1S3GA 3PQ4A 4UU7A 4MULA 1TJ5A 2IUFA 3D1VA 5AM2A 2B82A 1XKLA 2JJ8A 3AJAA 1SC3A 3L06A 5BVHB 2CBGA 3K0HA 1M6YA 1NW9B 3OHPA 5AVYA 4HT3B 3K1YA 1SHTX 2B0CA 3SDBA 2OQVA 2CW5A 2ASEA 3KCQA 3ZJUA 2ZDGA 2WIJA 1C9MA 2JH3A 4NESA 2CNDA 1AD2A 1KE2A 5FNZA 4TTRA 5AP9A 2GAFA 5AKIA 3ZCRA 3IOEA 3SFTA 2RHCA 4K6OA 5HK9A 1ECGA 4ESVA 1M8FA 1GNQA 2XE6A 1CR6A 4CNQA 3FB1A 1G55A 3LW8A 3GROA 2QAGA 2Y0BA 3UB2A 3KSAC 2I6XA 1AMOA 3CC8A 4QM6A 1X1CA 3OM1A 2IJGX 2IH5A 2PJDA 1AZSC 2AN4A 3H5VA 4OHVA 3QE0A 1DKQA 2POQX 4TMKA 3B53X 2I1QA 1MLDA 1RHJA 3LQYA 1L6RA 3WYNA 1XD2A 4JLMA 1XWFA 2DBRA 2PMBA 1XALA 2REQA 4I19A 4MR9A 5K99A 2Q46A 1COWD 1D7AA 5CEEA 3NTVA 2HT1A 2GM3A 2DGDA 4Y6PA 2ZWIA 2FAXA 4KVFA 1KEVA 2YV5A 2H29A 4EKDA 2OBNA 5IKOA 3EXIA 2QN8A 2VAWA 4LXTA 1TVMA 2QB5A 2HCRA 4DR5B 2Q2OA 3H2BA 2VSNA 2Q6TA 2VR1A 1QHFA 3X3HA 2X0IA 4YJ2A 5EMHA 3QFSA 4NCIA 4QXAA 1DMSA 4YWHA 2NU9A 3EVBA 1VTKA 2WYVA 3VJLA 1AO3A 3DF9A 2R65A 4URZR 5A9SB 5DZSA 4WQMA 2BN4A 4JU8A 3D0OA 2W48A 4O2BB 4CCYA 1XRNA 3KQQA 3WWOA 1ISIA 3I9NA 4OHXA 2RGGA 2FEXA 4M9ZA 4OQLA 1JIKA 2OZKA 5ALFA 3LUJA 4JFRA 5JCZA 3WLAA 3TFWA 5CVJA 2ES4A 2J7PA 1G9SA 3RC2A 3S99A 5LOVA 4UEQA 3R9KA 4DJEC 3V7UA 4LNUB 1B8UA 1EZ1A 3L4EA 4B6GA 2I3ZA 1BKSB 4PZ9A 2YVAA 1TVKB 1KZGB 1KK2A 3CBQA 5JSHA 5EWJA 3NKLA 2HHJA 2ISSD 2PA0A 4BJ5A 3NO4A 1DMRA 3PK0A 1Z17A 4C14A 4NE9A 3HYSA 1RPZA 3KPJA 4TZ0A 2PX2A 3W2FA 3AVTA 3MA0A 2PH1A 1U9YA 3KD3A 4RGYA 1HQDA 1TYDE 2LRHA 3PCRB 4WKCA 4DBLC 1ENZA 3OOJA 3FF4A 1LDMA 1X3SA 1Z9BA 2EKZA 3A1DA 2OCIA 4JLDA 1F5NA 3USES 1I7QB 3F98A 4KH0A 3AR7A 2X15A 4JC4A 3LX4A 1I2BA 2BW0A 1DOZA 1MDBA 4CN8A 5L53A 1E2BA 1KDTA 1KAGA 2BJVA 3NUZA 1NHGA 1ZUNB 3Q3HA 4PX2A 3KTAA 4KXUA 5I3ZA 4DNPA 1M7HA 2XDWA 3UK0A 3EEOA 3LLCA 5CFPA 3DQPA 1SC6A 5C18A 3QMPA 4MV4A 2O54A 1EQUA 5FYDA 3DLHA 2AEMA 1P44A 2HO5A 4LXIA 4YT5A 4C30A 1J99A 4QBKA 4G8JA 1T5IA 4EELA 4CBVA 4JWKA 2FUG6 5HZKA 3U13A 4Y2UA 3VMMA 2JARA 1PEAA 3B38A 2JHGA 1O94A 3NDPA 1D0IA 1CS4C 3NRCA 4GC5A 3ZJYA 4CQLB 4F8YA 2O8CB 1JIJA 4H1HA 5IYZB 1HTWA 2BFFA 3WMGA 4D4IA 3D7LA 1XD8A 3W5BA 2DPHA 2XTZA 1U7UA 1X70A 5ARBA 3C4VA 3GZJA 3I4FA 2CLIB 2Y68A 3FVVA 1QZXA 3GGJA 3TZCA 3S7ZA 1I3LA 3HBFA 3O4GA 5AIBA 1N5LA 2VP5A 5KNLA 3I6IA 5AOCA 5JXGA 5DM70 4QUDA 3H17A 1NU8A 1EWTA 1IM2A 2DHRA 2VPXA 1PT5A 2XWBF 3JQAA 4B43A 1P81A 4EGCB 1HEYA 2EKBA 3AEXA 1JHAA 1RXEA 3QKRB 1ZVJA 5CLGA 4RORA 1OE0A 3G7SA 1G7RA 2FW1A 5EXDA 3QKSA 4EA6A 4J1TC 4UM9B 1JE0A 2Y1LA 1P6UA 2WT8A 1I4EB 1Z68A 3B6JA 4R84A 2MSDB 1YUBA 2FR1A 3GUCA 3PR3A 4WN9A 3D2CA 5DNAA 4CU2A 2R6R1 4GYKA 3VKFA 4O59O 1NVXQ 2RK6A 3SZLA 4D0GA 1W4RA 3KPYA 1X77A 1KH1A 1UDWA 3MD9A 4FWIB 1XZIA 5ERXA 1DRWA 3Q5EA 4GSLA 4GGPA 2IEYA 1EI9A 5F1PA 1QJ4A 2XUKA 2OV1A 3BK7A 3MGKA 1O6ZA 4JLKA 3VOSA 4W7HA 5CITA 2YUIA 3UVEA 2H92A 4IJ5A 4IQ8A 1O0SA 3FRIA 4C4OA 1FQJA 2HBZA 2IYOA 2CJWA 1A4IA 2EFCB 2I0FA 1GRRA 4BFVA 5I47A 2VQEB 5A04A 3BD9A 3RAGA 3T7DA 1A96A 1O95C 3NX4A 3G2KA 4MMYB 4ZYVA 1DZIA 1ZX1A 3KQPA 3TNLA 3O4VA 1UCFA 2XF2A 3A6HA 3NLLA 4XQ0A 1O96B 1EP9A 2NUBA 1YDWA 4W1RA 2XD9A 2YYSA 2ZJ8A 3R5KA 4ENTA 1PVVA 4JI4B 1DGQA 2ETVA 1T8RA 1N5JA 1FJXA 4FDVA 4KR0A 4UOEA 1AQYA 4TLDA 1G6OA 4QQ8A 1BX0A 2OZLB 2Z5FA 1QGDA 2WKQA 3DW1X 4JJFA 4E32A 4HUTA 3M70A 3SFVA 3KJIA 3OZWA 3BMNB 1EFRD 4YACA 1JFFB 1FRZA 3TJRA 1P0MA 2JJ2A 2VIIA 2ZUBA 4XFJA 3WYAA 4EI7A 2NTNA 5HJEA 2VHCA 1GTG1 2YV4A 4GT1A 3GLHA 3UXHA 1S3FA 2BEWA 3MJ4A 1KZ7B 3L7DA 4HDMA 5K2MA 4C4PA 3MLEA 2W2LD 5BMVA 3P20A 3PHIA 4O3MA 4P6VF 4A26A 2FUEA 5CDFA 1DWPA 1J7KA 1JUDA 3KTDA 3ADKA 2FETA 5AUPB 1BS9A 3TAUA 2D0OB 2VUIB 2VZ0A 2VHVA 4W5TA 4IZIA 4H3KB 4LRWA 2FWAA 3RLFA 5DX0A 1JQAA 1JJAA 3VU8A 5CHYA 1KJNA 4YMWA 3E5NA 3SJCA 3O31A 1XMQB 4JN6B 1U8FO 5DBEX 2V3WA 1E5TA 3DLPX 2DT5A 3MT0A 1JEOA 3HJGA 4N12A 1AO0A 4B3TB 3D3NA 1N3BA 2JCBA 3FPKA 4U7FA 1YZQA 2WHPA 2V5AA 5HHTA 4MPPA 3GG2A 1ZA1A 3HJAA 2O07A 2BFEA 3GOQA 4MMXB 4QOEA 4WLNA 4ZRDA 3ZUPA 6CHYA 3T3OA 3RK1A 3SX0A 3JARB 2ZBVA 4ZOLA 2GF9A 4RFSA 2D5LA 1LVUA 4KSYA 2NT3A 4OAPA 4C0AC 3T3HA 2BR5A 1SBYA 2WAMA 5BUCA 3UHPA 4E5SA 3HR8A 3A9TA 3B8HA 3U3RA 3OOHA 5FI5A 3RFFA 3URMA 1ILWA 5CDFE 2OZPA 1EWRA 4E5PA 1IQPA 3VDMA 5DOVA 1NOIA 4GQBA 4I1PA 1OXVA 5C3MA 1HORA 1Z22A 3IBYA 5DU2A 3C5HA 1LTKA 1X0VA 1K3FA 4FCVA 1JSZA 3QPWA 1RAFA 1Y8CA 4C0HA 1GTRA 5IDXA 1E58A 4O4JF 4J16A 5FQNA 3RSQA 1FTNA 1L1RA 3EH1A 4TKZA 1MTOA 5JTTA 4EG4A 1L5WA 3D0KA 2Q4DA 2FN8A 4XR9A 5JH7A 4DV5B 1XMJA 3E6AA 2SHKA 3QG1A 4CMBA 1NW3A 3ETDA 4MWDA 3OTIA 1ELOA 1DTEA 1CR0A 4AUKA 1BEUB 3DT9A 2PVSA 4HXGA 1MHTA 1WLYA 3WY9A 2XRMA 3QSGA 4MAFA 1GQFA 1XXHA 2BHSA 4HDOB 1AUPA 1KSHA 4OHBA 4KYTA 1QH8B 4AT1A 4NXMB 1RQPA 1PJBA 2IW1A 4XCQA 3PD1A 1ZM4A 3G9XA 1PX2A 4FYKA 1ORDA 1OH6A 2RH9B 3C8HA 4UTZA 2V8OA 4H7JA 1GSAA 4XOUA 1Y0BA 2QE7A 1CZKA 5K0CA 2D74A 5TQVA 3ZU6A 2QIPA 1KDOA 3EGEA 5FEUA 1R88A 3THRA 4WNAB 2MYNA 4PGHA 1V5WA 4TWIA 1L6IA 4B6JA 1PYGA 1OLUB 1U0TA 1QR6A 1J2TA 3KXPA 1UMDA 3BWYA 3C15C 3LBIA 1E5XA 1XQXA 3PI7A 3ZYCA 4M8NE 5EYPA 3S1AA 5BSFA 3DVAB 2XXJA 5JBIA 4ONEA 1OXXK 3PDIB 3QEMB 2IPMA 1NVAA 5DXFA 5EHIA 1KVSA 1GZ4A 2G76A 2IEGA 3GARA 1EX7A 4V3CA 1NUAA 4Z0TA 4CV3A 1NT4A 3H1GA 5BW4A 4XB2A 1EE1A 1QGOA 3E22A 5IMSA 1RMTA 3PITA 1SMKA 3R09A 4FE7A 3OMLA 1FNSA 2RGAA 4F0JA 1V8OA 2UUBB 1H8ED 2IDKA 5LKRA 2NUPB 4OGWA 3F96A 2MIIA 3ZTTA 2MYPA 2PKYX 4TYMA 3R8CA 1Y82A 2MYUA 1KXZA 2OBYA 5JI2E 1CUEA 1WXEA 2ZQ5A 7YASA 5A2GA 5EZSA 1WCIB 3FSJX 3ZHOA 5H81A 3QF4A 3L6BA 3HZOA 1LBSA 5A9RA 4I50B 1ESNA 3DDUA 3W3AA 2DG2A 1BCSB 1Q92A 4CDNA 2XNKA 1BWSA 2IQIA 2AMYA 4R8VA 2Q5LA 5AESA 1F8XA 1FFXA 1ZG3A 2V55B 3PUXA 1Q14A 3O4IA 4ITRC 4JL8A 2DEUA 4RF3A 2F3TA 4K0KB 3NPAA 3DBRA 4RIFA 5LQKA 5K0FA 1AHHA 3EWSA 5CEJA 3D3KA 1XFAA 1WDWB 3BJRA 4BQPA 1E79D 4QKQA 3WYDA 5J5VA 2W2TA 3IQIX 1QHNA 1AGPA 1W59A 4ZREA 4DCOA 2QRPA 1R4NB 5BSWA 1D2HA 2ANBA 3AOGA 2QSUA 3O2QB 1L4FA 2RONA 4UHFA 1ZGCA 5DX8A 3H9CA 1JNXX 4WN9B 4YMSA 3W5JA 2CDRA 4YAGA 3SHOA 2WWXA 2G9QA 4KUHA 4R6XA 2AR7A 5FR1A 5HG0A 4ALIA 1RD4A 5AK5A 2IOYA 2P91A 3EDMA 5L7WA 2ZRAA 5I6DA 3JYPA 3PC2A 3PGMA 4OB6A 4QVGA 1MD9A 2B8EA 1QCDA 4BJHB 1YA6A 1YI8A 1XVUA 3QVOA 4C08A 4YJ3B 3SJBA 3VR6D 1HRKA 1PG2A 3T3MB 2HPHA 4B3MB 4J0HA 5B2EA 1MJNA 1IVSA 1L5SA 1YK1A 1DKRA 5E4TA 1IK6A 2Q07A 2ZYRA 4R1SA 3B1JA 1D7OA 4L0MA 3Q8MA 2PA3A 1T1RA 4YV1A 4NENA 4Z0PA 3W2EA 1PJRA 2GILA 2H2HA 1OKKD 5AK3A 3ZD9A 3IIEA 1KU6A 4CM8A 2PRJA 3ZY4A 2OBBA 3JZFA 3RJZA 3J81A 2RIRA 1JFTA 4FLEA 1S01A 3MG9A 3N7TA 3Q3EA 4NAHA 4AJLA 1SIBE 1TJNA 1SUEA 4J7AA 1Y9JA 2QW1A 3WGZA 1SVNA 5G53C 4JNCA 1FEZA 4L5AA 5ALGA 3S7TA 2OV6A 5LXTA 1Q17A 1KKLA 5FUVA 5FPYA 4UMVA 1JDBC 3I39X 3LUHA 3PC8A 5IEBA 4CG0A 4F3RA 1WMEA 2JGAA 1GGJA 2AF4C 3F9RA 1N32B 4HQLA 1ETUA 3AFOA 3CHYA 3PJGA 2X7HA 2M6RA 4PNZA 2BRUC 5HGXA 1P4AA 3HABA 2ATEA 4S0XA 1T6BY 4CT4B 1PGJA 4ZCSA 1FLDA 3OZIA 4BNYA 2WPNA 1NTRA 5JRDS 3T3NA 1J6UA 4JI8B 4O4JB 1HLPA 1M2NA 1WNTA 5HIJA 4DG8A 2UYQA 4ZDWA 1LSSA 4FFSA 2Q21A 3IAUA 2FQ1A 4X93A 3UIEA 4FMPA 1WP9A 3RI3A 1AKYA 2XYGA 4F4DA 1KQFA 2INGX 3NAQA 3DOJA 2GRJA 3HB5X 3B6EA 4U5XA 1AZWA 1QE3A 4R98A 2AXPA 2R66A 3D5EA 4P32A 1SXJB 4TOIA 4OYYA 4RZ2A 3Q72A 4E5KA 1KOFA 2R4TA 2R1VB 2KQUA 4US0R 1ZD5A 1JYEA 2I6QA 3UK2A 1JVSA 2EHDA 1L3BA 1BA2A 1Q1BA 2ZPUA 3MSCA 4BVHA 5A6VA 3BMQB 1UINA 1NVKA 1CF4A 4OQXA 3GPIA 3T7KA 1OTXA 2H1VA 2VJAA 5ENDA 1T1JA 3N86A 2ZITA 5IH3A 1E6UA 2AK2A 4R2WA 1G60A 4DDMA 1A9XB 4E08A 4X95A 2QAGC 1SVSA 1ZH8A 3AM5A 3IMFA 2D3WA 3QSYA 3PFBA 1BDJA 1RP1A 4WXYB 1Z4MA 3CH7A 5DH9A 5TC4A 4KREA 2GVDC 4N5NA 3L1JA 1KY4A 1VFNA 1IEXA 3CUKA 4P3PA 1XE3A 4MMZB 5KJCA 1NBAA 4ZU6X 3JSAA 3QXJA 4RK1A 1JGTA 3EC7A 1W52X 1NBOA 3H86A 3DP7A 4PYRA 3DH0A 3UTDA 4KQ1A 1BXRA 2MU1A 3VKWA 3QKWA 4N0MA 3VO1A 1DUSA 4ZA2A 3KFVA 1NXWA 4YAJA 1ISRA 3R77A 3M5CA 4G1VA 1OV6A 3AC0A 4B79A 2J3IA 5KQMA 1DU4A 3C6XA 4HUQA 2FZLA 4O1HA 1WUYA 3WBKA 2YIJA 1D8TA 3QWBA 2QN1A 4FHDA 1K0FA 1RZUA 1SCDA 1Q2XA 1V3TA 1EGVB 1Q21A 1VKOA 1GU0A 1U0JA 1ZSNA 4HAOA 4INOA 4G0VA 3KZXA 3RTCA 5DYWA 1RM3A 2VATA 3ESBA 1KF0A 2QUKA 2ODNA 2PNFA 1WHTB 4M0CA 4PYIA 2Q99A 5AKXA 4I3HA 4JI5B 2RHOA 1P2FA 3BQNB 3VDQA 1JAZA 1UXGA 3OD1A 1XA4A 3AT1A 5KOYA 1CNMA 5AVQA 4XLLA 3JVEA 4IUCS 2XMGA 4KEAA 2QMUA 3SHVA 3PDWA 1FTGA 1Q7RA 4YRGA 4OQQA 4OSEA 3DZHA 5A4KA 3CINA 2UYCA 5F9FA 2P9HA 1KBQA 4ZQBA 5E6RB 3EF0A 3MAJA 4OFWA 3JYOA 4D8YA 2V6IA 4WNAA 4X94A 5B37A 4LPSA 4QVIA 3FD8A 1T9DA 2VCYA 3OX4A 1J8YF 4PZLA 3ZVNA 5JLAA 3KQVA 2BGKA 2C1EA 2QG6A 2XMZA 2O8DA 1JB9A 1CJBA 1QXSA 221PA 4EW2A 4HD8A 4JA0A 3PR2B 4RO0A 1KI9A 2G9UA 4W99A 3U3JA 3WB1A 1CNFA 1K8YB 2J9FA 1EUCB 1H6CA 4U7JA 4TVSA 2X4GA 1E1LA 3RC3A 2ENUA 1W85A 2JFVA 2R6GA 4HNTA 2PSEA 5JJKA 5BRAA 4BNMA 3W6ZA 5JXJA 1UDCA 5FPHA 1YTLA 4GXTA 4EB8A 2OP0A 3HKBB 4J0KA 2YQZA 4MS1B 2BBOA 1JEEA 2JEZA 2Q6IA 2YJTD 5T6BA 2WUDA 1CDDA 2GK7A 4H6VA 5FBKA 2B1QA 3V33A 1EJBA 3HDJA 1IWPB 2PM8A 3TBKA 2WAYA 1RPNA 5D84A 4LVOA 3DZCA 1BGXT 2QL9A 1AQUA 1GZSA 2C3PA 5ALQA 2UV8A 3WDMA 4GOMD 3IIIA 1DAFA 1GL7A 1W29A 4AMVA 2XJ4A 3W05A 1VL1A 5BXYA 5JEDA 1VIMA 1ZJ5A 2VT2A 1IC6A 2H54A 1U65A 3DBHA 1N7JA 3EGCA 3MMPA 3WI7A 2PL5A 4HWTA 1UR5A 1X8XA 3BFKA 5IJ0A 2A92A 3ZQJA 4QRIA 4M36A 4RDIA 1I01A 1K3TA 3FMPB 4OJTA 3U3ZA 4B6RA 3CURA 4G9EA 4EZBA 4Z54A 5AW1A 2AN1A 1E3MA 4PNEA 3CG4A 1I8TA 4NOJA 5DWVA 3DCNA 3GDFA 5L9AA 5BVGA 5F12A 1XZLA 3LDUA 4QQFA 3UATA 1WX1A 1SG9A 1Z6YA 4RX1A 4WPGA 2D5BA 1GFWA 3QXSA 2YWEA 4KFTA 1Z2OX 2VJYA 5EY5B 4AY2A 3JAKA 1GRQA 3THXB 2JGEA 2OMKA 3RH0A 4WZBB 3WL4A 5CXUA 2GPJA 3CE6A 2FN7A 1BG6A 1U4OA 1XCJA 3I23A 4YDHB 4OQMA 1QG6A 1SUFA 3HDGA 4KWHA 1W30A 3M9WA 4G9GA 1BX1A 1N7GA 2YWJA 1GUZA 3KR0A 3LLSA 4KVGA 4P7BA 4ZOLF 5ES3A 5T4HA 2QYTA 3V1UA 4BN0A 5JEEA 3P97A 2GM9A 2GBLA 1NYLA 4NH4A 3GRZA 1JAIA 1U1GA 1M8JA 2G7MC 3OQMA 4F93B 2H0QA 1NLMA 3TNFA 5IT0A 1N6NA 3PP8A 4C0BA 2ZW9A 3ORFA 5C7LO 4A36A 4F3TA 2REOA 3KOXA 2R8PA 4OFZA 2IVFA 4RS3A 3EB9A 5DGCA 1DTWA 1P7ZA 2Q1SA 1GU7A 4CR7A 2K7FA 3B1ZA 1AHIA 3QVKA 3K3PA 4I3FA 4A1OA 1HNNA 4MQ4A 3ZOZA 4W8OA 1XO1A 2BY4A 3AV0B 3OZCA 4KR6A 3OY7A 5FADA 1Y37A 1RWQA 1Z7BA 3CVXA 1GPDG 2PZLA 3HGTA 4RLHA 2Z9BA 3OKCA 2E37A 4JT4A 5K09A 3H6HA 3I62A 1WZUA 3IMEA 2F00A 4QYTA 4XD7D 1TUIA 2D5IA 4TZKA 1TEHA 4XIJA 1G5QA 4NG5A 1Z5VA 2PQ0A 3A9RA 3SVTA 4NV1A 4X8HA 3O8BA 4LXQA 4B3JA 2WK1A 1DXHA 1MDFA 1WHSB 3EQ8A 1R0RE 3H3JA 4NYJR 4OP3A 4G67A 5EKUA 4F11A 5C8YF 3FDXA 3UH1A 2G1KA 3B12A 2VP9A 1XU4A 2WTEA 4IVQA 5FNVA 4B33A 4CF6A 5A0TA 3KDSE 5IJ9B 4ABTA 4Y6OA 4RXMA 1ECCA 1XTTA 1DAGA 4E22A 1Z2EA 3HJUA 1PUIA 5ALWA 2FNAA 2QTZA