1ZI8A

Crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQDIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVASKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTGSSGYVASAAALANERTLDFLVPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 82
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zi8A00
2BUBA 5SYNA 5HF6A 5JZ9A 4H7DA 1T2NA 5YASA 5JAOA 5K3FA 3E0XA 1EI9A 1LZLA 1QTRA 2GBCA 1K8QA 5DWDA 3W04A 3WKBA 3AIMA 1MX5A 4TPKA 1MN6A 2OXEA 2JGMA 4FLFA 1JT2A 1XROA 5FLKA 4QZVA 2WFLA 5C8XA 4GXNA 3V1KA 1VLQA 3ZPXA 5DYTA 1PJAA 3G7NA 4DNQA 1J2EA 1K63A 2XMCA 4PW0A 3GA7A 4FBMA 3AZOA 1U4NA 3H1BA 4BCDA 4Q05A 2H7CA 3H2HA 3V1MA 1IUPA 2XUAA 5AKJA 2O7RA 1UK7A 1XZKA 1Z68A 2WFZA 5FKJA 2C5FA 5JADA 4ROTA 5CURA 1GQSA 4QLAA 4X6UA 1K4YA 3DDUA 2C58A 3SK0A 1MNAA 4UBIA 3RLIA 3AILA 2PSHA 1JJBA 1DQYA 1GGVA 1H2WA 5HF5A 2WFMA 4PSDA 4AO7A 1XZBA 5K3EA 5FRDA 4KACA 4QDUA 5K5EA 1YASA 4MJ3A 2WHPA 1CUWA 4CG3A 5KREA 2ZSIA 4X90A 1P0IA 2K2QB 3C6ZA 2XUKA 3GROA 3WK6A 4PO3X 4PNZA 5ALXA 5DYYA 4QEKA 4Q3KA 3ESDA 4X71A 1BEZA 2QT9A 1EH5A 1XQXA 5BOVA 1YR2A 5ALWA 3OURA 3PI6A 5AM0A 1X2EA 1BS9A 3WWPA 4LHEA 1IVYA 1HQDA 3D59A 3B5EA 3QH4A 3RKSA 2WUGA 5CH3A 2DCMA 2VT6A 2C0QA 4KJXA 4F0JA 2XUHA 4KEAA 4B9EA 4P92A 2PPLA 4Q1VA 1W52X 4YASA 4BVKA 4CCYA 2OGSA 4FLMA 1JU3A 1WPXA 1G4HA 2I78A 4OB8A 3EF3A 2VTVA 4X3CA 5I8PA 5JATA 4HRXA 5EHNA 4EY5A 2HM7A 4Q3LA 1BRTA 4QLOA 1UWCA 5ALYA 2W6CX 4XJVA 4MYSA 3ZLVA 5KWIA 3RM3A 5JAUA 3V1LA 4IH4A 5K3DA 5JASA 4FNGA 3QITA 3HEAA 5D3KA 4I19A 4HVTA 5JD5A 4UBNA 1KU6A 3K6KA 5JYCA 2OGTA 1NU8A 3ED1A 2WIKA 3I2FA 3G0GA 5LZ5A 1AX9A 4G8DA 3FSGA 4DNPA 3WKDA 3QBJA 3WZMA 1XZGA 3R3XA 3D5EA 1R9MA 1E5TA 1CUDA 1CUJA 4IO0A 5E2IA 1XLVA 2WUEA 1WCYA 2XMSA 4XVCA 4AZ0A 1W1IA 2G5TA 4GECA 4F5ZA 5AIAA 1CUUA 1Y37A 2PM8A 4HAIA 4B85A 2AJLI 4UBJA 4B84A 5ISMA 4IH9A 2GYWA 4ZI5A 4B6GA 2DSNA 1LBTA 3LP5A 2GYVA 2QVBA 4BTLA 2VF2A 1IZ7A 1W75A 3C45A 3I2KA 3OM8A 2LIPA 1ZD3A 3BDIA 2WG2A 1O6FA 2WJ6A 4V2IA 3TRDA 1YS2X 1XLWA 3WMRA 4KYVA 2CKMA 3VKFA 1L7RA 1W76A 3PICA 5AKZA 1SCQA 4GLBA 1CUIA 3WK9A 2RIPA 1FFCA 1ODCA 3OG9A 4LXHA 1MX1A 5BWCA 5CBKA 1VE7A 1RWQA 2BAGA 1A7UA 1XFDA 5H3HA 1ZD5A 2ONCA 3VJMA 2WG1A 1H2ZA 3I2HA 4UHEA 3F9CA 3ZLTA 4UBMA 5A7GA 3IUQA 3VVMA 4KE7A 1E89A 2VEOA 3I2IA 2HA6A 5ALNA 5CRIA 5IVHA 5JZSA 4AXBA 3RK4A 2PUHA 2YXPX 3C5WP 4J0GA 5CH8A 5AH0A 3I2JA 5K3CA 4PV7A 4DM7A 2GBGA 3WI7A 1XZAA 4Y2SA 1EVEA 2XUDA 3L1JA 5KWJA 4FMPA 4QWMA 5FPPA 1WB6A 3WWCA 4UFNA 4B83A 4CG2A 2ZJFA 4EY7A 5HCUA 2Z8XA 1TK3A 5AOAA 1RP1A 2VJBA 3D3NA 3WL8A 3C8HA 4D9JA 1UT6A 1UOOA 3ICVA 4G4IA 5I9IA 5A6VA 3I6MA 4BAUA 2H9YA 3BXPA 3KWFA 3FLBA 5AK6A 1XRNA 3BIWA 5LP1A 4JNCA 2RGUA 3QPAA 4G9EA 2ZYIA 2OQIA 3VDXA 2JEYA 2EEPA 2XI4A 4B9AA 5D6OA 1JJFA 1DU4A 1K6EA 2AJCA 3OOSA 2FJ0A 1EK2A 4FKBA 3WKCA 3KOOA 1QFMA 4AZ3A 4RGYA 1UOQA 5AK3A 3TGLA 2Q0XA 2RHTA 2XDWA 4AO6A 3EBLA 1AMNA 5ALOA 4BDSA 1YA4A 5FOQA 1EX9A 2I3ZA 3DS8A 5K3AA 4A5SA 4QWWA 3WL6A 3C6BA 3ILSA 4XIIA 3W2TA 4I4CA 2X76A 2WTNA 4EUSA 5T4EA 3FBWA 1VJ5A 4LXIA 4XX1A 2NW6A 2ROQA 1N5RA 2JGIA 5AI9A 5I7UA 5AI6A 4DIUA 4DGQA 3TJMA 2ACEA 5DNVA 4J3JA 4MXDA 5JAPA 3DD5A 3ESCA 4WFJA 2WHRA 4FOLA 2VAXA 1T4MA 1IZ8A 2O2IA 3HI4A 3GFFA 1C7IA 1FFDA 2EDCA 4AN1A 1AC5A 4P9NA 1QIHA 2QZPA 3P2MA 3A2LA 2P8SA 4MEAA 2DHCA 4FHZA 3DOHA 5FUMA 3L1IA 2RHWA 5EGNA 3HJUA 2AJBA 2ZYSA 3PFCA 1VOTA 2QS9A 1XKLA 1JMYA 5JAHA 4GWLA 1MAAA 1EINA 1F6WA 2ORYA 1SOMA 1R50A 3BF7A 4RE6A 5AM1A 3FWHA 1CUCA 1XZJA 1UK6A 1TCCA 2WIJA 5CXXA 2XMDA 1EDDA 4KAAA 4KE9A 3HABA 1QLWA 1W6RA 4W63A 5AJHA 3LLCA 3FVRA 1SCIA 4BC1A 3HXKA 3WKEA 4CFSA 1QTIA 1TCAA 3T4UA 4YPVA 4EZIA 1DTEA 1DWOA 4Y2YA 2XE4A 3DNMA 4RNCA 2GYUA 3SWWA 4AO8A 4C87A 2GZSA 5EHXA 1QO7A 4LIPD 3DCNA 3WK7A 4Y2UA 3C5VA 3ZLUA 1MAHA 3A6ZA 4CG1A 1HPLA 3G0CA 4WY5A 3UUFA 1QIJA 1TQHA 1E66A 3KDAA 2C7BA 3FNBA 1XQWA 1WM1A 4WDQA 2VATA 1CUFA 5CT4A 3FVTA 5CT6A 1DINA 3D4LA 3I1IA 3F98A 2QJWA 1UZAA 1QZ3A 2VAVA 1YS1X 5DNUA 4KAFA 1HDEA 3OC0A 2OLEA 4OSEA 2XUFA 5AKIA 3H0CA 2WIGA 2PSJA 1UOPA 2QTBA 5AM3A 5HK8A 2OAGA 1ZOIA 2QKYA 3MGAA 1CUZA 4FFWA 3ICWA 4KRXA 3EQ9A 1YSCA 4AMZA 4ARAA 2O7VA 1W4LA 3S2ZA 4J0JA 3IUJA 3G0IA 2OAEA 4GW3A 4ZV7A 2WIFA 4C01A 4GBGA 2ACKA 1ZI6A 1LPMA 2WTMA 3WYNA 5HFAA 3RARA 1VXRA 4NS4A 2HA2A 2DHDA 2J4CA 3H2GA 2PSEA 1L7AA 4UBOA 2ZYHA 1A88A 5AI5A 4CI9A 3BDVA 4J7AA 4K6GA 4UFOA 1P0QA 2CZQA 4BRZA 3CN7A 2OCLA 2GBIA 1DX6A 4L3WA 4DNFA 3DEAA 4UBKA 4B80A 1MT3A 2XQKA 1ACLA 1CIJA 4DMKA 1THTA 5ALVA 1EHYA 1QIDA 4C88A 1G5FA 1FFAA 1U2EA 2JGEA 4UPDA 3WYDA 1H2XA 2D5LA 1ODTC 3O0DA 3ESAA 1DWPA 2XUQA 3K2IA 1CR6A 2IX9A 4C4ZA 1GPNA 1P0MA 5ALFA 4OB6A 4W1PA 2C5GA 5ALUA 1AUOA 1Y7HA 3FYUB 3BL8A 1ZGBA 1FSSA 3F8SA 3O4JA 4TVKA 5IVDA 4KAJA 1ZJ5A 2O2GA 5ALRA 2H1IA 5AK5A 4U2CA 4G1FA 1X2BA 3G0DA 3JWEA 3M83A 1ZI8A 3GUUA 4W9RA 1UK8A 2QOEA 1YB6A 4IH1A 3W06A 2V9ZA 3N2ZB 2HA7A 2W22A 3QPCA 1MX9A 1MNQA 1P0PA 4NZZA 1CUXA 1Q84A 3H04A 5A7HA 5ALSA 4BZZA 5ALJA 2HRRA 1X70A 5HKAA 4L72A 2G5PA 1C4XA 5LZ8A 4ARBA 4M0MA 3F96A 1YCDA 3O95A 4NVRA 4ZV9A 2C4HA 2PX6A 3S8YA 4G5XA 2YASA 4HXFB 4N8EA 5CT5A 1EB8A 1USWA 1R3DA 5ESRA 4EA6A 3C6XA 1XZDA 1S8OA 4MWSA 4DSZA 4OYLA 4W1SA 4CIAA 1OILA 4E15A 2QXUA 5J3JA 3JW8A 4JUIA 4FDMA 4FBLA 2CJPA 3FYTA 4EHBA 4Z49A 4OUKX 1TKRA 4GHWA 1PV1A 4JEIA 2PSFA 5SYMA 4DYHA 1B6GA 2JIDA 3G02A 4J0CA 4C89A 1G66A 4W1RA 1H2YA 3WL7A 5DTIA 2XMRA 4MQLA 1Q0ZA 4O08A 1LZKA 2G4LA 5HQ3B 4IHAA 4EB0A 3QPDA 3VXKA 5ALEA 3PF8A 2RAUA 2Y2UA 4J0DA 4FNMA 1QJ4A 1GQRA 3H17A 4P93A 1XZIA 5HZGA 2Y2VA 3EIOA 1ZGCA 2BCEA 2QMQA 1A8SA 1MU0A 2H7YA 3U0VA 4DMHA 4K6HA 2WQZA 2XUPA 1LLFA 1QOZA 3I6YA 2RI6A 2QR5A 2JGJA 2ZJ6A 1HLGA 2XLCA 5EHZA 1JI3A 4X92A 4WJLA 1YB7A 2XB6A 5DLPA 1XRLA 1MJ5A 1KEZA 1CFJA 2QUBA 4QDZA 1SFRA 4UFPA 5ALPA 1XKTA 2J3QA 2XUJA 4BP9A 2HHAA 3CXUA 1ORVA 2WM2A 2DR0A 1QIMA 1BCRA 5ALMA 2PUJA 1TIBA 4QNNA 3PUHA 3DQZA 1VA4A 4MYDA 3DYIA 4H0CA 3HYSA 4BAGA 1ZD2P 5FDFA 4DNOA 5AKYA 3NWOA 2PSDA 5IVIA 4H7HA 3R0VA 2XLBA 3AIKA 1CLEA 4WDRA 5F4ZA 3JYHA 1Y7IA 4EY6A 3DOIA 3R3VA 2WKWA 3G9XA 1LBSA 1R9NA 1M33A 2HADA 4L9AA 3CCCA 3F67A 1BCSA 3STVA 2OCIA 3HLKA 4WY8A 1GPLA 5C8VA 3D0KA 1BN6A 5HK9A 3W9BA 3C87A 5CT8A 3AINA 5K3FB 2BUCA 3AZQA 2ES4A 1OXMA 3ESBA 4INZA 4G9GA 5AI0A 3B12A 4EY8A 5T4FA 3C8DA 5D3ZA 1WB4A 1N8SA 2BGNA 4BTVA 1SCKA 3CN9A 2V97A 5JD6A 2CUTA 4C4XA 2WJ3A 5IKXA 1QIKA 3BJRA 4PSUA 5A62A 1IUNA 3WJ1A 3DYVA 5CH5A 3O4GA 4A23A 2HU7A 6YASA 3HZOA 1H23A 5EI5A 2JGKA 5EIEA 2WJ4A 4YK7A 4H35A 1N1MA 1J06A 1N5MA 1LPBB 1JJIA 5JIBA 4OU5A 1XRQA 4U2DA 4Y2TA 3KWJA 4U2GA 2E3JA 2JGLA 2HU8A 2XMZA 4X95A 4H7IA 1ODSA 3O4IA 4F60A 3I28A 4E11A 5E4TA 4BE9A 1D07A 3B3QA 4EBBA 4AMYA 1DT3A 4Y2VA 3A70A 5T4HA 3UMJA 2BGRA 3WIOA 4DTCA 3IA2A 2XUGA 4HZGA 3LS2A 1CUYA 3H18A 2H7XA 1XZMA 2Z3WA 3T52A 1XZHA 5EFZA 3D2BA 4ZXFA 3H2IA 1YA8A 3FCYA 1Q83A 4S0XA 1EB9A 3STTA 5LZ2A 3F97A 3V1NA 5AO9A 4PSCA 5HQ3A 3WA6A 1ZJ4A 3WKAA 3BE8A 1AGYA 4LKOA 2FUKA 3GELA 1XLUA 1WHTA 3AZPA 4PQEA 5HF9A 4RE5A 1H22A 5HF8A 3WIBA 5FXMA 5FPQA 3QZUA 4KE6A 5D7BA 2HFKA 1XZEA 1THGA 1GPKA 3BWXA 3IB3A 2XQGA 1LPAB 2WSLA 2WILA 4OB7A 4LYDA 1WOMA 3M81A 3I6ZA 1ETHA 5C81A 1YAJA 1VA5A 3EQ8A 3EQ7A 5LIPA 2Z5GA 3STUA 4NMWA 4Y2JA 1Q0RA 5AM5A 3I1YA 4N5IX 2UZ0A 5DTJA 1HL7A 3M82A 2RONA 2ZVDA 4B82A 5A7FA 2HA3A 3VJLA 3O9MA 4X97A 2OGZA 1WHSA 1I6WA 3ZWQA 5AICA 3FSGD 1HKHA 2QRUA 3NGMA 3MUOA 3WWOA 2QM0A 1KU0A 2ZJ7A 4QDTA 5K3BA 4FTWA 5AM4A 3YASA 3IBTA 1AQLA 5HFNA 2CBGA 4X85A 2AJ8A 4UHHA 4H7KA 3R3ZA 1GKLA 4BRSA 4M0FA 5ALDA 1LGYA 3G9UA 5LZ4A 1XRMA 5LZ7A 2VQ6A 3MUNA 4AX4A 1VZ2A 3W05A 1RYYA 1B41A 1JU4A 3FAKA 4BATA 2CMFA 4N8DA 1JKMA 3FLAA 4BVJA 2PU5A 4B0PA 1O6GA 1C7JA 1OCEA 3QM1A 3X3HA 1TRHA 4KRYA 2QUAA 1VKHA 1CUAA 3VISA 3ANTA 2YYSA 3W9UA 2XMGA 5E4YA 3BF8A 3G9ZA 2VA9A 4HXEB 2WUFA 1EA5A 4J0HA 1QFSA 5AKLA 4OD0A 2XQFA 7YASA 4CCYB 1EVQA 3E1GA 2AXEA 4X6YA 5AOCA 1WPRA 5A71A 3STXA 1JFRA 1BROA 3MVEA 5ALIA 5JARA 2OCGA 5LYYA 1XZCA 4BCBA 3L1HA 4A16A 1XQYA 2J4FA 4IQ4A 3N0TA 1SC9A 3GBSA 2HA4A 1E8MA 4FFVA 4UHCA 1BU8A 4Q3OA 1DQZA 2B4KA 1MO2A 4PF1A 1TAHA 4WFKA 3LCRA 2HDWA 1LPSA 4X00A 5C7YA 3E3AA 3CCBA 4QA9A 5E4JA 3H2JA 3PF9A 1CPYA 3O9VA 5BV7A 2XMQA 2JGFA 2XQJA 3QYJA 5HKBA 2HA5A 5LKRA 3WL5A 5AM2A 1QIEA 5AKEA 1R1DA 4DSAA 4GI1A 1UFOA 2B20A 1XQVA 1BE0A 3WK8A 2DHEA 4HS9A 1EK1A 2HIHA 3QMVA 4X91A 3OPMA 1AKNA 4CCWA 4HXGA 1VE6A 2Z3ZA 2Y6UA 3QVMA 3WQHA 2XUOA 1LPNA 5AKKA 3DLTA 5AOBA 1U8EA 2FJPA 3AJAA 2HL6A 4YX9A 2B61A 4U2EA 4U2FA 3SX4A 1MPXA 4C4YA 2ZSHA 4DMCA 1LPPA 4ZRDA 1AZWA 4Y2QA 3ZI7A 3HACA 3DJYA 2WG0A 3LIPA 4UUQA 1QIIA 1G42A 3TEJA 1GKKA 1F0NA 4AN0A 1NX9A 2BUAA 4QDXA 5KBYA 3STWA 3HRHA 4DLNA 1IUOA 2ZYRA 1GT6A 1CVLA 1ZIXA 2X5XA 4BCCA 3R41A 3DL7A 3BJMA 4BYMA 3D2CA 2BKLA 3I2GA 4M0EA 4BE4A 1ZD4A 5EHQA 1CV2A 4F21A 4BDTA 4C6HA 4X7BA 4K5QA 2ECFA 3IDAA 2WFLB 4MWTA 4Y2XA 4K6KA 5ALGA 2I3DA 3PFBA 1WB5A 1XZLA 2IITA 4EY4A 1A8UA 2FX5A 5FP0A 4WFIA 4XWGA 4ITVA 4BP8A 4ETWA 5A2GA 3C43A 5CMLA 3AUKA 2I03A 4BBZA 5LLSA 2PBLA 4W1QA 4JH0A 5EIAA 4BB0A 5AI8A 2EDAA 2R11A 3QMWA 1PFQA 1QGED 5ALHA 1CUGA 3WK5A 2WHPB 5ALQA 4X93A 1F8UA 2GBFA 3KSRA 4ZREA 3FOBA 5C8ZA 4WCVA 4B81A 4FWBA 4J0KA 4OCZA 1UK9A 1ORWA 2XT0A 2Y1KA 3K9BA 4UHFA 1QONA 4Y7DA 4BC0A 1NU6A 2OCKA 1DX4A 3OTQA 5JD4A 1CEXA 1CQWA 4H7JA 4TGLA 2O2HA 1VZ3A 4QE3A 5FV4A 2WHQA 4P08A 5EIHA 4B0OA 3IVMA 4J0IA 5T4BA 2DFPA 1J1IA 4H7FA 2JF0A 2R8BA 2XUIA 1UKAA 2HRQA 3C70A 3QMMA 1ZICA 1F0PA 3FYUA 3FLEA 1QIGA 1JMKC 2HU5A 1QO9A 3G8YA 5BWBA 3D2AA 3R40A 4B7ZA 4GEGA 4OYYA 4G4GA 3U1TA 2IIVA 3DL4A 2VT7A 2WU3A 1LNSA 2QJRA 3HC7A 1CRLA 2PVSA 4CIBA 4J03A 4KE8A 1E8NA 1UKCA 4RPCA 1MTZA 2WIDA 3R3YA 3IULA 1AURA 3HSSA 2PKYX 5ALLA 1CUHA 1ZI9A 3WA7A 1BN7A 1TCBA 1K5PA 3V9AA 2WLSA 5DJ5A 2B9VA 1EDBA 3DKKA 2OPHA 4E46A 2VJCA 4Y2PA 5ALTA 1DWQA 1CUEA 3ZV7A 1QE3A 3NOXA 4G8BA 1FFBA 3V48A 3WWDA 1FJ2A 2GZRA 5AHXA 1GZ7A 2WUDA 4UBLA 1A8QA 4Q34A 1FFEA 4JYMA 1L7QA 5AP9A 2XQIA 3STYA 2Y6VA 3Q0TA 3C6YA 5AIBA 4Y2RA 3R3UA 3H2KA 3E4DA 3PDCA 4JYPA 4UHDA 3WK4A 4ZWNA 3WJ2A 5AKHA 4BVLA 4Q82A 5AI4A 5JANA 1UXOA 4ZGBA 2DQYA 2OQVA 4X6XA 3IUMA 1ISPA 3ANSA 3FYUC 1E3QA 2V98A 2PL5A 3A2NA 3WZLA 2V96A 3DKRA 2JBWA 2Z8ZA 3G9TA 3VVLA 3WWEA 4U2BA 2BJHA 3WLAA 2CEKA 1GXSA 1CQZA 5CT9A 1XRPA 4E14A 5CW2A 4H7EA 1BEEA 2CB9A 3VJKA 4H77A 1CUBA 4UHBA 3IUNA 2HA0A 5LKAA 3G0BA 4BZWA 1E8DA 2HFJA 3LIIA 5LZ9A 4N8SA 4AB1A 1HBJA 4AQDA 1EDEA 3AIOA 4I3FA 4QDOA 3SC2A 4HRYA 4LXGA 1QIFA 3PE6A 4G4JA 2VSQA 3A2MA 1XRRA 1ACJA 2VJAA 2OG1A 5AK4A 1EXWA 5ALKA 4OPMA 3O4HA 1XZFA 3KXPA 1VXOA 2J3DA 5ALZA 5IVKA 3M3DA 4FLEA 4GDMA 4N5HX 5AKGA 5JZBA 3R3WA 3FCXA 1U65A 2WU4A 1IMJA 4K2AA 4L0CA 4OU4A 4MQMA 1CUVA 2YH2A 4LYEA 3BIXA 4MEBA 3NUZA 5AKXA 2C0PA 4KR0A 5IH7A 1R88A 3Q8WA 4X94A 1R4ZA 3D7RA 5CTAA 3IIIA 1CUSA 3AFIA 1DT5A 3UUEA 1UKBA 2X8BA 2XMBA 2DQZA 1LPOA 1J07A 5CXUA 3H19A 5JALA 4DMFA 2VJDA 5DYWA 1YAHA 2PU7A 3KD2A 2D0DA 4BAZA 1ZIYA 2AJDA 4Y9SA 2JEZA 2G63A 2QXTA 3H1AA 5DNWA 2BFNA 4HTAA 3PUIA 3GZJA 3IURA 4H18A 4G8CA
chains in the Genus database with same CATH superfamily
4FGUA 3I3SR 3FNFA 4YROA 1XTQA 4JZKA 2TS1A 3F7TA 2GHTA 4D8WA 1T2NA 1PL0A 5JAOA 3QFCA 4TSFA 4S1NA 1I3NA 3HJTA 1ISHA 5JXGA 1ABBA 1NRJB 2JFVA 2P6MA 2IYUA 3CZRA 5GV7A 1YUNA 2PYZA 3MIZA 5ITVA 1P2VA 1GUDA 2GBCA 1OVGA 3DMFA 4FQ7A 1W36C 2AEFA 4DV4B 4CCSA 3W77A 1W7AA 4MA4A 2DR2A 2PS0A 4CDRA 1A76A 2P65A 3ZCRA 1T25A 2B6NA 2NQ2C 1E69A 4LBYA 4YAWA 5L8VA 3PR3A 3FR7A 5HIIA 4LTNA 3I64A 2BSAA 4YALA 3ZWOA 1QH1A 1VBKA 2WTAA 4ILKA 3T5TA 3TOVA 5KVVA 2EZ4A 4XYEA 4RO0A 2VXYA 5LJIA 2R47A 3DE3X 3AEKA 2BHNA 1E9FA 1MOQA 1F51E 3DAPA 1EFLA 3AUJB 1DAKA 2VT2A 4QTYA 4L2IB 4RFLA 3FLMA 1W30A 1OJ7A 2P67A 1V3VA 3UC9A 1LJ8A 2WFLA 5AVUA 2J3IA 4W6QA 2YR0A 1CJKC 1YBFA 2H4HA 5C8XA 3FOCA 1SG6A 2OLKA 2OO3A 2ZSUA 5F4BA 4DUGD 5J2TB 3FTNA 2A5FA 4A0FA 2REBA 2W98A 4KV7A 4GH5A 2FP3A 3L40A 4PZDA 4XSHA 2XMCA 2ZWOA 4DNQA 3JAMA 1SXJB 2PIAA 2P3OA 3DM9B 4FBMA 5B7NA 1UEXC 2A9OA 3AZOA 2WF9A 3FUCA 5B7QA 4JWKA 1HFWA 1JPVA 1UBCA 1YK0A 2JHCA 1G17A 3TZ6A 3G8DA 4CLEA 1BFKA 3LXRA 4E12A 1GYRA 4BCDA 1BGVA 3HRIA 1TADA 3P45A 4L50A 4LDRA 1TUBA 2PA3A 2HQOA 4NF2A 2MWMA 5D7NA 5AKJA 3ZHYA 1GCGA 3ZDQA 4RKFA 1CR4A 2ZRKA 3V7WA 3C4QA 1IBRA 1XZKA 1DTSA 3EB9A 1K7SN 4WZBA 5FKJA 3EH2A 1QHEA 1EVZA 1KAQA 1ZN7A 1GNPA 1C29B 4L4YA 2Q2WA 1M73E 3IALA 4RGBA 1R5NA 4OKNA 4B5LA 1EEXB 4R2XA 4BFLA 5HKOA 3BWVA 1GQSA 4QLAA 2G9ZA 1P6XA 1M3SA 3GLHB 3W34A 1G2IA 2H6EA 2EQ5A 3UV3A 4BRUA 3CT6A 1K4YA 2R00A 4YN3A 4AC9A 3NTUA 2R8EA 2CDAA 2WJIA 4G1BA 4X7PA 2ZJYA 1N0UA 4K6CA 1E2KA 3JPYA 3O94A 2Z6AA 3LPNA 1K8YB 3GLGE 2N46A 2E21A 3I9LA 1GARA 5JEDA 3SCZA 4ZYLA 2GNAA 1O3YA 1ZRMA 1L1EA 3JAKA 4WACA 4YO8A 3IDQA 4P84A 4HB2A 4LQLA 3TI7A 1H4TA 1I10A 3PFHA 3OECA 2HK6A 3AP1A 1MLDA 3Q3EA 2BFOA 2GLUA 4ND4A 4YI5A 1YASA 2X0NA 3DOCA 1IWOA 2IZ0A 1NOKA 2P1DA 2WHXA 3M4XA 2O3JA 4MV7A 2AFIE 1Q0SA 2WHPA 1U28C 1XXHB 5LQMA 3QTLA 1QP8A 2UYYA 5IRCD 4KUGA 3IERA 1ESCA 4I5EA 3CF0A 1OI4A 3F8WA 3G2NA 3IEIA 1XXHA 4D8XA 4LK3A 1SXQA 3ODGA 1XAHA 5JPIA 3X2SA 4I9FA 3RRXA 2OHFA 4YJHA 1DUIA 1SCUA 3DAOA 3JQEA 3NC1C 5CDYA 2DKNA 4L1KA 1LUAA 2JFNA 4PO3X 3A0RB 2HDNB 4Z1MA 5DYYA 2YHBA 1E2IA 4YAJA 1PEKE 3VR0A 1A71A 1UBEA 3IO5A 5F7JA 5SY6A 4QAJA 1ZONA 3B1KA 4GP6A 3IEMA 2RBEA 2H65A 1W36B 4Q3KA 4ARUA 3KO8A 3ESDA 4X71A 2PZ8A 5E1MA 3ROFA 3KQYA 4JFRA 2H92A 3JALA 1EH5A 4XGRA 2XKJE 4RETA 5BOVA 4BGUA 3A3KA 1X1BA 3Q98A 4KR9A 5ALWA 4EO4A 3Q6NA 2ODNA 2WJWA 1E2NA 4I14A 3IDSA 4NH4A 4YGYA 5AM0A 4OHVA 2KB0A 3SC6A 1X2EA 4JFAA 3GJTA 2AN4A 5CCEA 3I39X 5CLJA 1DMRA 3IQIX 3BB1A 3KWLA 3LOUA 4YCAA 3SGLA 2NXWA 3IBCA 1E1CB 3VKHA 4KC0A 4F06A 2A9RA 2WYOA 3QH4A 4CXMA 2H1RA 2EVWX 2WUGA 1GV0A 5CH3A 4C1NA 1XEWX 3H5NA 2F3TA 2M32A 4IIDA 4ZGWA 2AWNA 5F98A 2QTWB 3OUZA 4F0JA 1KEUA 1P1RA 4TMYA 5BO5A 1JA9A 1YJAA 3F5MA 3RTAA 3J7TA 4B9EA 3LECA 4TKZA 1XMOB 3BPSA 1JWBB 2LTAA 2J09A 3DB1A 5IF3A 3R5FA 2XY4A 4IAOA 1RZRD 4UCXA 2OK8A 3W8EA 4CCYA 3P9IA 3JQFC 4FLMA 5CYGA 4EVIA 5DWQA 4QFCA 3CRW1 3U7QB 2C8VA 5EE9A 4KXUA 1TT5B 2AT1A 4XRRA 5EP3A 4DBVO 4MPRA 4OB8A 2NVUB 1ZSYA 2B8EA 4L57A 2FK8A 1ESZA 3KTAA 2VIIA 4X3CA 5I8ZA 4AECA 5A2QA 1TT5A 2CGEA 5TS3A 3OQJA 5FPTA 5CLGA 2J3MA 3NATA 1TUBB 4KPGA 3UWKA 2P5TB 2HWKA 4AZVA 5EHNA 4EY5A 2H1SA 4PWZA 5U9CA 5J23A 4DRXA 3V32A 1L4GA 4G5OA 4LWPA 1Z4NA 1MO6A 2XXJA 3C1TA 5KNBA 1BRTA 4J4TA 5CLFA 5GONA 1UWCA 2Q0QA 4S12A 4RLFA 3T5MA 4YY3B 2B3TA 1W34A 3K9GA 1QPZA 4MYSA 1C3OB 4D0LB 2C4NA 1JKFA 4H1VA 2WF8A 2VYVD 5EJEA 2OV4A 2BJVA 2F1RA 4OQYA 3WGZA 4OQFA 1I4EB 2QRLA 5MF6A 3JWHA 2W93A 3KPVA 2VEDA 3D6VA 4AM8A 4OQZA 4F71A 2LGJA 2JBAA 4FNGA 1E2LA 3QITA 3HEAA 4B09A 3AFGA 5D3KA 4D9KA 3DUFB 1C1DA 4ER0A 2IHVA 3RWMB 2QW0X 4HVTA 4W82A 3AB3A 3VQTA 5CDSA 4N76A 3RD5A 5C35A 2B34A 4RMIA 1TYZA 3ES9A 1C1DB 4TUYA 1E60A 2ESRA 2KS6A 3AKYA 4I2NA 1JDJA 1H4VB 4KSYA 3I2FA 5DW3A 3BMQB 3QYPA 4WCFC 3WWYA 3TL6A 3NHWA 4Q03A 3Q3IA 4IUDS 1NIPA 2QQFA 1V45E 1P62B 1AX9A 2BF4A 1GZHB 1Z8NA 2VNHA 3G59A 4RH1A 1GNTA 4XWAA 4P7BA 3QE4A 3RC8A 2P9EA 3LHDA 5C4MA 2YJ3A 2Z2ZA 3AEYA 3WZMA 2D0PB 1KYIA 1D2GA 3R3XA 4RHFA 3D5EA 1A8PA 1R9MA 3ROKA 1IB6A 3JRXA 3LQFA 1QK5A 1G8MA 5L4LA 5BW5A 3B1XA 3HE3A 1L8OA 3LKZA 3QVVA 2IHZA 4ZVOA 4DUPA 1E7RA 2C9OA 2W2OA 3L4BC 1BE8A 5E2IA 2J3EA 2WUEA 3AHHA 5FF9A 1WCYA 3WNVA 3OCCA 3QUSA 3TD9A 2I1VB 1SM4A 2VPTA 3MINB 1ZH0A 3LT4A 3P2KA 5F2NA 3WB2A 4F5ZA 1SBTA 1U0TA 4JN6B 2ODQA 4RCYA 1E9RA 1O97C 3CF4A 5E1DA 3U62A 1RLUA 1R6XA 1TECE 2ZYAA 1A27A 1EU1A 1LNQA 3NALA 4IKEA 1OXSC 3PKJA 3A9UA 5CFLA 3O1LA 1Y9DA 2MHCA 2OWDA 3MEQA 3U4GA 2AMYA 2DX7A 4IS3A 4KWTA 5C51B 2GXQA 2VUTA 1U0RA 2FQYA 4B84A 3CUEF 3WRWA 3KOXA 3FY4A 4CKYA 4GICA 4I5IA 4LX8A 4ZQBA 1GFWA 5HGXA 5ISMA 1E0JA 1N5LA 2ZR8A 4MRRA 4PLWA 5CIQA 2IUYA 3RVMA 4NBLA 2BM1A 4RV5A 1X7XA 2J9ZB 4F46A 3JQRA 4KSCA 3C39A 2LWIA 4GE3A 4QDJA 1ZA2A 4ZU3A 1ADJA 2WA2A 2JARA 1KH2A 3EZ7A 3H0KA 4FEAA 1IZ7A 3Q2KA 3BCUA 4UATA 3I01M 5JBNA 3C45A 1XU7A 1X3SA 1JHMA 2HK7A 2ID4A 3I2KA 4LGVA 4FZ5A 4OTZA 3OM8A 2LIPA 2W0SA 5LMZA 4EUHA 4RENA 1HMPA 2YNMA 5BWLA 3TINA 1OZ0A 1XHLA 5G40A 1JJVA 1SRRA 2BMAA 4H0NA 3MMPA 2BRUA 2WG2A 1FTWA 2VP5A 2ICAA 3IV7A 4E6PA 3ZHSA 2EKQA 2Y1EA 3FFWA 3TTVA 1XLWA 5G1OA 3WXBA 4F92B 1MG5A 2NTYC 3CMCO 1GSOA 2Q3JA 1W76A 1MIOA 2A9JA 4MKFA 5GM1A 4G85A 4D2IA 3G23A 3IH5A 4GPAA 1I6KA 4RMNA 1NPTO 5CX1B 3N59A 1OASA 2ENWA 1X7DA 3GEHA 5DP1A 1FFCA 1QCZA 2Y1LA 3V55A 4TV8B 4QYWA 4DSNA 5A1TA 4G84A 2G28A 4CQLB 1MX1A 4UVIA 3TJZA 3CEJA 5CBKA 1VE7A 9LDTA 5C37A 2BAGA 5FULA 1XFDA 4IIJB 4C0WA 3NJRA 2WM9B 3O74A 1IY8A 2A84A 1ZGJA 4ZCPA 3PC8A 2VJPA 1H2ZA 4HYEA 3I2HA 4F2PA 4UHEA 1JLRA 2FXIA 1SO8A 5BSFA 2E4YA 4Z9XA 1R12A 4S1WA 4UBMA 1JDSA 3OEEA 3EYWA 3IUQA 1I13A 1K9VF 2CK3D 1GA1A 3ZD7A 3GN2A 1E89A 4KE7A 1ZINA 2XNDD 2VEOA 3I2IA 1NR7A 3QEOA 3R7SA 3T1TA 2QX4A 2O7QA 2OC9A 3N2EA 4Y6QA 3W6OA 1RRKA 2D4AA 1EEHA 1IK6A 1N6PA 4Q9IA 2CYBA 2W2LD 5DN6A 4YRCA 4HDNA 3CUUA 5C3MA 1CDZA 5T6BA 1QBGA 2QN8A 2YXPX 4WOPA 3L9WA 3L7OA 4FR5A 5K3CA 4O4IF 3PNSA 1E7YA 4F8JA 4K2HA 3CUYA 4KXQA 4M83A 1U8ZA 5FI3A 2MDTA 1BXRA 1FP7A 2P9CA 1EFKA 4YWHA 1AO0A 3W1EA 3W3AD 1DFGA 1YRWA 2HSWA 2CNDA 4MYRA 4II3A 2VP3A 4UUAA 5EUMA 3TQCA 1GL7A 3FUXA 1N78A 2ZVQX 2PLFA 3L1JA 1ANKA 4N03A 2ZUTA 4EOGA 5DN6D 4ZC1A 2HGSA 1N2CA 3O26A 1O8CA 1U2DA 4IIFA 4ZA2A 5K4HA 3K5IA 1WXEA 3KV3O 4E5KA 2Q62A 4MV4A 1Q19A 5FPPA 4QFMA 3DKIA 4AAYA 4B83A 1BWRA 5GZ6A 3NRBA 1ZC3A 3TTTA 2ZJFA 4IJKA 4HQOA 5ELLA 3HUFA 4JYCA 1MOSA 5HCUA 2YZMA 1D2NA 4PYRA 4W5JA 1PE0A 3OAAA 3VNSA 1EWRA 2C7PA 1ZVMA 1RAEA 2JZOA 1ID1A 1NUHA 4H3VA 3E9NA 4M38A 4R41A 5ANRB 5I9SA 1IAVA 3OIWA 3EDMA 4FCTA 1NW9B 1GGKA 1VHTA 4TS1A 2YOFA 3C8HA 4IFTA 4C29A 1UOOA 3ENQA 2OBNA 3I9V1 2GN8A 2WE8A 4BMSA 3PEYA 1VJTA 4TKUB 1USIA 4PZ9A 5I9IA 5LD2C 2BKXA 5CBPB 4ZTUB 4BAUA 2C2KA 1NG9A 4C6TA 3L84A 3LX5A 2GJKA 3NEPX 2ONZA 2H1HA 1NXTA 3BIWA 1I3OA 4JA2A 4NQZA 1LX7A 4JNCA 3CVVA 2PZJA 3QPAA 4CL3A 4F86A 5HJEA 3WRYA 2Q1SA 2WPDD 3LHKA 4DJ5X 1BDIA 1GPMA 1U1CA 2V3VA 4KITB 4O02B 2OQIA 2PH5A 2JEYA 2EEPA 1AHHA 3WWZA 2CNOA 2GZAA 1T0PA 1JJFA 1DU4A 3V8MA 5JRJA 4WLNA 2AJCA 3QVXA 3MWLA 1NP7A 1ZHHA 2FJ0A 3GPBA 3V6LA 2WBLC 4I6EA 3AF2A 3OO1A 3K5HA 2PUBA 3GJRA 2WKSA 4WINA 1QFMA 5HSGA 3F78A 3R9WA 5JS1A 3BM5A 3N0WA 5CTJA 5JAIA 1UOQA 4RMGA 4JXZA 4DARA 1N6LA 3W8RA 2WF5A 1FDUA 3EEBA 1WTAA 4A8PA 3RFXA 1SBNE 2H11A 4HX2A 2AK2A 4JP2A 4EO7A 5JC8A 1X80A 2GBLC 1GCIA 3N86A 4FS3A 4ZI2A 1Y33E 2NSDA 2W6ID 4PRKA 4D4IA 1WTCA 4L75A 1Z2OX 2AL7A 4NWIA 5J2TA 3L49A 4EUKA 1V95A 2RHTA 2XDWA 3NHJA 1NQ5A 1XEAA 5FOUA 5FWXB 3EBLA 5ALOA 3RHSA 4BDSA 1ZUNB 2JI7A 2NPIA 1O8BA 4BLUA 4E6EA 1OXBB 1G291 3A9SA 1KIMA 2FN4A 2P6OA 1RHKA 2GCPA 1F6BA 4MB6A 4WZAE 3WS7A 2O5EA 4AU1A 5GADl 2O8FA 3CPSA 2QRVA 2CUKA 2RGBA 4V38A 5D2CA 5FORA 4P7KA 3C6BA 5JROA 5K0ZA 1X19A 3JQ9A 1F20A 3GFVA 1DC3A 2JHGA 1MB2A 1BW9A 1EE1A 2AK3A 3TVTA 3KT8A 3R6GA 4I1OA 3W2TA 5HIAA 1Y8RB 3UXYA 2JLVA 3GHYA 2ZZMA 1YGYA 2NO0A 2XDAA 1FQJA 1KXJA 1WXXA 3IAS6 5TEWA 4EUSA 1USUA 3ISVA 1YZ3A 4A8JC 4MTLA 3FBWA 5BY2A 3CT4A 5IAEA 1CEQA 1X8KA 1ZGHA 5IEBA 2EV9A 5EZ6B 3UAVA 3EFOA 4MVJD 1KL7A 2MOKA 4URHA 4XX1A 4I1IA 1DC4A 1E2JA 1P5HA 2OCPA 4IMIB 3KT0A 3QELB 3FR8A 5H8WA 5ADVA 3SHQA 1MG0A 1XFAA 2GEFA 3IVAA 4M1OA 2JGIA 4OKIA 1RXEA 4TXHA 5AI9A 4ZVNA 3E9YA 5HW0A 4KKVA 1KNXA 2JHFA 3IR5A 1NXWA 3QJYA 3AX6A 4J07A 1YJQA 4L8VA 5TVGA 4JI5B 3S2IA 1VGRA 4ZEMA 1YRHA 2A3RA 2RC6A 2X7XA 2PYDA 3MYYA 1BFUA 4Q1FA 2E6KA 3JQGA 3UJDA 1IOVA 1SZJG 2ZAYA 8OHMA 1TQ4A 1PDWA 4DG8A 3BN3A 4BNDA 4FOLA 3FETA 4JSTA 2RGNA 1G21A 3GQBB 3IT1A 2Q4RA 4I1SA 4RQBA 3U61B 4V0ME 3PZBA 3NDRA 1RWWA 3TSWA 1IZ8A 1DE0A 4U7PB 3KAPA 5CLIA 1UBLS 1WJGA 2AB0A 2PWAA 1NVVQ 3EGVA 5HG0A 2JCSA 1FFDA 2VHJA 4I99A 3X1XA 2O0KA 4GFDA 4BNXA 5BSGA 4I9NA 1AC5A 1TUIA 4P9NA 3EXHA 1YHZA 4Q7JB 4RZUA 2I1LA 2QZPA 5BT9A 2YWRA 2P8SA 3U7GA 4ZVVA 4JBNA 1T5BA 2C95A 3LPLA 2AKYA 3U44B 3OA2A 2E4ZA 4I3GA 1AE1A 2BBTA 1TMKA 4EJSA 3U7RA 4U2KA 3KB2A 3NDPA 1YONA 5FUMA 2JLRA 4MYCA 3EVGA 4QREA 3HJUA 3EZ9A 3CGGA 3DHNA 2ZM5A 3HKDB 2IV2X 2OT3B 3CWCA 3AM1A 3VDRA 1VOTA 2A9PA 2QTVB 2WSYB 4QHYA 3W3ZB 4EHDA 1JF8A 4ZV4A 2UYGA 3ZD8A 5JAHA 1P1FA 2Y99A 1JAYA 1G8JA 3KZOA 4FFPA 1MAAA 1YH3A 1Q95A 1F6WA 2AW5A 2ORYA 1YS9A 1SOMA 1WQ3A 2CLKB 3BJIC 3UY4A 4G1CA 2A1IA 1WY7A 3MT7A 1TEXA 3AR5A 3OE5A 4RE6A 4FILA 5L4SA 3AF6A 4X1YB 2GN6A 4YRSA 2QROA 3I6BA 2ZUBA 1UK6A 4D92A 2X9GA 4CEJA 2FUG6 1E1CA 3FW1A 2O1XA 2WIJA 1L5OA 4L5BA 1BXGA 4RVHA 3A3OA 4NRDA 4LHZA 5CXXA 3CZPA 3GP3A 3UMCA 3WQBA 4Z4QA 3GEBA 4E1VA 3WHPA 1ECBA 1ZH4A 3WYEA 4EI2A 5LP6F 1M5RA 4JXJA 3F6PA 3FZGA 1NRWA 3RVRA 3AC0A 3GMTA 1T9ZA 4W63A 4D8TA 2WYWA 4Y2HA 3ZVNA 4PEVA 1N2BA 2WAOA 3CEAA 3WTBA 2DJ5A 1SCIA 1X7XB 3E22B 3CTPA 1XPJA 1GSIA 3GG2A 3LUFA 2VKTA 1QTIA 3CJTA 3GARA 3LUAA 4YBRA 5BRJA 2GTIA 2YWEA 3T4UA 2YHSA 5EJ6A 2X3YA 4HDKB 5KYXB 1AN9A 1K5DA 1HE3A 3LUJA 3PE3A 2FSHA 3OX2A 1MDFA 3VO9A 1FZQA 4Y2YA 3W6ZA 1V37A 2ZRGA 1WE2A 3DNMA 3LUHA 3AI1A 2DFDA 3TOZA 4QM7A 2JCYA 3K0FA 1EWYA 2G9UA 1ZK4A 3IQFA 2B4YA 2EW2A 4ND5A 4QICA 1K8ZB 2IC5A 2GZSA 4P35A 4YI3A 1W9HA 4MTCA 2ZQYA 3HQ4O 1QHHA 2YVAA 1HZJA 1W5AA 3BX1A 4WMLA 3RPEA 4PFQA 2AHRA 1ICIA 4HBZA 4R2WA 3IAAA 4X5OA 3A6JA 1MAHA 3D7NA 3ESXA 3FYCA 1P45A 3NHLA 3S28A 4BPRA 2YUIA 1UJ2A 4CG1A 1FBNA 1W48A 2O0LA 4LZJA 3DO8A 1G20E 1D03A 2I1WA 3FPGA 4JXKA 4MAFA 1BE6A 4V0NA 4ZU6X 4EHNA 2CSXA 4V1CB 2G0NA 2BI7A 1DBIA 4QJBA 4EB3A 2RHGB 5J5CA 3PXBA 1JR3A 3F47A 4LG1A 5IN5A 4GVXA 5IHXA 1U0BB 1OFVA 1XQWA 3DWFA 5BQOA 1PSWA 5GV8A 1L4NA 3ZGLA 2DUNA 4E1BA 1W5EA 2EAUA 4OJMX 1CUFA 2ZTLA 3FVTA 3PNLA 4IDEA 4LW8A 5I7EA 4FUQA 3I0ZA 2HF9A 4TRRA 4FHCA 1EBUA 1XXLA 1T8UA 1F5SA 5ESWA 4M9RA 3M6XA 1AUQA 3EXIA 1UZAA 3NBXX 2ORWA 3QEKA 2VAVA 1GP2A 1TYCA 5DNUA 1P3DA 1HDEA 2TMKA 2PSSA 3H5AA 1NNSA 3T7IA 2V3CC 3W1VA 3DUFA 5BURA 4NJEA 2JFQA 1T8TA 3H0CA 2WIGA 1IXZA 2PANA 3NTLA 4KPEC 1XCPA 1MVLA 1Q7CA 2VWHA 1MO4A 3PQ7A 4W5HA 1JI0A 4V0OA 5FA5A 3X44A 2FYTA 3UPDA 2H48A 3C7CB 4LJ4A 3VYTB 2BFEB 4P81A 1CFZA 1ZY2A 2BP7B 1QFZA 3JYQA 4M7WA 3FKSD 3JSXA 3K96A 4Q5IA 1T8SA 3EASA 4KLNA 4KRXA 4ZAZA 5T5QA 5B36A 1GQ2A 1K75A 1NULA 4F2WA 5GQSA 4J0JA 3K4PA 2I22A 4HVAA 2C84A 3JATB 4RVUA 2WPNA 3NR2A 2Q8QA 4L4SA 1FB5A 3O2SB 1UFRA 2HB6A 3OZEA 3L07A 2ORED 2XB4A 1Z2AA 4Y6OA 4C01A 3GT7A 1WP9A 1WUKS 2GNPA 3A4TA 4AJJA 1ZAYA 4GBGA 1IPHA 3DR3A 1X7YA 5REQB 2CNWD 5HFAA 3IEPA 3MGKA 5JRDS 5K0BA 5DM2A 2I62A 3C6MA 2H16A 3M4ZA 5I9NA 5K09A 2PKWA 4L85A 1Y3DE 2DETA 4AKGA 1US8B 1GCOA 3S70A 2JJ2D 1NYLA 1WP4A 4GI7A 2D0IA 2W6JD 4PM4A 2GQ0A 5FQOA 4CKBB 1HO3A 4E33A 4UBOA 1OFGA 4MVJM 1NUPA 4Q9NA 2QY9A 4HH0A 5JS6A 1JB1A 3WBKA 1K7XB 1KP9A 4CI9A 4LYYA 1RPJA 3BDVA 1DIBA 2O9JA 4J7AA 5BSHA 1QLJA 2CZQA 1AS0A 1Y7TA 2LIVA 4BRZA 1VDZA 3CN7A 4U3JA 4XD2A 1TM2A 3N0XA 3V46A 1A7AA 5CFRA 3MQ4A 3NHBA 1TI7A 3VTZA 2BFCA 2X19A 2X8JB 4CBVA 4DNFA 7REQB 1AJEA 1TU3A 4ZT4A 1KXZA 3U48A 1NTOA 3RLFA 1MT3A 1TU0A 4K0RA 4JLJA 4P5DA 1ARZA 1IEQA 5TMPA 2DQSA 1CIJA 4DMKA 2NP7A 3UATA 1KC1A 3ZHUA 1MDBA 3DBLB 4O4JF 1NPYA 3BWBA 3I42A 5FTJA 5L7TA 4WGFA 1GITA 2QGNA 1UPFA 2EZ9A 2QDKA 2YRFA 3RH0A 4E13A 3H4TA 2VTBB 1IY2A 4WK2B 5HNKA 2GPAA 2OFPA 1H2XA 1ZP6A 2D5LA 1L4LA 1FRVA 1UBHS 1ODTC 3JARA 4RK1A 4AJ4A 2C2BA 2EATA 3ZZ1A 1M2VB 2XA9A 3OLCX 4QGGA 2YDXA 1TD1A 3GCXA 3GOHA 3EXFB 4C4ZA 4CE6A 1SUEA 3HCFA 5LYJB 1UBUS 1FUYB 3CG0A 4OB6A 2W4IA 4W1PA 4TVBA 1S2IA 4IHJB 1UXGA 5ALUA 1L1FA 1LDEA 4UAUA 3FZEA 5LYJA 4A4DA 3ZZ0A 5KHOC 1Y63A 1IHUA 3KELA 4JX8A 1YZGA 3TW8A 1DC7A 3C15C 2IK8A 4NTZA 3DTVB 4XUDA 3OETA 3AL3A 1Z4JA 3PI7A 4KPUB 3IPAA 3O83A 2WSSA 3OF5A 5ETJA 3TIFA 3LBYA 1YDFA 3PCXA 4G0PA 5B2FA 3WYCA 2GZ3A 2WJJA 5AVKA 4URWR 3ZWCA 4BN5A 4Z4HA 3CVWA 4DLZA 3EOBI 4KYIB 1RHMA 1NZJA 3GX1A 1X2BA 1Z75A 4RKYA 2EQAA 2QUKA 1ZZGA 1D2RA 4WCDA 3R9IA 3MXOA 5B7GA 1PJQA 1ABEA 1UK8A 2EZUA 1FOEB 2RI1A 2O2JA 3A1WA 1E0KA 3O1HB 4KGDA 4NQRA 2V9ZA 3W06A 3DV2A 1QUEA 4HGZA 3ORRA 5DM60 3H5WA 2XZLA 3L1UA 3H1GA 8GPBA 2HJRA 3FNGA 2YHUA 1MNQA 1P0PA 1VYHA 3HBMA 4NZZA 2X0FA 3O73A 1R0CA 1RWPA 2BHRA 2OV6A 4P2GA 3BFXA 1BE1A 5B53A 1RYFA 3H04A 4ZJZA 1CZKA 1KYWA 1YTUA 2B4RO 1W73A 3A36A 4BZZA 1XNQB 2PDAA 2ZSJA 1NJ8A 3G7UA 4R1TA 5FNVB 2FR0A 2HRRA 4DE5A 4F2DA 1NN0A 2PLRA 5HKAA 1GVNB 1N3BA 2PWYA 2ZB8A 1DAEA 2ZB2A 1C1XA 3CNEA 1ZITA 3ZTTA 3DT9A 1Y8QB 2WSIA 3IQHX 4LK2A 3F96A 3MHTA 1ZMBA 1P75A 1WHSB 2QZ4A 3AB8A 3E7FA 3KVNA 3O95A 1E3MA 3B70A 4JI8B 4TWRA 4JASB 1YL5A 3ZY6A 1DEOA 2QR3A 2YZ2A 4KXLA 4TZTA 4JI1B 4PQYA 4RMJA 4XQGA 2IFTA 1I7LA 4HFNA 1WLYA 1YJBA 3BZBA 4JBHA 3V9PA 3S8YA 4G5XA 3M3PA 3MD9A 5DYNA 1IOWA 4JDUA 1H0SA 4N49A 1EFDN 1EAYA 4UCQA 4FNAA 4BL5A 3MGGA 3KZVA 3QWIA 5CEFA 4RD3A 3RHFA 1E5QA 1OVMA 3ID6C 1DCKA 2XMPA 3FMOB 4RD0A 3WP1B 1RYZA 1AF4A 4CN8A 2H4YA 1YBAA 2C4KA 5CXSA 4DREA 1LF5A 2CWWA 3OT1A 4RPJA 3L4KA 2OOSA 1J99A 3OZSA 3IVCA 1SUAA 2ZG6A 3C6XA 4QD3A 3QBTA 3ZGVA 1MD9A 1IN1A 1S8OA 1QHFA 4COOA 4FUTA 3T38A 4FMBB 1NF3A 3OHMA 4G0XA 3RT1A 1URPA 2BPOA 2DVMA 4O4LB 3QBVA 4URZR 1Q0QA 3FG9A 1KMNA 1W5BA 2HKIA 2FPUA 2PX3A 2ZRCA 3IS3A 4OUDB 3W2FA 1HH4A 3ORHA 2PT9A 3QBDA 4MDHA 1WDWB 4JUIA 4FVTA 2R2GA 2GI4A 4A82A 5LIRA 4AP9A 3WHIA 1Z2EA 1E98A 4V03A 4D3ZA 3DL2A 2E82A 1PLJA 3FYTA 4MGYR 5IHPA 3ITKA 4OGLA 2AV6A 3EOAI 4UTRA 4ZARA 1X8JA 2I99A 1X1SA 1CR1A 3COPA 3BSFA 4PYOA 3MCVA 2ZBDA 5A3RA 1T36A 4DM7A 2ZJZA 4HUQA 3GJ0A 4PC2A 1PD1A 2PSFA 1EYZA 2YYAA 4JLKA 4JP3A 4B3BA 4J0CA 5JCJD 1U6JA 3NAQA 1MABB 1YMQA 3UKOA 3QV1A 2Q1XA 3O47A 1H2YA 2B8TA 1OY1A 1R9GA 2R7MA 3OJOA 3CZ4A 4MV9A 5D86A 3ABQB 5DTIA 1D6JA 1Q0ZA 4OSOA 3ZC3A 1H2HA 1N1GA 1RQPA 4O08A 4D25A 1JW9B 3BWDD 3KWMA 2TMDA 3AESB 4RCVA 3PDIB 3R5KA 4EB0A 1GGMA 2BMJA 4MVJE 4YDRA 2X0DA 4YUZA 3MT9A 4Q7EA 2IF0A 2RAUA 3O3OB 3OJCA 4KBGA 4O2BA 3ZWWA 3QVKA 3ZCQA 3P26A 5DK6A 3E84A 4TZ6A 3G0HA 1YD7A 4O1IA 4D4HA 2PMBA 5LXTF 2H8GA 4PHTA 3D54D 3IHLA 5TF0A 1CDDA 4LX0A 3RREA 4P93A 3FSRA 3RVOA 4JYAB 5KNCD 2BR3A 1QMPA 3P71T 2VA8A 2C4UA 4TWZA 5EHGA 1PF7E 2P0YA 3QGMA 2Y2VA 1Y8RA 5IABA 1RRFA 2F8LA 2NV6A 3L0ZA 3B6KA 4IO1A 2M6RA 2DFLA 2PEYA 1VCMA 2GM3A 4GT1A 1A8SA 3DZ8A 3UHOA 3IPYA 1OYOA 2H7YA 5B12A 4K46A 2PQ0A 3CE9A 1DAHA 3PFCA 3U0VA 1RCTE 3ZV4A 1J5PA 2X15A 3MNFA 4HAOA 4DDTA 2XUPA 3VV3A 3UJBA 2ZREA 3I6YA 1QB7A 3QE0A 2R0QC 4I9UA 3MAGA 3FYHA 4Y0VA 5LN1A 2D6FA 3KD3A 4QODA 5GZ3A 2X5KO 4AY6A 1J0XO 4P3YA 3N7AA 4HZUA 4ENQA 2VDNB 5BN3B 4UUNA 1GL6A 1PZNA 2ZJ6A 1YHYA 3LK6A 1Q74A 4AY2A 5J4HA 3OE4A 4F1KA 3L0YA 2G1UA 5TQ0A 4TMFA 1A2OA 5CITA 3O84A 3I5XA 1JTVA 5AT1A 2XB6A 1G21B 3GQBA 4IYJA 1S2MA 4KK3A 5DLPA 1KFKB 4LV5B 3PLAE 1GPDG 1VJ0A 1MJ5A 2D2EA 4NE2A 2ZB7A 3LC7O 4XVRA 1DBPA 5EWMA 3ZUGA 5KJFA 4HP8A 1C7ZA 4RDXA 4PX9A 4TLDA 3ZCTA 1I7PA 1TC1A 4NENB 2QUBA 4E5SA 1KE2A 2CV2A 2DKFA 1NVAA 4KN5A 4QDZA 1AKMA 2FLKA 3PLNA 4UFPA 1M6VA 4IHKA 4XB2A 4OP2A 1FIUA 5FO1A 1WD7A 2BH9A 3DDNA 4FGZA 4I50F 4X3OA 4YONB 3OT1B 4BP9A 4F3KA 3U16A 1K5HA 4GF5A 3OX4A 1QPGA 3RO7A 2C2ZA 2PUTA 4ZFNA 1R2QA 4LYJA 2KBEA 1DFIA 1H3FA 1N8KA 2H2DA 3DEIA 1DZ3A 3NPAA 4JBWA 2FLVA 3CB2A 4PTLA 2CWDA 4Q4CA 3RYCB 4I0WB 1D1PA 4BFWA 1ELOA 3K0CA 4ZK2A 4QNNA 2YBEA 1XMXA 3PFKA 5EJ5A 3PNYA 1U3UA 1XBTA 4PANA 3WE7A 4RFVA 1XVLA 3LUPA 1T4DA 1YQGA 1YKFA 3K9QO 4U7DA 3EPLA 1YJ5A 2Q5JA 2Y4OA 4QYMA 3DYIA 4K9SA 4WLOA 4H0CA 2X4LA 1PRYA 2Y76A 4Q3NA 3AQIA 3F4KA 3F3MA 3ISTA 3OPNA 4K26A 2ZTUA 1L4KA 5B58C 5FTLA 4QQKA 3ZJUA 2XB8A 4BAGA 1ZFNA 3IHTA 3VI4B 3MRSA 5H7XA 4LRXA 5FDFA 2A4MA 1A9RA 2BKVA 2P7HA 3VC1A 4DNOA 5AKYA 2PSDA 3O1JC 1R27A 1YDWA 1YFZA 4B32A 2C5LA 3MM4A 4KDFA 3H13A 5U4XA 4PZCA 3RADC 2XLBA 1ZL2A 3QVUA 5FYDA 2YICA 1Y1LA 1F3LA 1CLEA 3DVAB 4J2HA 4B8WA 2DWOA 1KZ6A 2W9XA 2HBYA 3B2QA 3DW1X 5F4ZA 2I2XB 4BGDA 4ABTA 1Y7IA 1W49A 1SIBE 4EY6A 4NFLA 1KEVA 4I8XA 3KSAC 3VHXB 4M37A 1LI4A 1MP0A 3GAMA 3O2NA 2E0IA 3FNEA 4GBED 4NJMB 5BNFA 4RTNA 2QJFA 3ELWA 5EXTA 1LBSA 3U7HB 4OK6A 1M54A 4QXRA 2A1TS 2H4JA 2HADA 2HIGA 3A9WA 3MG9A 1UPTA 4H3SA 4NICA 4DXDA 4CDGA 2QNIA 3TLBA 2DE0X 5CA1F 1P5FA 3QVJA 2R6AA 4Q4AB 4R0MA 3IQDB 1RI1A 2J0QA 2R6ZA 3LGSA 4OQXA 2IPAB 2GUGA 2H1LA 3G85A 3D0KA 1BN6A 1U2GA 4BKRA 5KU7A 5D85A 5K99A 1YRBA 3DBOB 2VPQA 3TQOA 1JE1A 1TVKA 2WMYA 3DOFA 4FPXA 4RVNA 4JUAA 1SKYB 3SKXA 1M6WA 5AJVB 3VR4A 2R65A 1YB1A 4DMUB 4M7RA 5L40A 1L7BA 1VHJA 4EI7A 1Q20A 2ES4A 4DLPA 4B6SA 4O2AA 4B3DA 3UQZA 2AN1A 2R3SA 4BO4A 1OXMA 3VTAA 3ESBA 1O95D 1YFKA 2B2NA 4LE0A 2GD0A 4G9GA 5CX1A 2F7SA 2E4XA 4H6PA 4K86A 3O3NB 5AI0A 5EWJB 1OWMA 4CG0A 5GY7A 4NMHA 1QRTA 1QH1B 2X86A 2FTKE 1JHRA 2EP7A 3A2KA 5T4FA 3BKXA 3C8DA 4BTVA 1GILA 4Z8XA 3WGGA 2VDWA 1M2KA 3EEOA 4I7EA 4BQFA 3AVYA 3TE7A 3ASUA 4CKCA 1JILA 4XCQA 4YACA 4G65A 3GJ3A 3L79A 4Z3OA 4ME6A 3CN9A 3FGOA 1JRLA 4YRLA 1TGYA 2V97A 4UEOA 1M72A 3O8OA 2G9NA 3RC3A 2QN1A 3HMQA 1K3TA 5IJAA 3E23A 2IYSA 1RM5A 1H1LB 3RS2A 5JNVA 2EX0A 4NK4A 2WJ3A 2Z1DA 1LLCA 1ZVQA 1IPFA 1FYDA 5CLHA 2GA9A 4JDPA 4ZEOA 1J09A 5IKXA 2W2XA 3GRAA 4KQGA 4Q9LA 3HJBA 1NDUA 3BL6A 2PVPA 2VOJA 3INRA 1UJ4A 2RHDA 1GCAA 1M10A 3TCKA 3DLBA 4KOAA 4P8RA 3LXXA 2ZJ5A 2B78A 3EVFA 3IAM1 1MC5A 4KZPA 2NXNA 3CRRA 3I1JA 2MJLA 3KKEA 1KWGA 4QYIA 1GD1O 3OE7A 4NAHA 4RTMA 5ARCA 3HNOA 3HZOA 4OK3A 1PYOA 3EODA 2WWHA 2VK1A 4ENVA 1FW6A 4KUHA 4LC0A 3VRHA 5E9AA 3CZCA 3SYTA 2ENUA 5EIEA 3GGGA 4BQRA 4YR9A 3WDSA 1EGQA 4JENA 1DKLA 3KKOA 1YBVA 4D46A 3T0IA 2ZW9A 1LPBB 3RYTC 2X4IA 3EVEA 4OL9A 1A0OA 1JH9A 3OKFA 1L5MA 3FWKA 3JD1A 4WTOA 4DLSA 5F2EA 3U1VA 4O2LA 4EY3A 3B5IA 2XGOA 4FZJA 3PQDA 4CM8B 3LVQE 3IOCA 3RYFA 3TQHA 4H7IA 4KFRA 2P4EA 4XWKA 3MINA 4E11A 3AG5A 3AVVA 5A0TA 3DAYA 1SVMA 3MCZA 4R1LA 1ONBA 5E4TA 4BE9A 2PUVA 2XXBA 3DO6A 4M1QA 4MQEA 3OQNA 1QP4A 1WSDA 4ZJYA 3B3QA 3DVRX 3L7MA 2BZ0A 5AVRA 4FBGA 3DVAA 4PHHA 3LVFO 4XGNA 3LPMA 3RAJA 4TRJA 3E2IA 1WCV1 4MMYB 4RD2A 4CM4A 4D0GA 5T4HA 3K9WA 2GPTA 4OXXA 4Q4JB 5HR5A 3UMJA 2BGRA 2X4GA 1DIRA 3GFBA 1ONNA 1U0LA 3FWYA 5I7VA 3SHWA 1A8IA 2PQ6A 4EELA 3OEHD 2GH1A 4DTCA 1E5VA 5DOVA 2WTXA 1ZKDA 1R6DA 1IM8A 3I4LA 2XUGA 4KBFA 1HORA 3WL3A 3TN7A 2WABA 3U3KA 3JR7A 1UQUA 3NJ4A 3NTVA 4H6WA 4Z9AA 2AC4A 1UM9B 3M0EA 3LQRA 5C0OE 1U5AA 4B7AA 4AJ1A 3JALB 2ZBPA 1IN4A 1E9AA 2B7LA 3D2BA 5EFZA 1YA8A 5HQJA 3MT8A 1N34B 3NIDB 1FU8A 4FGSA 1JFFB 2JC3A 3QUTA 3PWKA 5ERGB 2XE8A 1XJWA 3HCRA 4C08A 3I23A 5DT9A 1NY5A 2OYSA 2EZTA 4RESA 4WLVA 1JKJB 3NH6A 2JH8A 4I8DA 4BQNA 3CKLA 3VMMA 4K3UA 1W0KA 3NHAA 2BZ1A 1PNOA 3AOEA 3RROA 1JAZA 4F93B 4BFYA 2F1JA 3UH1A 2ZP1A 3GELA 5EWJA 1WHTA 4PQEA 5D3QA 4BQPA 3WIBA 5LBIA 3LKDA 2ZXFA 4HR7A 2BKEA 2CEAA 4UNNA 3ZKWA 5KTTA 3V4FA 3FM9A 5FBWB 1VL6A 1VPLA 3ILXA 4PIMA 3TKYA 5JXJA 4CKWB 4RZ3A 2FGJA 2GA8A 3K1ZA 3CPHA 3ZXIA 1AKEA 4L5AA 3UK0A 4EW6A 3N2KB 4MK4A 2J6BA 4NZ9A 2D5AA 1PSZA 2HZ7A 4DSUA 4TROA 5AR1A 2NZVG 2YVKA 3BWXA 3IB3A 3HVHA 5KSPA 4CTOA 4TLBA 1KEEB 2HNKA 2WILA 1NBWB 2LRHA 2WZQA 3VYUB 5DBFA 5A9SB 5LJLA 2A0UA 1EESA 2FMUA 1BO6A 3U26A 1IM2A 4D02A 4ZJUA 2J31A 4K6OA 3R23A 1DDOA 4WZAA 1EGMB 1U5CA 2I1QA 1VA5A 1NNI1 2EKDA 4F6CA 4M76B 1XVVA 3QPWA 4P6VF 1HT3A 1NTRA 4J1TA 3R6LA 5K0CA 3NV9A 5K20A 2ZBUA 2IXTA 4A0HA 5C46F 4Y9TA 1NJSA 1XCMA 1E3WB 3IODA 4EWLA 4ZYXA 4FJ2A 3BTUA 2CY0A 2VAWA 3C16C 2V7QA 3GD7A 3LT0A 5BWMA 1CHDA 4DADA 3KIPA 3VZBA 3I5MA 1MAVA 2C57A 3IEUA 1DAFA 4QPJC 3V42A 3IR6A 5A4IS 2BLNA 2HA3A 3HB9A 3CKMA 4L7VA 1DS6A 1MOPA 1HQYE 2H9AA 4DABA 3WBJA 2VI5A 3WICA 4YV1A 1WHSA 5KTOA 5TPZD 3JQAD 3KRTA 4LGMA 3SQNA 5AICA 5J5VA 1Y1RA 1KJQA 3FSGD 3PD0A 4JQCA 5EKXA 3NGMA 5JSFA 2OFWA 2BELA 3MUOA 5CA0A 5D00A 1P74A 1EUDB 3SMQA 3WWOA 3N6RA 4D0SA 1KU0A 3M4JA 2NWQA 3ZU6A 1RKBA 1N3YA 2HRZA 3DLIA 5EWLB 2QE7A 3L8FA 3I05A 3U31A 2XNJA 2FZVA 2ZT6A 4KYTA 4W7SA 1H9BA 1FMFA 3IBTA 1AQLA 5EIWA 1Z4PX 2NUPA 3E9DA 4BMVA 3ZLJA 3L7YA 5L3VA 4X85A 3BHNA 3ADPA 5ARBA 4WT7A 3TLXA 1M6HA 4UAGA 5ALDA 4QFBA 3EE6A 3KX2A 1W2HA 3H4MA 4EGFA 5LZ4A 1XRMA 4PGAA 1V9LA 4ZVKA 3ZE7A 5ULLA 2PCLA 5JZVA 4XPIB 4AX4A 3JZAA 5MDHA 2C94A 3ZK9A 1BYUA 4CTKA 1QGOA 2I71A 4LE1A 3LK7A 5JYDA 3I6IA 4IF4A 4IWNA 4JJKA 4LDZA 1FDOA 5KOJB 1RYYA 1HDOA 1Y3BE 2WVJA 4MPPA 1B41A 4JMLA 1JU4A 2OXIA 1Y5NA 1F2VA 1UBSB 4YQFA 3OY7A 1Z8FA 1FX1A 2DUMA 4O4LF 5BQ5A 4BATA 1T2EA 3IKVA 1S2OA 4NHEA 1XR3A 4N8DA 3WLRA 4CQJA 3OJWA 3KVRA 2FMTA 1NF2A 2XTMA 1ST3A 3HR8A 2CFOA 3RQSA 2VJQA 4V3BA 2SKDA 4DSZA 3FZYA 1WBDA 1AKWA 3BJEA 2I4TA 2ZUUA 3P9PA 5DIZA 5H3LA 1EJ6A 1W2GA 3DZJA 3LX6A 4U39A 4ZN6A 2EJUA 4S1TA 3SY8A 3TIGA 1SCNE 3QOXA 5EJMA 3ANYB 2MT9A 1TTTA 1I3CA 4DMMA 1HG0A 4F9GA 2GFHA 2XTJA 4JI4B 5KIAA 4NECA 2ST1A 4AZWA 2RHCA 3PGJA 2ZSAA 3MOIA 2ZIWB 2X5NA 3HU3A 4MYTA 4LVUA 3HHEA 5D3MB 3R7WB 2OP0A 3ANTA 4XYMA 4EHHA 4RHYA 4J4BA 1MHTA 2YBDA 4L16A 4X41A 2POQX 3EGXA 2PKXA 3LT5A 5E4YA 1TW2A 2D3TA 2UZAA 4B31A 4E3WA 1JTFA 4HBGA 1KVRA 3FIUA 3PLRA 4Y0NA 3I9FA 4QUDA 3RK1A 4HXEB 3LVRE 3B51X 4UDXX 1SAYA 1TK9A 4P36A 2VZ0A 2XUZA 4JUBA 4UDOA 3NB0A 2QA5A 2QRQA 3FJYA 3K92A 1NNLA 1T5LA 1F6DA 3AM5A 1GPAA 2YN4A 3HM9A 2WTEA 3H8JA 5DDIP 1JR3D 2N1BA 4OFBA 1GZ3A 3IIEA 4M4SA 1SEPA 5GGXA 2ZUFA 4TKMA 4C76A 4RK6A 1KI4A 1NW6A 1P5RA 1UMBB 1VG1A 2VS1A 4PZLA 4BQSA 5IZ4A 2IGTA 5FR1A 3SYLA 5MGBA 1JFRA 3TFOA 1S0UA 4JB0A 1KKUA 5TGDA 4YPOA 2D2IA 3ETCA 3W3AH 3WSTA 2GZHA 3L1HA 4FINA 2DTXA 1E3SA 4UEJA 2V4MA 3QKSB 3UEOA 4EA9A 2HA4A 1T5SA 2OXRA 4FFVA 4TWJA 3F8TA 4ZT2A 1RPZA 1BU8A 1DQZA 1DRVA 3QKRA 3T15A 4A3SA 3THYA 1JSLA 1G3IA 4Q9KA 4PF1A 3MJCA 4LSGA 2JA1A 1XP8A 5LQAA 4ZCSA 2PO7A 5GPBA 3ICPA 4HWKA 5HCNA 4BUCA 4HGPA 2RD2A 5KAMA 1IBMB 5IJ9B 2AGVA 4MW6A 1NF8A 3NRJA 4KRFA 4GVLA 2Y05A 1V1MA 3B60A 3R76A 1MQ8B 2AA3A 4D3YA 1LPSA 3OQPA 1IRXA 2NXJA 3OZVA 1Y6FA 3U3DA 3AB7A 4NV0A 1E0AA 3KQPA 3H2JA 1WDLA 1EBBA 2CZCA 2PV7A 1CPYA 3KHUA 1PDVA 3UCEA 2AI1A 4TV9F 1J8QA 2G8NA 5MN5A 2JGFA 4FX5A 3RR2A 1F4LA 4NOKA 4HQRA 4TUYF 2XF8A 5DISB 3TSZA 3FX2A 4B3MB 2J7PA 4UREA 1VHLA 2R4TA 3E9RA 4JWTA 1YU6A 4MW5A 4UE6A 3B6IA 3H7AA 1KO4A 1YCHA 1LB1B 2L19A 3BDAA 3N2GA 4C6RA 4HDMB 4P7JA 4EI9A 2DY1A 4KXYA 1K6IA 3LZDA 3L7AA 5HRUA 5DNAA 1IHYA 3WNCA 1RCFA 1ULUA 3D8BA 1DAMA 3AUYA 1TZ2A 1TKAA 1ZNWA 1RWXA 3THOA 2RG1A 3D6AA 4YJKA 1THMA 1Y42X 2L0XA 3UNXA 4UOZA 3EQ6A 1NASA 1UFOA 5CVEA 1H0KA 1OV4A 3BRWA 1EK6A 2IEIA 3SZRA 3WK8A 2Q1YA 3JD3A 1JEYA 3TRJA 1EK1A 2WVGA 3GL9A 1CR2A 4PZUA 1VKRA 2YV1A 1X7HA 2JBHA 3QNUA 3AR3A 3CH5A 3RC2A 1G20B 2J07A 3T35A 1SUSA 2P40A 1OXTA 4KXNA 2Z3ZA 4P5EA 3WLQA 3QVMA 3SZMA 4NXMB 2AG1A 1LPNA 4PAMA 2SHKA 3DLTA 3O7MA 1U8EA 4K40A 3CU5A 3MJTA 5B3AA 3F5QA 2R6CA 4UUPA 1P2SA 1UAGA 1V8BA 3O7WA 4QUEA 5DYIA 4LOLA 4MWBA 4REOA 2IV3A 4XM2A 3QOYA 5E1OA 4YX9A 2VF8A 1G7RA 2VDQB 1FS4A 1XCJA 1SA0A 1X1EA 3LUDA 3KSZO 4H16A 1AOXA 5JXWA 4G0WA 1MPXA 4ZVRA 3JQFA 4HY3A 5KJEA 3EZFA 1ZCBA 1JG3A 1NSYA 4BVBA 4QTUB 3K8ZA 1V16A 3P0EA 4M1ZA 5GIPE 2OHOA 3ETLA 5DLYA 4ZRDA 3I53A 1QP0A 4PPGA 1AZWA 2JIZA 1EJBA 3U39A 4XR4A 3ZI7A 1Y6RA 1N25A 2EU8A 2GN9A 2DG2A 4YQYA 1VB3A 3ITDA 4O3FA 1JDBB 4MVJF 4EMUA 3ZG6A 1QJCA 3EEQA 2YIVX 3LSTA 2PJUA 4GPIB 4RPHA 2RB5A 3A28A 2G08A 4IHJA 4RK0A 3KV1A 3AUFA 4LWOA 4F4IA 4EL5A 5JY1A 1EGVB 3KOWA 5KMGA 4O2AB 1BWSA 4J0EA 1YQTA 4PSVA 2Q4TA 3FDZA 3QVTA 4DLTA 2ZR7A 3KEQA 4OHUA 2Y67A 2ZKLA 1EGAA 4EW3A 4QSHA 3SZGA 1KI7A 4UW9A 1LV8A 5TB5A 1D8AA 3FHTA 1CVRA 1ZD8A 4LISA 3TRKA 1C8BA 3EPKA 2J6IA 3A7EA 4G0OA 1W87A 1T2FA 3R41A 3ZTYA 5AW8A 2DRIA 4BYMA 3D2CA 3E7PA 4HGYA 1A97A 4YA6A 1P3JA 2WSMA 3I2GA 4BE4A 1ADCA 2B5VA 4F21A 1KVUA 2HV8A 4BDTA 3D3EA 4CQNA 4MJ7A 1QYVA 4X7BA 5HXAA 3AVQA 1RLIA 1JSCA 4K5QA 4MV8A 3QLTA 3NUGA 4HMQA 1LTQA 4JJFA 4MWTA 2SICE 4Y2XA 1FDVA 1M8FA 2ZWVA 3M6IA 3BC1A 4XVQA 4YRZA 4RX1A 2XZOA 4MX8A 2VK4A 1KK1A 2PRYA 4EY4A 1C8KA 2Z43A 2FFHA 3P5SA 1UBNA 3L8DA 3PEVA 2P4HX 4MOWA 4B4KA 3HKCB 5H02A 4M3NA 3TMKA 1XLTA 4PN3A 3TBHA 2NGRA 2IQIA 2VK8A 1NN1A 3JRWA 3K8QA 4KQ2A 4GMXA 4B1FA 2XB9A 4OFWA 2R8OA 2EFJA 3GJ4A 1A1VA 2CD9A 1Z36A 5F1YA 1T3LA 3TUJC 2O8NA 5JJBA 1MO5A 3VH4A 5C1OA 4BLOA 3C43A 4JVLA 3T9AA 1H94A 5D87A 3ZNQA 3LYAA 4LE2A 3V80A 2JJQA 4AKSA 5JH7F 1SXHA 3H1PA 4QYSA 4BWGA 1VCHA 3FROA 2IIBA 4C4RA 5H9WA 1DJQA 2JFFA 2YFQA 3HXPA 4GKBA 5EIAA 5IUNC 2EERA 3TECE 2CXOA 1NFRA 2ERCA 3KQSA 2ZEJA 3SX0A 3TGPA 4JJ6A 1O9GA 1T2CA 4BB0A 1Y80A 2B4QA 3GEDA 4ABYA 2EDAA 2C2YA 3B2NA 3VNVA 4URVR 1SPBS 3OCUA 2GYYA 2FHSA 2J08A 4MW4A 1PFQA 1ZRHA 3CVXA 2D54A 4H4CA 2C4WA 4QEDA 4Q9DA 5ALHA 4GSKA 4F84A 3JV7A 4B45A 3WK5A 1VJCA 2WHPB 4JU9A 4E03A 3PKIA 2QSUA 1F8UA 2GBFA 1D6MA 4GOOD 2RAFA 3QUBA 4S35A 4UZEA 1QNLA 1C81A 4QUKA 5C8ZA 1NE2A 4DCSA 5CFPA 5TLSA 4AKEA 2FOXA 4PR3A 2GF0A 1W47A 3LUKA 4G09A 3VZQA 5BW8A 4ZIRA 3QY9A 2ISQA 2P35A 4MPJA 1YIOA 5EQDA 4DJTA 2X58A 4IRXA 5KKNB 1Q21A 2OCXA 1MC4A 1XD9A 1VE9A 4FEGA 1X42A 4TV8F 3BSSA 1KI6B 2O2CA 1PX2A 3IDOA 4J0KA 3EX7C 2YWHA 3KAJA 4OAQA 4AQ7A 2EEZA 2HO5A 4LOHA 1UK9A 2IXAA 2RHOA 4G41A 3GGDA 3N8KA 4M1WA 2Q6IA 1G9XA 2EQBA 1XO1A 3HDYA 2QP4A 4R7ZA 3UCXA 4XFDA 1J49A 4LMRA 4RNDB 3I92A 4A10A 1XCOA 1OFHA 1X7WB 1ADFA 3ELUA 3GCZA 3Q2OA 1QONA 5IAGA 5A4DA 4Y7DA 1MABA 2WP0A 2PLAA 2VTBA 1DX4A 3KXLA 3K6SA 3A6DA 3T94A 2ABWA 3B8HA 3CVUA 2XXAB 3COZA 2O2HA 3GLGA 2P4UA 4QE3A 4XEHA 4NDNE 1U9IA 2WHQA 4P08A 1VJDA 2QZJA 1KDVA 1QCCA 5T4BA 4PLHA 1PAUA 3WDLA 2VQ3A 1DKPA 4R05A 3RGWS 3HEMA 5F3DA 4H7FA 1D5WA 5KTKA 1OTHA 4W99A 4ZZ1A 1WLSA 1JQJC 1X1RA 2C82A 5AMXA 5JZMA 4K0KB 3LQYA 1Q0PA 2HRQA 4PLYA 1NLZA 1ZICA 1Y3AA 1R4MB 1VKJA 2IJGX 3T7AA 2H08A 5B4UA 1DZIA 1IBLB 3OA0A 1JMKC 5FA8A 2ZJ1A 4NZOA 4MHSA 3G8YA 1HFKA 1MV8A 4P3NA 3QXCA 3BMCA 1SGWA 4XW2A 3N8GA 2NU7B 1Q1QA 3JQ8A 3KPWA 5LCXA 4DCUA 5IM4A 2FCRA 2P1ZA 3N8NA 1RXYA 1RWNA 2ZS9A 4ISBA 1TEHA 4TN1A 3DL4A 3Q6IA 3RFUA 4MDEA 2VT7A 2MSWA 2J59A 1O0BA 3IELA 5KYYB 2CNKA 1OBCA 3OLZA 1LVGA 2FP4A 3ODPA 2PVSA 3GRYA 4W5OA 1KORA 1Z07A 4LY0A 4K6FA 1SXJC 5K8IA 3KQMA 1UOEA 2G9RA 3ZVMA 1JIXA 1PSDA 2JFWA 3ETGA 4BJ1A 3UMSA 4G0UA 1UP7A 2VG8A 1AURA 2V7QD 3TTYA 2AE1A 4F38A 3QHAA 3KU4A 3MAAC 4WWHA 1ZI9A 4PFJA 1WOYA 3QKSA 2N75A 1RKXA 3WA7A 1P5ZB 1PG0A 2O23A 3IQEA 3SJ7A 3V9AA 5JCPA 4RLQA 3W5BA 4OLBA 4PNPA 1ZESA 3E2MA 3K6RA 4D96A 4DEXA 3ZWKA 4IG4A 2OHGA 2J9XB 3BEOA 1XD2A 3DKKA 2Q5EA 2G09A 4FXOA 3ECAA 1C0PA 1EHCA 5THXA 4AW9A 1XZ8A 4ALIA 4QJ3A 4RJTA 5HPYB 1JFTA 5BMVA 1L7OA 4RL6A 1GNQA 1FDIA 3BZWA 3B7PA 3JASA 1Z8HA 2PAAA 1WUIS 4JOCA 5B4VA 4PLPA 2VJCA 3Q3JB 4CIVA 4JKOA 3AOGA 5EMNA 5ENVA 3GT3A 3ZW9A 3KFXA 4O2RA 5G4KA 5BVHA 1W1UA 2GRJA 1J33A 3CV3A 3HPQA 4N3AA 2CF6A 4WHMA 1IZYA 2Q9BA 3CG4A 3EXHB 4UE2A 2VYFA 4HLUC 2QG4A 2GZRA 4PAOA 2B1IA 2ZI3A 3R4VA 4IZOA 5AHXA 2IEGA 4PVDA 2WUDA 4MWZA 5IFLA 3WGLA 4UMVA 3R3HA 2O52A 3JVIA 4Q34A 4RVDA 2EL9A 3WAJA 3T0GA 1OH8A 1JAIA 2BOVA 4HPJB 1ZCAA 2O2DA 3L01A 3A14A 4WH0A 1NR5A 1XEWY 2D1RA 4QGFA 4NP6A 3A6EA 2XAUA 2BBOA 2P0EA 5K0TA 3VZRA 3Q0TA 5H5JA 3C6YA 5EKDA 4Y2RA 3AUUA 4R31A 1E7SA 2ZZNA 1BHO1 4YP6A 3H2KA 1MENA 3N2IA 1HNXB 2X1HA 2GOYA 3W5JA 4C43A 3E3NA 2GPWA 4RY8A 4ARIA 1J0EA 2ODWA 4UHDA 1M2OA 3PQEA 4BNYA 1XAJA 1O5OA 4FQ8A 1Z0ZA 4IDHA 1KEPA 1YZYA 1A9SA 1WW3A 4ZWNA 4JI3B 5FLYA 3TR6A 1U2PA 5K6AA 5LWHA 3IT0A 3SG0A 2D5IA 5G4LA 3X1YA 4BKPA 5L45A 4HRVA 5T8KA 3TK1A 5L95A 1XL1A 3E48A 1JDBC 1F38A 2BVNA 1PLLA 2DQYA 1JIVA 4GWKA 1W93A 3DDZX 4X6XA 3UV7A 5ED4A 1EE2A 1C1YA 1PWYE 3DXFA 2EF1A 3CXRA 3ANSA 3Q7TA 2WEKA 1QVRA 4R9SA 1E3QA 5EP1A 5JSYA 3SQXA 1OKKD 1AS2A 2QB5A 1MB4A 1OA1A 1FRZA 3FZQA 1XWFA 3PIRA 3SKVA 2XXAA 1LJLA 4IQFA 5DOZA 1GAXA 3VTKA 3DKRA 2ATCA 1PR0A 4KYUA 2R6GA 4XJSA 3QA3E 3T99A 2W90A 4BP1A 4Z0HO 2BCGY 1QKJA 1SIUA 3E22A 4RPKA 2MSNA 3G9TA 3S7TA 2KYRA 3TKLA 3ZQ4A 2JDID 2PXHA 3HXMA 3CVYA 1Z12A 1YFLA 2A92A 1X8XA 3I5AA 3A4VA 2CEKA 2IKQA 1M2GA 2X7JA 3HK2A 4NCAA 3NPMA 1GXSA 3OLVA 3PWSA 4V24A 2W43A 5CT9A 4DXAA 4Y1RB 2MMCA 1XRPA 3UQYS 3WB1A 3TSOA 4IJ5A 5LD2B 5AVZA 3TD2A 3VJKA 4H77A 3Q7RA 1A9QA 1FFWA 1YA6A 4GL2A 2O5VA 3QFFA 1SXGA 5J4VA 3IUNA 1Z56C 2BGJA 4RKRA 4B8ZA 2KQUA 4D5EA 4GC9A 2G1KA 4WAUA 2HFJA 2BZGA 5J2TF 2PRJA 2Y0PA 3ZHXA 1KP2A 5IWCA 2W70A 4NEQA 1NLYA 4G4SP 2ONYA 2ZJOA 4YRBA 1V1RB 3SOZA 3L4JA 4MA5A 1Z34A 4YJ2A 1R0SA 4AQDA 3LLUA 4ARZB 4RTSA 2WYUA 4IIVA 3AIOA 4QDOA 1CNEA 2QN3A 2SKCA 1RAIA 1T3TA 1V1RA 3HYNA 4PQGA 5J43A 3TSAA 4NBSA 1E79A 4FE4A 3PFWO 2QYTA 3AEKB 5B1SA 2IU0A 4DLBA 3TXXA 4A5OA 3LU1A 4C0JA 4KZKA 4KPUA 3VBCA 5A02A 1W94A 1DJLA 4L95C 3U4MA 4BZQA 5DRTA 1FEZA 2PKCA 4LMAA 3IX7A 3T1VA 5B64A 4XB6B 3F1LA 4QUAA 2CHEA 1ULBA 1TNDA 5HUJA 2GBPA 4MRMB 3WNZA 1KSJA 2CBZA 1Z6QA 3O4HA 4F04A 4CIWA 1ZH2A 3W5UA 1HGXA 4KI7A 3VYVA 2J3DA 4BFVA 3A1FA 4WK0B 5IVKA 3DXZA 3K0AB 3HFRA 2EJBA 2J85A 4LMBA 1Q1AA 4FLEA 5L7YA 1YKSA 1HEIA 2ZI4A 4W9NC 3EJWA 3RI3A 1MXHA 2BI4A 4BBPA 1NVFA 2BEUB 2VBIA 4KHZA 3AF3A 3RTEA 4IW3B 5ILQA 2WU4A 5COBA 5D5HA 2RKOA 4ARCA 1V5IA 4BNJA 1VBFA 4GLOA 4IOJA 3V8RA 3FCAA 4XIYA 3ED5A 2A88A 1PS9A 3UO8B 2P5UA 2REQA 4XDGA 1OFUX 1UBGA 3NKFA 4NNPA 3NVAA 4KR0A 3AY7A 4EPTA 4YLGA 1UBJS 2W37A 3G1WA 3Q8WA 2XCSB 4X94A 4LJ5A 3HY6A 4G0VA 4HC4A 4BKMA 2ZE6A 1CYEA 2PBRA 3BHJA 1SUIA 4W5WA 2R68A 4NATA 2FWJA 2D1SA 2H4WA 1GR1A 3IUSA 3WGHA 1FMTA 2PUDA 3AJDA 2HX1A 1DT5A 4ALJA 3L4BA 1UKBA 1Z74A 2CDRA 2X8BA 1QXSA 4KDCA 1U3GA 5DRYA 1DBSA 1GUBA 3G2HA 1WKBA 4WNAA 3O6VA 2VKQA 4KXXA 2UZ3A 3DQQA 2H5IA 3W7