1ZR2A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCAGTGTCCGATAATTTAT
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination/dna
total genus 46
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr2A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr2A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr2A01
3LSJA 3JRGA 1WCMJ 3QPSA 2HQ5A 5C31A 3S1QJ 2DMQA 1CQTA 2K9NA 3LOCA 3UKGA 1Y1WJ 3LNQA 5F08A 1ETYA 2X9DA 2FX0A 5C3EJ 2HOSA 2VUMJ 4LOCA 2JA5J 5EDNA 1QRYA 1IUFA 2DA6A 2YS9A 2KT0A 2XGDA 2E19A 5K7ZA 3GTLJ 1IRZA 4C2MJ 5C35A 4B3AA 3HBLA 3NARA 2LFBA 3Q0WA 2HOAA 3LSGA 1JT0A 1ETWA 2WAQN 1RKWA 1Z0XA 2YUSA 2EZLA 3H3VK 3HOVJ 3HOZJ 1TC3C 3BG9A 1FJLA 3TW7A 2ECBA 4X1EA 3K2AA 1FTZA 3BVPA 2Y9ZA 4M3BA 2EZKA 5IYCJ 2AO9A 2E2IJ 2JK3A 2L7FP 2GBYA 3C2BA 1QPIA 1FEXA 4XK4A 2DA4A 9ANTA 2D5VA 2CRGA 4I6ZA 2Y9YA 2JA7J 2GLOA 2LLKA 3H0GJ 1W0UA 1WGXA 2YU9J 4J19A 1LFUP 1GVDA 2JA8J 1X58A 1RPWA 5EG0A 3BTCA 2GM5A 1APLC 4IHVA 2LR8A 2EZHA 3JR9A 2MGQA 1VI0A 1HLVA 5EF6A 5F0FA 1JKPC 2ME6A 4D5FA 2PMZN 3BR2A 5EZGA 3OSFA 3JRAA 4A3DJ 4D7MA 4A3IJ 2B63J 4BKXA 2DJNA 3BT9A 4MO7A 3A01A 2OF7A 1VNDA 1JKOC 2Y31A 3ZQHA 3S2DJ 2DA7A 3BTJA 1BA5A 5GPCA 4MIMA 2P81A 1BW5A 3PKZA 5EZHA 2RSLA 2K9QA 1IV6A 2VPRA 5IP6A 3SJMA 3JRBA 1BL0A 5F1JA 1GV5A 2EZIA 2XGCA 2VI6A 3RQIA 4BQQA 4BY7J 2HOTA 1UMQA 2LY9A 3BQYA 4S0HB 3TEDA 5FKOA 1B8IB 2TRTA 2VKEA 2DTZA 2E2HJ 3TP0A 4MFEA 1F36A 1U9NA 3B6AA 3NAUA 4MFDA 3ZQFA 1ZR4A 2LTPA 3G1LA 1U78A 3OSGA 1A5JA 4XIDA 4V2GA 4IHWA 1GUUA 5E3LA 2RAEA 2HDDA 1TWHJ 5IYBJ 3BR5A 5FKMA 3OOUA 3D1NI 4UUSA 2M0CA 4A3GJ 3JRCA 3SFIA 2QCOA 1XC5A 3MVPA 1MBJA 3MN2A 5EG0B 3WHCA 5M5WJ 5K7HA 4M3EA 1T56A 1FTTA 3UJ3X 1U9OA 3SDGA 1QVTA 2K40A 2ZB9A 4BY1J 1ZGWA 2XGEA 3IH2A 3OIOA 4BXXJ 1IDYA 4XRSA 4M3FA 4DZJA 2R5YA 5EYRA 2MW8A 1ZTRA 3ZQCA 4A3MJ 4XRSG 1XG1A 1YRNB 5J1YA 1MSFC 1JTXA 2DN0A 2TCTA 1MBHA 1ZK8A 3HGYA 4DW6A 4Y52J 5C4JJ 2XSDC 2IEKA 1B72B 5IOYA 4FTHA 4FCYA 2COBA 5DTDA 1RESA 2WV1A 2R5ZB 5E3NA 3IV5A 1ETVA 3ZQGA 5E3MA 3G13A 5C34B 2L7MP 2EQRA 2H8RA 2DA2A 2JWTA 4G12A 1JTYA 2LD5A 4C3IJ 4FE4A 1YRNA 3FKIJ 1QVUA 3HM5A 4M3DA 2O8KA 4AYBN 2XPWA 2L9RA 2MSYA 4JX4A 4B1RA 2HI3A 4D5CA 2XB0X 1X2MA 3HOWJ 1JUSA 5IP9J 2OPTA 2WB1N 1AU7A 1LE8A 2O7OA 3HEFA 4A3KJ 3BR3A 5EGOB 1JKRC 2FD5A 1ZQ3P 5M3FJ 4JP0A 3ZQLA 1JJ8C 1B72A 4EEFG 1IJWC 1ZKGA 2FQ4A 2XRLA 3QPLA 4W1UA 5J1RA 2CUFA 1HF0A 3ILXA 1VF9A 1FIAA 3Q0VA 1EF4A 1BW6A 4C3HJ 2ME0A 3A01B 1AKHA 3S15J 4HNVA 4CYCB 5FJ8J 1I50J 1LE8B 4BBRJ 1SANA 1JT6A 2IBDA 5F27A 1GDTA 1ETXA 5IOZA 4A3FJ 1ZR2A 1TWAJ 3BTIA 1GV2A 2DA1A 4W97A 1RKTA 2LK2A 4X6AJ 1NK3P 5K7FA 3Q0UA 2R5YB 3JRFA 3JRDA 3S14J 5GPAA 1P7IA 4QIWN 1HDDC 2X48A 2H1KA 2M9HA 3GTMJ 1GHTA 2DMUA 2EBIA 3S2HJ 1K61A 4M3GA 3CCYA 1FIPA 3M4OJ 1I6HJ 1TWFJ 1OCTC 4XRMA 4BBSJ 1E3OC 1LFBA 2GM4A 4A3CJ 4M6VA 1Z77A 3BR1A 2ECCA 1MSEC 4DYQA 1GT0C 1JUMA 3HKZN 1OCPA 2CQXA 3HDDA 3PM1A 3I4MJ 2M2EA 4UUTA 1JGGA 3FIWA 1TWCJ 3E7LA 4V2FA 3GBGA 2NVXJ 1TWGJ 3I4NJ 3WHBA 1DU0A 1PUFA 3M3YJ 5F0HA 1O4XA 5E3OA 2CJJA 3GTJJ 5C44J 2NVTJ 3GTQJ 3LSRA 2MG4A 3TP3A 4B4CA 2LKXA 3RKQA 2ID6A 3FK6A 4A69C 1Q1VA 4DYRA 2L7ZA 1A6IA 3GTOJ 5FKLA 1SFOJ 5F0CA 5C4XJ 2R0QC 2R92J 4AC0A 2KDZA 2JN6A 1S7EA 5JLXA 2E2JJ 1WH7A 4NDLA 3RZOJ 4IHXA 3BTLA 3VPRA 2G0EA 4A3LJ 2XPUA 4CYCA 1PUFB 1UHSA 1MBFA 2R93J 1R9TJ 3IH4A 4JYKA 4JX5A 5FKNA 3CDLA 4IHYA 1T33A 3BG3A 3ZOBA 2DA5A 3QQAA 5M3MJ 1MH3A 2DMPA 1BJZA 3K7AJ 3BR0A 4Y7NJ 3JREA 3A03A 1IGNA 5FKKA 1IG7A 1MNMC 3GTPJ 3RZDJ 3HB9A 1X2NA 5EGOA 2Y0SN 3HOXJ 2VKVA 1ORKA 2Y30A 3CMYA 3ZQIA 3GTKJ 2DA3A 1ETKA 4L5EA 2X6OA 3L1PA 2W48A 4QTRA 5HODA 4A93J 1ETQA 1I3QJ 1RR7A 3DCFA 3JRIA 5IYDJ 4A3BJ 1ETOA 1XS9A 3W6VA 1JUPA 2K9SA 2O9LA 4AUXA 2CQQA 3FISA 3Q3SA 1JJ6C 3S1RJ 4RDUA 3PO3J 1G2HA 3GTGJ 3HOYJ 5FLVA 4XICA 2EH3A 2R5ZA 1OJLA 1HX7A 3A02A 3DEWA 2JJ7A 5M5YJ 2QF7A 1IC8A 1ITYA 1HDPA 1AHDP 3G1MA 1AKHB 4FISA 5FLMJ 2R7ZJ 3PO2J 2CU7A 1F43A 4UUSB 2I10A 1ENHA 1MH4A 2HXIA 5IPAA 4A3JJ 2FJ1A 2HYJA 3S17J 3B6CA 5JLWA 1D5YA 4I76A 2IAIA 3S1NJ 1DU6A 2XPVA 2DMTA 2M34A 5BNGA 3BQZA 3CQZJ 4IEJA 2N8GA 4DZPA 2L0KA 5J1UA 4MLOA 5F04A 5IP7J 1W0TA 1H88C 1WI3A 3LSPA 1HCRA 2NS7A 1JKQC 4C3JJ 3MKLA 4D7NA 1U8BA 1POGA 1OFCX 4ABZA 2E1OA 3O8HA 4A3EJ 2NVQJ 3TW6A 1H8AC 3BR6A 3HOUJ 4RBOA 1WPKA 5EEAA 5M5XJ 2Y2ZA 3LHFA 1MBGA 1P7JA 2AHQA 3HGGA 1Y1VJ 2CUEA 1UG2A 1IDZA 2XB5A 1B8IA 2NS8A 3GUVA 1MBEA 3G1OA 4DYCA 3JRHA 2NOGA 1HOMA 1MBKA 3S1MJ 2ID3A 3S16J 3F0CA 3LHKA 2JA6J 2LVSA 1K83J 1RETA 2M8GX 2ELKA 2JMWA 4JX6A 5C32A 5GP9A 1WH5A 3IH3A 3FK7A 5DS9A 1NK2P 2MHCA 4FE7A 5J3LA 3O8GA 4GFBA 3BG5A 4QSHA 2LP0A 1VFCA 2DMNA 1NTCA 2NVYJ 1H89C 2HXOA
chains in the Genus database with same CATH superfamily
1OKKD 1FJGB 4II2A 4M6YA 3ILVA 1NPDA 2XY4A 4HD8A 1XNQB 3WLTA 4HF2A 2DFDA 1J1DC 2C98A 5BSHA 3M8JA 2BR3A 1WHSA 2C0CA 3C14C 4DYVA 3PWSA 3IMGA 4E3WA 1TC3C 4UARA 1R4NB 5YASA 1SQPG 1E6WA 2X8WA 2E1PA 3FHTA 5IYCJ 4ZTBA 3CCQI 1ODDA 2JAWA 4ME6A 5JJKA 1WGXA 2YU9J 4QREA 2MR5A 4KUGA 5HUQA 1TNDA 2GM5A 2W4IA 3KD2A 4Z4EA 4ZHSA 4FDAA 2IS1A 1SUSA 4XM1A 1FPQA 1ZVMA 5AW5A 3SQLA 5IKXA 4D7MA 4R4LA 4DXDA 4Z3KA 5FBWB 3VYTB 4XLPF 2NO5A 1PL5A 3LVQE 4D6TE 2H9YA 1AV6A 4B2IA 3CR8A 4RL6A 2IUTA 4BFSA 1C2YA 4EG7A 4HWKA 3L93A 1YF3A 3CQ9A 4PC3A 1C50A 1D03A 1HE5A 3ZE7A 1FOWA 1ZP6A 4I98B 4RTMA 4W9MC 3IAOA 4ZOEA 3GGGA 1YK0A 2J5QA 4PGGA 3ECAA 4MDHA 4OSPA 5EJIA 1QYWA 4D97A 1E3HA 3SBDA 1KHTA 4M3FA 1QV7A 1PYGA 3H3JA 2QSGX 3ZQCA 2JZYA 2FVYA 1ESCA 3FNGA 4R0NA 3TLAA 4EO7A 1N2XA 2O8BB 2D2EA 4RADA 1PP9D 3LWDA 1NTZG 1VHWA 1OPXA 2FYTA 3VP8A 4ETSA 3EPLA 3UHOA 3AE9C 1P0PA 5T4BA 2FSFA 3S6JA 3DQQA 1GGEA 3I73A 5MGBA 5M5BA 3LT1A 4QDUA 3OS2A 1UXJA 4L0QA 1Z16A 3GUZA 5AKLA 4Q7JB 3ZLUA 1CUJA 4FMPA 2YIVX 5C8YF 5IUNC 2BFDA 1WCIB 4X9XA 2O4UX 5BVGA 1NHWA 5EXDA 4GVXA 1JIJA 4ZCPA 3TCKA 3RSQA 1NY6A 4KR9A 3CPEA 2STWA 2FEKA 4JP5A 3G6EP 4US2R 2Q4TA 1M1XB 1QYDA 2WADA 4E5PA 4DLKA 3AY6A 3N97A 1WKVA 1P7IA 3D8BA 4JEMA 3VUFA 3ZN2A 2R68A 3S2HJ 1Z06A 4KIJA 2KZJA 4FMDF 2ZFUA 3CCYA 3O95A 1UAYA 5SY4A 1I39A 3IFSA 3SZ3A 4RM3A 1G3RA 4CKWB 1F38A 2ZI3A 3B6KA 3CCVP 4G81A 4BQIA 2ZJSE 2ORIA 1YJ5A 1SWVA 3QI2A 2OFXA 3NTXA 3LCUA 3HUDA 2IX3A 1X79B 3SXUB 3RDPA 2ZM5A 2NVBA 3O3OB 4FDUA 1SKUA 1VQOI 1TU4A 4EFKA 4D9HA 5C44J 3BJ6A 4X8MA 3WUUA 5JBNA 4BO3A 2HU2A 2M6KA 4P08A 1ABFA 2JD1A 1HI9A 1H65A 1L7QA 3ABLH 1KZUB 3BA1A 5JSYA 2PQ2A 1EINA 4P9NA 2DCUA 3D6TB 4R79A 4OHXA 2WOJA 2QD2A 1FFWA 4IFMA 2XYQA 3GP8A 1FLIA 4UXNA 2I4OA 1QSGA 1KYOE 3TZ6A 3QVJA 3GTKJ 2OXFA 3L6DA 5JNWA 2G77B 1X8YA 5EL0A 1D9XA 3OIYA 5CCBA 4R4JA 3OQMA 1AB6A 3AE4C 4X7PA 3CZRA 3KT3A 4D9GA 3WJAA 3AEEC 1JU3A 3MCVA 1AMNA 1Y7HA 4MRAA 2NSHA 2PX5A 2PCJA 2FSVA 4XR4A 4NOJA 2E75C 4TL6A 1BOFA 2ZEJA 2M34A 1E9BA 1UXIA 1M1JB 1SQXD 4E5KA 2YZNA 2Q07A 4LLHA 3L7CA 4BQFA 4CIDA 1E18A 4HH0A 1RXIA 4XRRA 3UOAB 5JSKA 4ZVKA 2JRTA 3L0SA 3T5GA 1FVHA 4BB6A 5B6IA 3W6KB 4OK3A 1YJNI 3EGCA 2Q6QA 3MMNA 1XA4A 4N3AA 2YTZA 2WAXA 1W85A 5LPNA 4RPJA 5FD6A 1L8AA 2FGKA 4JBAA 4DSUA 3DBHB 2REQB 5SY6A 2RNGA 2FEMA 2YN2A 5ALYA 2VBGA 2Q0SA 4YXFA 3GV0A 3HMQA 4LJ4A 4HNHA 2O3JA 4ETMA 3EISA 4BBJA 1ETYA 3CXUA 1JKIA 2W83C 4OHVA 1USVA 1RKWA 1PTJA 5AK4A 4RLFA 3AIIA 4CO8A 1I9CA 4D9NA 1BE6A 2QSZA 2CSXA 2GX6A 3H8JA 4OHUA 2BHYA 3IULA 2KLOA 2OBLA 2HNHA 3M1EA 2YYZA 1E89A 5HQJA 4B43A 2LLKA 2MTBA 4REQA 3K8OE 4ZA2A 4DHWA 1GXPA 1NQUA 4IIXA 4DQKA 1X38A 5ALUA 3K2BA 5IKOA 2HZTA 2QQFA 1IWPB 2XWBF 1B0UA 1DPUA 4DDKA 2YXRB 2Y27A 1YFJA 4MYUA 1JFFA 5TJJA 1JYEA 3PTLA 2HS5A 4CV3A 2A0YA 4YV7A 2K37A 4HNRA 4F4UA 5TNXA 3HDYA 1FSEA 3BIOA 3CRRA 2NNWB 1N5MA 3I9LA 1JBKA 1KBOA 5CCEA 1GG8A 3W79A 1JEAA 2EKDA 2XNDH 2OV8A 2VA9A 3KHTA 3U7RA 3Q0TA 5E17F 3R8XA 3JSAA 2QUKA 3NMUF 1A8HA 4LDRA 1LBEA 3ZV4A 1APBA 1ORRA 5B7PA 4RGUA 1FLDA 3WDKA 2AFRA 4XGQA 2R7RA 2RGYA 5FDFA 4OU0A 3ML6A 2P0EA 3JD4A 1LEBA 2VAPA 2Q5OA 1B6TA 4DV3B 1KILD 3S2IA 6PAXA 3GEGA 2IW5A 1IFPA 4FHDA 4YYEA 2I7XA 1DDNA 2EKLA 4NC6A 2H31A 4OB8A 4JJ4A 2G9QA 1E58A 5ERYA 2OPTA 5K05A 3VDMA 1F4PA 2OECA 5KZMB 3DT9A 5EJEA 2CT8A 1U2EA 3H86A 4UATA 2XRYA 1AKQA 4CZCA 1H0TB 4MP8A 3GF7A 3BRWA 1TPZA 5IHXA 1T1RA 3REOA 2I1LA 4G4IA 1YD7A 3WGNA 4JV5B 3OE7D 3QVUA 1KIAA 1B8NA 1Q74A 5LCXA 3W7AA 1Z6TA 2VP9A 2G80A 1GXSA 2VPXA 1GHTA 1KI4A 4Y7CA 2DAOA 2AEFA 3RRJA 2G6TA 4JOMA 3JVEA 4OQLA 3W1EA 5A2QZ 3H1JJ 2J3QA 1IYZA 1QTQA 3FMFA 5AKYA 4LZWA 4LJSA 2OFFA 1VJDA 2IV3A 3ZMVA 5CBOA 1S3JA 1CEXA 4ZXFA 2B8WA 5LVAA 5GY7A 3ZK9A 2MT9A 3ROTA 1SU8A 2IBZI 5F0HA 2E4ZA 3BH0A 3RK4A 4YP7A 4BNZA 1KR2A 3RFXA 1Z7UA 1I1QB 3OLWA 1IRFA 2AI3A 1Z8DA 1HQDA 2XPUA 4RKUJ 2DTXA 4QD3A 5LWQA 1YJNP 1VDMA 4L0CA 1QHHA 3HVRA 2YQ4A 4FMBB 4IZ6A 3JAWB 2DLNA 2X8BA 3W5UA 3ETJA 3H0EA 4Q6BA 2E75B 1Z0UA 2AXPA 1Y6GA 4LI3X 3E58A 4CG3A 1TTYA 5HZKA 3G73A 3G8YA 3PC8A 4I1SA 3G2QA 3BAFA 2QRUA 3VA7A 2OC9A 3ZD8A 3GARA 3E18A 4MDYA 2IOFA 4Z8XA 4Y1RB 1ENHA 2PGIA 1YIOA 1PDOA 5JLWA 4PFJA 1V45E 1UCFA 4EYYQ 5GOZA 2I8LA 4QL3A 2ZZKA 2CB9A 2WSSH 3VZCA 3CZ6A 1O08A 2KS6A 2I99A 3D6ZA 4KPFC 1BSVA 1E1YA 4KODA 1W25A 4AICA 4NDZA 1GT91 3ZZMA 3O8OA 3U9SA 1TVCA 1HWTC 2VL7A 2NWQA 5JVGF 2ISSD 2WWTA 3U0BA 1L0LG 2XGMA 1WZNA 1JEJA 3KZOA 3SQNA 2HMWA 4CT0A 2R84A 1VQ5P 1SXGA 2FRHA 3DLBA 3MJDA 4PVDA 5CA0B 4KLRA 3KKZA 5J4KA 2G0AA 1GV1A 1M34B 1PGJA 4OU5A 5CK5A 2DTEA 1R7JA 3EIFA 4LHEA 2XTAA 4MIKA 5JI3E 4RV4A 3TZCA 3JQDA 2GUWA 1EAYA 4TWBA 1DRUA 5FI3A 1M8OB 2ODTX 1N32B 1F8YA 1CF7A 2MINB 3H3VK 1W29A 3H5AA 3CR3C 4GBJA 1P2BA 1RHUA 4UB6C 3BCSA 4JPZB 3HVHA 4ZPJA 3MWFA 3TQSA 4L8FA 5DYGA 4PXSA 1D2GA 5AHKA 1CQZA 4PLHA 4BATA 1T8IA 1LC0A 4BNFA 4BEBA 1V55H 4EGZA 4X93A 4F9EA 1NYLA 5B4VA 3UGQA 1VQNI 1G3UA 4A3DJ 2UZ0A 4EI8A 2DJNA 5HXAA 3U37A 3TRFA 4G37A 3E3LA 4DIFA 1SD1A 2VZ0A 4HB4A 1GKYA 4CRWB 2BEJA 1ZLJA 4CV0A 3VNVA 4MSUA 3WGHA 3IILA 2ZT8A 4G85A 4AXBA 3DDWA 4JJ6A 4BZWA 2BR5A 5A0VA 4EG3A 3TXAA 3TO5A 5LC1A 13PKA 5BUSA 1UZCA 4BACA 2F4OB 1XA3A 1TO1E 1N5KA 5BUZA 2PR7A 5TLSA 2WAQA 1PNVA 4DBLE 1M8PA 2FFRA 2WE8A 1KHHA 2B25A 3QODA 4OGGA 2UUOA 3X0DA 1XG1A 1PYOA 1J2JA 2C7VA 3L9WA 2H1LA 4IJQA 4L8WB 3WLRA 2CXXA 2HAEA 3KWMA 4RZXA 3U1BA 3CLUC 3LBHA 1N0HA 1OVRA 1HEIA 1BVYF 4G63A 2P5LC 1RZVA 4MWGA 2HVRA 8MHTA 3FKIJ 4YASA 3FWHA 4DSTA 3HOWJ 3K6GA 3MRXA 2MR6A 4O6VA 3PC2A 5G1NA 1W6UA 3DE2X 4YHBA 4XKCA 5EGOB 1P7VA 3HR8A 4LWZA 1CUWA 1X1SA 2E34A 3JQRA 2BV6A 4P55A 1ABBA 2XZPA 3QU7A 4W97A 4QDXA 1FC0A 2ZJ8A 5KI6A 3RWMB 4HJRA 1W0JA 3MUOA 3FBWA 3EZ7A 2HIGA 3BR1A 4UUMA 5BPIA 1S96A 3GYBA 2I55A 3HDDA 5BXYA 3MMXA 3NDRA 4RMHA 1S7OA 3OYGA 4EITA 2AR7A 2WNSA 4TXNA 3TP3A 5IMSA 3DDOA 5FOVA 3LLSA 4J0EA 3HSRA 4BJ6C 5JEDA 5JH7F 1BR1A 1PUIA 3LC0A 3PZRA 4WBNF 3RSZA 3W1WA 1BR2A 4F7ZA 1L5SA 5FLXK 1TMYA 1T0FA 2GVZC 4HH4A 4N3CA 3L2WA 1DKNA 1D6SA 1ORHA 3TL3A 4BXLA 2C95A 2FFJA 4QPQA 4Q18A 2ZVPX 3RASA 3IGFA 1QP7A 1W2EA 2O48X 3V1YA 4HEQA 1SQPD 1Q1EA 4GEGA 5JMTA 2PGAA 3L7WA 4EJSC 4I0AA 4UBIA 2EKZA 5EGNA 4PQEA 5MF6A 2DQLA 2VUSA 2XZLA 2ZUFA 5LLDA 4UHTA 4L27A 3VYSB 4ASWA 3EVBA 1RY3A 1NI5A 1LDDA 1ITYA 3N5CA 1CR6A 5GTHH 1UZUA 3I6ZA 1HR0B 1CFJA 3UCEA 4ND1A 2RHHA 1L6IA 4S35A 4HDOB 1DPGA 4ZT6A 4O1IA 1R8JA 3IAM2 4OH7A 4DDWA 4LA4A 5CFNA 2WB1A 2XC7A 4P3PA 4KXQA 2J3IA 5F9MA 1AK1A 1ZAYA 1SP4A 4I3HA 3UM9A 3ZVRA 3HMKA 5ERGB 3P2KA 3Q3JB 4LIUA 3RYHB 3O9MA 1WPGA 1HT3A 1QPGA 4L9NA 2Z9OA 4BVJA 5DN6D 2A69F 1MBKA 5JPDA 4X6YA 3HK2A 2XJ4A 5BVHB 1NK2P 1H89C 1QV6A 3MWEA 4MJ3A 2QQ9A 5DUIA 1U6JA 3CLSD 2X6XA 4CMIB 4P4LA 3DNFA 2HSJA 4ESHA 1LX7A 4Y1RA 3A6ZA 4YUVA 2FX0A 3ADOA 4BE1A 3QEJA 1MD0A 2XGDA 2QGZA 4TZ6A 3UW1A 4P8RA 3D3KA 2OGZA 3GLFE 3KKQA 2Y0SA 2PKYX 3KXPA 5KU7A 4LYHA 4KI0A 2ERXA 2PVCA 2WSSD 2ECBA 1E6LA 2ZYTX 4FZRA 2VP3A 4ZYWA 2V6FA 4KQHA 1E94E 2EWWA 5TT0A 3CB2A 1FIUA 3AP3A 1R1DA 4YDRA 1HRDA 5G3YA 5FXMA 4UQPA 3BGVA 3IIIA 5EUBA 1JQJC 1KE1A 4X1YA 3WK7A 2VONA 2JGRA 3CUTA 3L75G 5EZGA 1XF9A 4HX9A 1Y39A 3RAEC 3F5HA 1IUPA 2X0NA 3MYYA 3GJQA 1FZCB 3IRQA 3BXHA 2CBGA 5DHQA 3IP8A 3ZDCA 3UAZA 1TJ3A 1DWOA 1GPNA 3DTVB 3O75A 1SFKA 4JP1A 4CUJA 3L8CA 3TP0A 1Y4UA 5AVVA 1YQUA 4NONA 1A3CA 4MYSA 3IUEA 4DIMA 4CE6A 3BC8A 4WT7A 7REQB 2WJ6A 3U4MA 5IN5A 5BOXA 3CC8A 4DLAA 2K5UA 4OX9B 1WY7A 2WTAA 1VG1A 3DOFA 1U0HC 2LSOA 5FOQA 1AU9A 3R3SA 3MGGA 4JYPA 5DYNA 3DHWC 3OX1A 3C8VA 2BR4A 1EWTA 4PN7A 5B7NA 5IC5A 1T8TA 1WDTA 3MERA 4UNNA 4EB6A 5IH3A 1RUOA 2XDVA 4WY4B 1GU4A 4BUCA 4B7XA 5A62A 3OOEA 5AXCA 2EJVA 3SN6A 2F67A 1S2IA 3R60A 1KRHA 3LK7A 3P9XA 1VSVA 4PYJA 5KX5F 3L4KA 3EJ6A 4WGGA 1D2CA 1DIRA 2WNHA 1CB0A 1C4WA 1ECBA 4I50F 1BD3A 1GLGA 3ABVC 2ASEA 5ES4B 3O4FA 3L71G 1OFIA 3PP8A 3OE1A 5H0IA 4M22A 2C20A 4R2IA 1OYVA 1S2LA 3CNEA 4QTYA 2KHZA 1MFTA 3PRYA 4OGKA 3L35A 2QJKC 1DQYA 4AP6A 3GA0A 1SQGA 5B3AA 3TW8A 1LLQA 3QPHA 3UK2A 3JATA 5IOZA 5BV1A 3BD8A 4Q1EA 3ZBPA 2EJBA 1GYQA 3QMWA 2OESA 2Q2WA 2A6PA 3CO5A 2RGCA 1ISIA 3BZCA 4M7WA 4Q7QA 1SC9A 3M07A 3O4GA 3ME5A 1Z12A 3SBOA 1JUMA 4WVLA 3ETNA 2ECOA 1DU4A 1RPZA 1WXWA 3T7SA 3HXQA 1GPAA 3I9V1 5KWJA 3M3YJ 3TSIA 5EP1A 5IZCC 4B6PA 4D4HA 2P9CA 1ZRFA 3E2MA 4Q4JA 4D0RA 3TLMA 4CIXA 4AECA 2Y6VA 1KA8A 1AXGA 1PP9E 3T9FA 1DKRA 2WK1A 1KMHB 4R9UC 3WRWA 1UIRA 3OP1A 4DCCA 3EAGA 4ED9A 3CUQB 2OG1A 3BZUA 3WGIA 3HVKA 2QPTA 3W8EA 4YDHB 1GPDG 3B1FA 1SQPE 4PWYA 5AUPB 1V43A 1W5AA 1XLTA 2RE8A 4XGNA 2NV2B 1E9AA 1T5BA 2P0AA 2V3WA 3PUJA 1OVUA 3EQ2A 3RUAA 4D02A 1XX5A 1JVBA 4C7XA 5HGXA 2W82A 2Q7OE 1JFRA 5J23A 1K7EB 3HXOA 2D00A 2SBTA 3ZR4B 4QJ4A 1PI3A 2R7ZJ 3W6ZA 4QARA 1QO0A 4TZTA 2HPHA 2ZWIA 5GTIC 3OCXA 5DYYA 2NU9A 3CISA 1EE9A 4YELA 1GU1A 5KBYA 5L3VA 4AVZA 2Y76A 3D31A 4E5NA 1M1YA 2GM3A 2MWMA 3K1MA 2Y9MB 1BJTA 1V8DA 1B2LA 1DBQA 3M4YA 4UB6E 4JLJA 4P9FA 3FSGD 2NVQJ 1VCHA 1OUMA 5SZHB 2G70A 3DQPA 2HZDA 3OA7A 2V7XA 4IGFA 4RORA 1U2WA 1U8FO 2P6SA 2A6HF 3MTEA 3I2GA 3KJNA 1FVXA 5BSVA 3B8HA 3Q8MA 1KYVA 5CPBA 3FK7A 4KBGA 1UJBA 3TOXA 2BVNA 2EERA 2O2HA 4CEHA 3EEQA 3FVTA 5F2EA 1AD2A 1V96A 2K9NA 3BIWA 2KQRA 4JENA 4OFWA 3RJMA 2D74A 1Z4JA 1LI5A 4B8WA 2WD9A 4PD4H 4Q7MB 2BT4A 1ONBA 2C77A 2VQDA 2A1TR 1Q6ZA 3AVVA 2YWFA 3LSGA 3DVSX 1YO6A 2IA5A 2FXOA 2HI0A 4FFSA 5E95A 3H1HJ 4CMCA 3VGPA 2FOKA 2F5EA 5KTYA 2OLJA 4A0HA 3EGDB 5CJJA 4U6SA 4UTOA 1XEWY 4W7IA 4J19A 1SA0B 1YITI 1JMKC 1S2MA 4R98A 1OASA 1R9NA 1EFDN 3ER8A 2OWDA 2W6CX 2NX2A 4H0LB 1RZUA 3E5NA 1UINA 1GU7A 3F98A 4Y0VA 3G2IA 4NBSA 1OC4A 1ZVVA 2VBYA 4ZO7A 5F4BA 5G2OA 3RYHA 3NM5A 5GPBA 1NU1G 2IPXA 1GQQA 4Z1MD 4KLNA 2PMDA 5DLEA 1UT8A 1DOHA 2APJA 1GA1A 1U6KA 4RETA 1NZDA 1RQLA 3M6VA 4TVKA 2IYLD 4OOFA 2OCPA 4YT8A 3JQGB 2C9DA 5KKNB 1VBFA 5GIPE 2HNBA 2VP5A 1Y1QA 2GBIA 3RSNA 1EKEA 1CLEA 4MGHA 1QG0A 4CKWA 3KZYA 3K09A 2MINA 2G63A 3BWDD 1G38A 4BQOA 5J8FA 4RKFA 4LMAA 4IFIA 1XL1A 5EWLB 3PWKA 3MEXA 1BR4A 4U3FD 1DX9A 4DW6A 3VYRB 4FCYA 1IHDA 5A4DA 3ZH2A 2L01A 4PC2A 5JXHA 1EKXA 4XX0A 3CXRA 1J42A 5HCNA 4KNYA 2OZPA 3F6RA 4D5EA 1BG6A 2O8CB 2RGGA 1I27A 2EW2A 1PLLA 2B87B 4S24A 3S8MA 1HV8A 2H16A 3DW3X 3AIKA 2CLCX 4QUHA 1HQKA 1OU4A 4LQLA 4QOEA 3VPHA 3ZQ6A 2KP6A 4NBVA 2G3YA 1AQJA 3PJFA 1TIBA 4K8RB 4Q5IA 4DUGD 1FOSF 1FIAA 2ME0A 4XD2A 3N75A 3T5TA 3WL5A 2XQJA 2ODQA 3PEVA 3PRKE 4JMPA 2UYQA 1UXHA 1JY2N 2PV7A 3CE6A 4EUFA 4NEGA 1WNFA 5CXSA 1UPCA 4Y99C 1K06A 1KYIA 4Y2RA 3B3AA 4QEZA 4BB0A 1XHEA 4LJKA 1MTZA 4RK6A 2CJWA 2XCLA 1XX6A 2PSHA 5GGXA 1QO9A 1LDKB 4KVAA 3PGMA 1M6YA 1VB5A 2ES4A 5REQB 4EPVA 3E7DA 2Z2SB 2ZJ3A 3MN1A 2QRLA 1U0LA 1N9GA 1X4PA 5FQNA 1WG8A 5D3KA 4EVRA 1R23A 3RC7A 1KZ9A 2H9IA 2ZSIB 2Q3MA 1LWNA 2OV2A 2OYSA 2FSUA 2MG4A 4DL9A 1M5UA 3QLVC 1OAKA 3OY2A 2PWYA 2QVOA 2F3PA 4XORA 1UBKS 1SUPA 3ITNA 2REOA 2NO7A 2L82A 2PUAA 1V4VA 4JYKA 4OGFA 3H9CA 2V5UA 3ZOBA 3H6PA 2FE1A 3A03A 3T1YB 5LGUA 2P2NA 3ITEA 5AVOA 4FFBA 4LVCA 4RELA 2Y75A 3BCAA 2A5YB 2FBWC 3UJHA 2NRAC 3IQZA 3N2EA 4LV6A 3DCFA 2HKXA 5IYDJ 3P0IA 4IL6C 3KP5A 3GUHA 1LKZA 2VAMA 2RQPA 4DDTA 4PSAA 3LCRA 2P9QA 2CVZA 3HCCA 4B6QA 3IQXA 1LTJB 1OZFA 2QA4P 1NBIA 5ILUA 1RQUA 4PYIA 1K2WA 1MGPA 3GVHA 1Z88A 5LQCA 1E2IA 2Y48A 4EF5A 3PHIA 4AWAA 2JH3A 4H77A 1QQAA 1DDGA 4UFNA 3OWXA 4REQB 4CN9A 1D4ZA 5DWDA 1U9YA 4MUAA 1G2QA 1H88C 2VO1A 4L57A 5JAOA 1L6RA 4AX4A 2E48A 3Q3VA 1WI3A 1JKQC 3LUGA 1WSAA 5JQWA 3RGGA 5LOVB 2H92A 4ZVLA 1UKBA 2BKXA 4WWHA 3C5WP 4MYDA 5CDTA 1BI2A 4BVBA 1U3VA 4CKYA 2NZ2A 2EFDB 3QP5A 2A5JA 1L5LA 1EDIA 1PU2A 2P10A 3AEKB 3FLEA 2WEKA 4CM1A 1Q0HA 1IW7F 1OH6A 3DLHA 3GLIE 4Y9DA 3EOBI 2X5JO 1YE8A 1L5KA 4CI0B 3MMZA 3Q98A 4F91B 2D3WA 2GJ8A 4DV7B 1V1RB 1QZYA 3GZNB 1Y1LA 5HIMA 3SSUA 2WM8A 2CNKA 4K2AA 4Q1FA 1GAWA 3BM5A 5F21A 3UAVA 3A3YA 3UF0A 2IXTA 3T7KA 2F5CA 2DF8A 4XYLA 3VU1A 3FPGA 1Y3BE 3TW8B 3V8VA 2F4IA 1K6OA 4HOBA 3Q7EA 4K6MA 4X3OA 5AUQA 3A70A 4AQRD 3QNUA 4C89A 5CNIA 2EOAA 2ZJOA 4DLRA 1RLIA 1M74A 4IFBA 5LQMA 1IN4A 1TAUA 2W2MA 4L73A 1A02J 2V8OA 2ZR0A 2QTGA 1SQXG 3EZ2A 3MAGA 3VHXB 4EHHA 4RZ2A 2OL4A 1XTRA 1D1TA 2H3EA 1KI6A 1G8KA 1TM4E 4I55F 1RVV1 4RD1A 4DLSA 1PL0A 2KYVA 2RH8A 4PFQA 1QFZA 2M9MA 3EVZA 1VLJA 4EB6B 4L02A 3CLHA 3LG2A 4ESJA 1VLVA 3JXEA 1JKJB 1L1EA 2DY0A 5JDIC 2KIUA 3V1MA 4H13C 1RYBA 4QU9A 5DWVA 3KD3A 3RROA 3KP2A 5K4AA 1JSRA 1OBHA 1WRBA 2SHKA 3HRKA 2RAEA 3HDTA 4Y6SA 1EXJA 5D87A 1FY2A 1H8AA 2WWFA 4HEA1 5AM1A 1ENZA 5JXGA 4K0KB 2VZ9A 4R3WA 4EENA 1JG2A 5JS6A 4X66B 4FYVA 2Z5UA 4PIVA 4YK7A 3KYIB 2EIHA 1UP6A 2DQSA 3PITA 1R64A 2WBLC 3ABRB 1BMDA 2YUIA 1FF9A 4N4OB 1XKXA 1SFCA 3C41J 2JAXA 3A0UA 2LD5A 1J06A 3EYYA 3NEUA 1EE2A 2RJNA 1II9A 3IBTA 4F21A 4BNCA 1XEWX 1ZOOA 1ORDA 3A9CA 3TTUA 4LBYA 1SKYB 1ZKGA 3F4KA 3I23A 1ODLA 4MP3A 1CZKA 3OLQA 5A4KA 2MSCB 4ZOQI 4EMSA 2ZRCA 1NHAA 4RS3A 1Z25A 5ESWA 3M5PA 3DKXA 1S4QA 1ZRMA 1ZD4A 1ND5A 5E8GA 4A3SA 2IZ0A 3OL3A 3M5WA 2LRDA 1UKAA 4M8IA 3O1IC 1KH1A 3VR4A 2WWHA 4M1WA 3BMOA 2F3RA 1VJGA 1RI4A 5FBRB 1NTKG 4KN5A 3ZXIA 2D7CA 1L4AD 1X8KA 2H1OA 3OMXA 5FGMA 4Z4FA 1KIMA 2QLNA 4QPPA 1ZO8A 3CC2P 1NBOA 4PR0A 3AUFA 1QIKA 5E3OA 2MOKA 2VNAA 4Z1MH 1GZDA 4MIEA 1S3GA 2VDRB 1L9KA 4Q1VA 5KK1A 1S6LA 5IWCA 2R8ZA 3MKWB 5E6RB 5FO1A 1HFJA 3GRRA 1K89A 4PRKA 1NXPA 1KZ6A 2GKOA 3KEGA 1QV9A 4LG0A 3BZBA 4DC0A 1S6YA 3G6EI 1BGYD 1G1JA 1N7SD 1KFMA 2O5EA 5A4AA 3DKIA 3U1KA 2IPQX 3RTBA 3KYCA 3K73O 4HDUA 2X6OA 4UASA 5DK6A 4WBAA 1IJFA 1RE3A 2QTMA 2A5FA 1CUFA 2P2YA 3FJ1A 4MVJE 2EFGA 4D25A 2VBFA 2C4KA 3P97A 3V00A 4JA0A 2D59A 5FFFA 3LOUA 1XZJA 5KHDA 1VBNA 3A1CA 1KFCB 4PSVA 3QE9Y 1EDJA 3I2JA 3OEHD 3MSCA 2H2IA 1U81A 2VNIA 1TQMA 4NE7A 4BVKA 5IXSA 1SKQA 1BW9B 3NATA 5B5EC 3DMTA 2B1QA 3AEZA 3V48A 4I8DA 2IHBA 4QUAA 1BCCE 5I7FA 2P79A 4O33A 5BNFA 2LZ0A 4D57A 4R40A 2FN9A 3DBRA 5ARCA 2EFQA 4OBEA 1LQUA 2ZI4A 4FSHA 5E9JA 3DVAB 1F0PA 4BO4A 4W7HA 1NTCA 4ZIRB 1S7GA 3DDZX 1BE3G 2VOOA 3JQ9C 4J2HA 2PH7A 2VF7A 2AW3A 3JAMZ 3QE0A 4TYMA 5IVIA 4E7JA 3HXPA 5E4TA 4CQLB 3DEIA 5BPDA 1Z2CA 3CNOA 2CEKA 3OW2O 4IRGA 3I4CA 4GRAA 3E8SA 2I2FA 2JT1A 5JI6A 3GFVA 2OB1A 3H5LA 2OM6A 4BJTA 3TS1A 3GPDG 1PQWA 3GVIA 4ARIA 3U3MA 1CQIA 3FHNA 2VPLA 1AX9A 3OKPA 1SAUA 3D6VA 4UQOA 3T3HA 1HEUA 4QZVA 4L76A 5CM8B 1R3UA 3OYHA 1FSGA 3PK0A 3M9WA 4OGWA 4A3IJ 1BHQ1 2RGEA 5BSFA 5JHGB 4BBAA 3IOBA 1N73C 4TRNA 4NU6A 1GA6A 4MVJH 2QX9A 3T9CA 1G4DA 3G71I 1DIAA 3K4QA 3W3AD 1JY2O 5IAGA 4IRUB 4JKIA 4B33A 4DXHA 3OY7A 3FDZB 2KBEA 3DMFA 4WMLA 2AR9A 1DELA 1XMPA 1U8EA 1PBTA 3T34A 1PK7A 3ZY6A 4V39A 2G1PA 3H5WA 3GLLA 3C5EA 1P5ZB 1OD6A 1NAHA 4JC4A 5DYMA 1EGHA 5AKXA 2ICWG 3JASB 4OIOF 4PLPA 2HXSA 1KNXA 5D51S 3IUJA 2YOGA 5FUMA 2XSDC 2OBFA 1D1AA 2V5VA 4JLMA 1FZTA 1NOKA 3PNKA 5BUCA 1XZGA 3I0TA 2W6AA 1K97A 4IQFA 4C5CA 4HDRA 1N6NA 2O2GA 3ZJVA 3VYIA 5TQVA 4BX9A 3ESWB 2YWCA 5KYUA 3RKSA 2YVKA 2PG4A 3GBVA 4I8XA 3MCAA 4UU8A 4P33A 1FNDA 3OZVA 4U3JA 5B55A 4UY8I 4TLEA 4BO2A 4TTAA 4YJFB 3LSMA 4QU0A 1GGHA 1F9EA 4RZIA 1ZIOA 1VF9A 2ZYAA 5HZGA 4CKXA 4NEQA 5F27A 1ZPDA 3C1DA 3JRDA 1XRMA 1YA4A 2YZGA 1H2YA 5LUAA 5DF1A 1M34A 1Y81A 5IEJA 4HGPA 1B2RA 3H04A 5COAA 4AIDA 1JEQA 3B2QA 1X7XA 3RC3A 4BPRA 1UDRA 2BHLA 1XZIA 3H1PA 5E7QA 3ITDA 1U3FA 2QE7H 3F78A 3SOZA 3CNNA 4LECA 3EEIA 1UBTS 3ZEIA 2FG5A 1DEAA 2FQ1A 3JC22 2QQ0A 1Q1VA 5DBOA 3FRIA 1Z91A 3KJQA 2WG0A 1FTWA 4DFDA 1J1ZA 2I3ZA 4DLWA 2UAGA 3N39C 3ORRA 2X0DA 3VV2A 3OPVA 4XPIA 5DCMB 1B6GA 2XVYA 4FR5A 1HW2A 4QOSA 4E5DA 3IAM1 3H8SA 4S1OA 2Y0MA 3LQRA 4C3VA 1YZ3A 5F7OA 1KWKA 2HU7A 1EFHA 3PJDA 4CWAA 3KR1A 3MTBA 5FYQA 1O6ZA 3GHYA 3I12A 4FB5A 5GAJA 2QTZA 1MO2A 4RK7A 4IXDA 2BFOA 5JNUA 4TLDA 4E6KG 5BSGA 3FW1A 5BYJA 2QRVA 2PUHA 3DFGA 2I6UA 2JI6A 2WMDA 4IX9A 2DQKA 1A7JA 4IQGA 3Q3DA 4MV6A 3EGDA 1MEOA 4IG4A 3WFJA 4ZKEA 3P0RA 5IPAA 5T7BA 1Y89A 2A06D 1SCIA 2KPOA 5EWMA 3H1JG 2PT9A 1N2ZA 1MNDA 4UD2A 4AP5A 3HJBA 5EMKA 3JR3A 4FR2A 1THTA 5P8WA 1KU6A 3H8VA 1KQOA 2YZ2A 3DAPA 5FOTA 4QYIA 4PYMA 2Q50A 1U7ZA 4NMHA 4C0SA 2VJQA 1P4GA 2REBA 3TMYA 1ZICA 2QN8A 1U5BB 3O8RA 4RDXA 3TKAA 2X2EA 2ABWA 2BKEA 2OBMA 3MHVA 4F72A 3R7SA 3MW8A 5FBHA 3QOXA 3JAMK 3INTA 3N28A 1P77A 4CKBB 2Q3EA 2NYXA 3CKYA 3LDFA 4RSMA 2M1XA 3L74D 1ECCA 4P4UA 4M99A 3PKZA 3TI9A 3HRMA 4QMAA 4LKOA 3GX4X 1UC8A 2M7AA 2ISQA 3RTCA 2IA2A 1CDZA 4Y6GB 1IHPA 3TQOA 1XCOA 4F8EA 4LJ5A 4OHWA 2WSCJ 2BEOA 2W5UA 2YV5A 5DNWA 2CLMB 1WBDA 2DDAA 4OJTA 3OECA 1OFTA 4YO7A 2NTVA 3KFWX 3KE8A 2C4MA 2HOAA 1UODA 2JJMA 3B5NC 4NBNA 2R6HA 2XF2A 3CC4P 1QO0D 3PE4A 2GYWA 5TPZA 5JR3A 2F1IA 1EGMB 1V9SA 1Q50A 3GD7A 2Z2KA 2VHYA 1CHDA 3MMPA 1L7DA 1HLVA 5EXXA 3CUQA 3BK1A 1YCFA 5HFNA 5JO0A 5DIZA 2E4YA 2HF8A 1JHYA 5JCZA 4YRIA 4AMVA 4IF4A 2YRWA 3HTKB 4MDFA 4F12A 1H4TA 3ZS8A 1BGYJ 1Q1NA 4L9SA 4EKGA 3PJRA 2VQ3A 2R751 4DDUA 3TQFA 3CU5A 4QXAA 3ORHA 1UM9A 3T9EA 4HUJA 3RWBA 3TDUC 1J2XA 3OSGA 2PWZA 2PUTA 3FWZA 2C03A 1UG0A 3ZHSA 5DHSA 4MPRA 2ZLBA 1IL0A 1DH3A 4PJ0C 2HPCA 1Q14A 4B73A 2GFQA 4DNXA 4M8KA 4HTAA 1Q3HA 3EEOA 1BFUA 4Q16A 1H0SA 3QELA 4B6RA 5D6NA 4EDFA 1IC6A 1QYVA 1ZSNA 1X22A 2OWEA 3G9TA 3DOHA 4JR2A 2QVYX 4P3XA 5J1YA 3TAHA 4FKBA 2W2TA 3L6RA 3ZR8X 2HMSA 4UM7A 3BPVA 3K1ZA 2GCOA 5I7EA 1VCOA 1E9RA 2O07A 2FK7A 3EZXA 4XVCA 1NUUA 2AZMA 3DFFA 2PGJA 3KLBA 4NICA 4OQXA 2OB2A 1T8RA 3UGJA 2G28A 2ZUVA 1JUSA 4ZDKA 2W2KA 1YGYA 5TT1A 4OKNA 4MPTA 1JKRC 3UNXA 2DW4A 2WJ4A 1GLNA 1YR1A 3V32A 3GEIA 1GK6A 2PQMA 5DHTA 3ZQKA 4FS8A 5KVSA 1O94C 2J5OA 1GFWA 2E74D 1RXVA 5HIAA 3KL2A 1SURA 2G4VA 5KPJA 2CV2A 3ZZNA 3KPYA 4KVGA 3WGVA 3KWFA 4AU1A 2WIBA 4TXMA 4C0KA 5K5GB 2BHRA 1EUQA 3ABOB 1VTKA 1ZL2A 2IBZD 4UNQA 3R40A 2V4UA 4G0PA 1S3FA 3K53A 3ZWAA 3E48A 5C7YA 1HL7A 4AO7A 5KREA 1YIJP 1OR7C 3CCSI 1ULZA 4YQFA 3E9CA 1FFEA 3HPRA 4IF6A 4I9FA 3K9BA 2FYNC 1N75A 2PXAA 3L1IA 2AQFA 4IIVA 3CDLA 3VM6A 4KPUB 1QLWA 3K7AJ 3ANYB 3JQEA 3DU6A 5JYCA 2ZYIA 3K2EA 3ILHA 1ZRCA 1U0SY 1RKBA 4C2AA 1P17A 5CCXA 4QTRA 4LYJA 5DM4A 4CMJA 1GGJA 4YQYA 2PZKA 5HLTA 3RSHA 3EIHA 3FZNA 1XS9A 3W6VA 3W5JA 1W6RA 1RKXA 3PD7A 3TRDA 4TRRA 4YR9A 2CNNA 2OSBA 4FGUA 1CKEA 1J8QA 3DO8A 1KIFA 2NTJA 2GA8A 3IVRA 3NHAA 4FISA 4FTWA 3MWEB 3T3OA 1L5HB 3G5UA 2ZNZA 2P6RA 3K1AA 3CRZA 4HFMA 1FJ2A 3S1AB 2YXQB 4C6HA 3ND9A 2O50A 4RF5A 3HA2A 3G8BA 3OCCA 1U57A 3SWKA 1M33A 1ZEJA 4C14A 1V8FA 4GIBA 3BWYA 3V4VB 1CW5A 4R9VA 3NDBB 3WHPA 3TGPA 3HJUA 4D4IA 2GO1A 4Y2QA 2YKQA 1JRLA 3UPUA 1AUOA 2B34A 1EEHA 3G2LA 1IG0A 4MROA 3GLQA 1XZBA 2M8GX 2MHCA 2GESA 3FTNA 4HKZH 2DFPA 4TXJA 2YZ7A 1MMAA 4J1TA 3EVFA 3KSBC 1ZUNB 2EX1A 3FWPA 3ND6A 1OLSA 2J87A 3DL2A 3FDYA 2KBFA 1MJGA 5IT9A 1W7PD 4WXCA 1VLQA 2R5WA 4GYJA 1XPRA 3FDXA 1NQXA 3GOQA 3HOVJ 1GVNB 1JTFA 2J3HA 4PFKA 4CM4A 3NTOA 4N5IX 4OATA 1N5DA 2X1LA 4E2FA 2D5CA 2R7OA 1UJMA 4JGIA 3UKOA 5J9FA 5PNTA 2JA7J 1VJRA 4W82A 4LYGA 1KILC 2Y1EA 1JU4A 1XVTA 4YIKA 3WU1B 1PV1A 2TDXA 4G5OA 3K1TA 4M0CA 1SQVK 2LR8A 1Y6QA 4LB5A 1WVMA 1Z0FA 1QE3A 3BHIA 4RDIA 4WZBA 1KRXA 4A12A 3B70A 4W5WA 3RAJA 2O3SA 3GFIA 2DFEA 2Z16A 1TYZA 2W22A 4BEJA 4GZMA 4AJ4A 5I8PA 1GAQA 2CQ7A 1KKMA 1DHTA 4BGEA 1OVMA 5APYA 1BU5A 3V8MA 4ZTUB 3H18A 1KVUA 1UMCA 3JQAB 1F8FA 2QW8A 3RIMA 5BYBA 1R0LA 3C5HA 2CYYA 2BLNA 2UYYA 2VC1A 1GD2E 2Q7CA 4CQLA 1B3BA 3VSLA 4Q4HB 4L3WA 5LB4A 4N0BA 2X85A 3KBOA 4J1QA 3GLHB 4O08A 4P22A 2J7PA 3F9CA 1NONA 1P1RA 1RWBA 4Z7JA 3QZUA 1IRGA 2PMEA 4U7JA 1JKFA 3A0HC 2DFHA 5DMHA 4XSVA 2PX8A 4MV8A 4RPKA 1FNNA 3VVCA 2QL5A 2XAGA 1GD1O 2QAJA 4J7UA 4EW2A 5JBQA 3IV5A 3IDSA 4HX2A 1QZXA 2DA2A 4EK9A 1MW7A 4HQ0A 2J6IA 2KW5A 2UZ4A 5BMVA 3G02A 3O82A 3O2SB 1BJAA 3H16A 5K8IA 2EFNA 2JP3A 4IUCS 2OXEA 1SBHA 3KKNA 4LK3A 1GTSA 4TROA 1U8XX 1GGFA 3WLNA 1Q1AA 4K03A 5E4JA 2ZB8A 2IRWA 4BMXA 3TECE 2VIXA 3PPXA 2R1ZA 3RW9A 2FFDA 4MUNA 4A0QA 3C3CA 1F14A 1T1SA 3BMCB 3BIFA 1CC1S 2ZJRF 4GQBA 2GSWA 2GPTA 2PH3A 3RS9A 3TIFA 3LOQA 4ZP1A 2WM2A 3WGMA 3WAGA 4ZJPA 1Y48E 1YJCA 5JVDF 2ZBVA 1RYYA 4FNMA 4HNUA 5AI6A 5EMMA 3UMJA 3RPQA 5GM2A 2B61A 3UA4A 5LP6B 3KQOA 3GLHA 3SYRA 3T9DA 3RJ9A 3ZIAD 3RKQA 3P8MC 2UUAB 2ZITA 2PA3A 4HVAA 3LQYA 1OB2A 3F2IA 3GVXA 2IBZG 4KHPB 2OCCH 2LBFB 4U6NA 4YG2F 2DSNA 2VQLA 3RV4A 5CT4A 3OICA 3NFRA 3T9BA 1C1DA 3OYBA 3U59A 3AFHA 2PT5A 1DAHA 1U0NA 1Y3AA 2G9NA 1O9BA 1LTHR 4JP2A 4BRSA 5H6QA 1XKLA 1YJWI 4LJ7A 4M74A 1FZFA 3Q3SA 1JJ6C 4EM0B 2QAIA 5H3HA 3B9BA 3EPKA 2LD4A 4JSYA 2NNYA 2VYQA 1U8CB 1C29B 1NH4A 4BECA 1GGMA 3NBZC 3QX9A 4RESA 3B3GA 3ECOA 1PFGA 4A3JJ 2ZGVA 4DNQA 1XP5A 2I1VB 3D8RA 3AIOA 5AI5A 1N6IA 4D1YA 2QI9C 1YS6A 1YVEI 3PC7A 5F04A 1VE5A 1WV0A 2W27A 1YQXA 4NJMA 4F2PA 4C6SA 1QB7A 5GQSA 3H2JA 1KJZA 3I2HA 4IIEA 3SM3A 2WUFA 4G7ZF 4I55B 4IOLA 4JXKA 3X1KA 2KNCB 3IKLA 1J0BA 3INNA 5EFZA 3MUFA 3R8FA 4EG5A 3HGGA 4JWKA 1UK7A 5CDUA 2I4MA 4I50A 3R0VA 1H9GA 4LUCA 4QSHA 5M1BA 4M9QA 1E7SA 3FRHA 5F2OA 3ZJ4A 1FZEA 3K2IA 4JGGA 4JQZA 3NDJA 4KWTA 4NBRA 4NESA 1IM8A 1EVZA 1T8UA 3KUCA 5K6TA 2E7WA 4WCFA 2CLFB 3E7FA 4O0LA 2H8GA 3O74A 5D6OA 2FEZA 4DAEA 2UWJE 1IZ9A 5AW7A 4KIBA 3UWSA 4WECA 1BS9A 1GO2A 1YZHA 6ADHA 5BYKA 2HHLA 4MUIA 4KH0A 1Q1GA 4YRCA 4E2WA 4QAJA 2OBBA 1VQNP 2JRCA 2MJLA 4IEEA 1C9DB 3HD7A 3TNUA 4Y2HA 1P3DA 2GOXB 4OAYA 2VXOA 1ST2A 2C9CA 2P9EA 3HUGA 3WGJA 3BHMA 1CUIA 3NWPA 4ZU1X 4GP7A 4YCNA 1OXSC 1R9MA 3LZDA 3NIBA 4DMFA 3ANSA 2P81A 1Y0NA 1N5JA 2BCCD 3Q7QA 2FCRA 3SAJA 1IY0A 2X42A 4XWGA 4NR0A 5AIQA 1C8KA 3JYQA 1L7AA 1ZN7A 3BJOA 2EWVA 1L7EA 2GJSA 4D56A 5K4HA 1NHLA 4L7QA 3E4DA 2AC4A 5HEKA 4FOLA 1YBMA 1OXZA 1EGAA 1VE3A 721PA 4Y1EA 1F7UA 2IH2A 1CW2B 3WQHA 1BN6A 1OCRH 4TS9A 1YVDA 4EZEA 2FZLA 4OQZA 3AKDA 2H94A 2VPTA 1YRNB 3AE2C 2H54A 3SIPA 2JHGA 2X4DA 4E2ZA 3B7GA 5DN9A 1G1MA 2IT0A 5A6SA 5GTIH 1HGVA 5CW2A 4Z9YA 3UANA 4UAUA 5L8VA 3TLCA 4XRFA 1P4WA 2O8KA 1NATA 4HB1A 4YACA 1GNVA 1V47A 3U5ZB 4YVFA 1RW4A 1SY7A 1KJWA 3F3XA 1W4LA 1ZQ3P 3WL4A 1QK5A 4CM3A 4F92B 1HTTA 3D6NB 4HNAB 5ADUS 1EWYA 3HPGA 1GEEA 3P9ZA 4DGQA 4ENJA 4LW8A 4KYWA 3EAQA 5B4UA 2ZU6A 2JLVA 3LECA 2ADMA 2EQ5A 3SDBA 4RCVA 3OUTA 3HXLA 4A15A 4JBGA 1EFLA 2R00C 1Q21A 4BMOB 3M6UA 3O6BB 1XTVA 3TX2A 3OBIA 1GRVA 1G3YA 1LDJA 2CZCA 1N8RQ 1R0CA 2ZWOA 1Y80A 4CM6A 4KBFA 2D2CB 1XJWA 2W93A 3LSHA 4E7OA 2BGNA 2DTDA 4A0ZA 1JVSA 4D9JA 3DZJA 1CZOA 2WUDA 2V9KA 3C7TA 2FWBA 1RMYA 4HAZA 2Y0EA 3NWJA 1E79D 2M5WA 4J00A 4K6OA 1G5RA 1D4AA 4NDNE 2E6UX 5FTWA 1ZSVA 2H43A 2ZIUB 1S4MA 3QUAA 3LRPA 2WPDD 1E0SA 2ZIZA 4QO7A 3EVTA 3EH1A 4KPEC 2P30A 3EZLA 4WY5A 5JV5A 4XAQA 1ETKA 3AG5A 3W8NA 3QPBA 2AOXA 1SR8A 2LBFA 4R8HA 1LWUA 4F45A 4HWPA 1AUVA 2RAUA 1L5RA 3EFEA 1R6TA 3Q41A 3ZGZA 5C5EA 3H2SA 3CMEI 3CMAI 3WLKX 4MV7A 4KEAA 5EP3A 3AR8A 1QYXA 2CCJA 5TQ2A 4DY4A 3GQBB 2I76A 3O6VA 2DMTA 1N6PA 1PNOA 1WW8A 2OMEA 3WGUA 6GPBA 1JN0A 4E3ZA 3C6MA 3K6SA 3H65A 3OCZA 1NBEA 3DE1X 1NTZE 1VLMA 2JB9A 3F8TA 1E2MA 2QRZA 3LA3A 3IEKA 4J0CA 4QOGA 1T4MA 3DAFA 3SKXA 4P82A 1USWA 1Y1PA 3FVRA 1M57D 3KXLA 4INAA 4ND7A 2Q5FA 2WMOB 5GWXA 1UBOS 5CD9A 3IR7A 5APQA 3VFDA 4NBTA 1KY3A 2WJGA 3FG9A 1IHOA 3NMDA 1YLFA 4ZO6A 3ZHVA 5HQTA 4G1FA 4KVFA 1KH2A 3VHQA 3SZTA 3GR6A 3CW9A 4BDYA 2X1DA 4HNSA 1RF1C 1WO8A 1G17A 2C2ZA 1E1DA 4JLSA 4PLCA 1TK9A 3DO6A 3W78A 4XI9A 3M9BA 3WTBA 1T4CB 4B86A 3ADDA 4S0ZA 3OLVA 3A06A 5K8LA 1VIYA 1P84E 3HE5A 4BWYA 4DBLC 4OI0A 1FMWA 4Q37A 4F2GA 1JMYA 1KJYA 1WD5A 2V6MA 3FYUB 1CG6A 1TU3A 3T8TA 3FF1A 4BFLA 1WQ4A 2ASVA 5CDHA 3H1KD 3EH2A 3E3VA 4WZBB 4XLNF 4AZVA 1PT9A 1AZSC 4BQPA 2IPAB 2YWEA 3HFSA 3DLAA 3QVTA 5LSAA 5JDCA 2KKOA 2WYWA 3DHVA 4EYKA 1EDEA 3U44A 2E2HJ 2W00A 4G26A 3IO3A 1E2BA 2QT9A 4W8HA 5G1OA 1NXTA 2GBGA 3VOSA 2NIPA 5APUA 1ULHA 5D5QA 3SC4A 1PJAA 2HVSA 5JVDA 3SXYA 3IS3A 5KYKA 1EVEA 4CA0A 3TTTA 2KJBA 1VG9B 3R5HA 2HU8A 2XSJC 4GKVA 5K3FB 4GL4A 1M2HA 1QRSA 3F7OA 3QE2A 4MWDA 4H6VA 4ZU6X 1MW9X 2C84A 2QM3A 2ZNYA 2EDAA 2G8NA 1EFVB 3HGYA 3LAPA 3QX7A 2HRZA 3TIXB 3DR3A 2NXWA 2DECA 4JBIA 1X2EA 3ZHCA 3D4NA 3PEUA 3DFZA 2XXJA 2HSWA 3CPJB 5DLDA 5BVGB 1TQ4A 1RJ9B 1YI2I 4INPA 3LP8A 2JA1A 1OH8A 4N47A 3U80A 4RVUA 3IOCA 2CXQA 2O0YA 3TD2A 1VE7A 5DGDA 4AF8A 2Q3JA 5BNTA 4YCAA 3A3KA 2YFYA 1N25A 3IDOA 3OX4A 4RE6A 4ZWNA 4F71A 2OLKA 3UC5A 3JALB 4Z9FA 3PV0A 1GCUA 1HH0A 3LT5A 3EUAA 2BFDB 3MZHA 4HL6A 2O8DA 3BEOA 3V1LA 1AKHA 3S15J 4ND4A 3LX8A 3RIGA 1JLMA 3RUHA 4MCJA 4FYWA 1OKRA 4RTLA 1KD1Q 3R77A 3F9KA 2HEOA 3HEAA 1ISHA 3N9IA 3UKDA 2V03A 4RA9A 3HB7A 1BCCG 2E82A 1OFVA 3AVTA 2IYYA 3LRXA 3C3KA 5ALNA 3C1OA 1PR3A 4HLQB 1OCTC 3QXXA 2B87A 2EBUA 2ST1A 1VQ1A 3OBBA 4YMWA 3A0BH 2H6EA 4RPCA 1DBRA 4LNAA 5E8IA 4D0SA 1LJ9A 2O23A 3FPSA 5EKSA 1IN5A 4J91A 2GUVA 5DM60 2VDLB 2FWIA 2JFZA 1G2IA 3LA2A 3NT5A 2DLLA 3K1JA 5BSWA 1NW5A 4NJOA 5JD6A 4EP1A 3NXSA 4DDVA 5CCGD 1DJLA 3FKSD 1EQUA 3BR0A 5K1ZA 2YXBA 2JTVA 1SBIA 2IDBA 4X71A 2V55B 2GA2A 2K2WA 5F77A 3ET5A 2BEZF 4HWGA 5E6UA 2PO5A 2WU3A 3R9KA 5CCHD 4BWVA 1O1YA 4WNCA 1RKVA 4JZKA 3WL8A 2BY0A 2W70A 3DT8A 1Q7TA 5KNLA 3NHFA 2XCTB 3UWPA 1Z6RA 5KAFE 1L7RA 2XASA 3WWOA 1WB6A 1XTTA 2WWIA 4V3CA 3HU5A 1PYDA 4G8XA 3OLZA 2UUZA 4KIFA 2P3OA 3P9SA 2AWOA 4WSOA 3R4VA 1MTOA 4N6JA 2QVZX 5GV7A 3VKWA 5AVQA 4X20A 1I6LA 4A82A 5L40A 1OYOA 1WPKA 4QX6A 4EBBA 1LTBC 4XR6A 4BEHB 5IJXA 2AXNA 2FSPA 4TKUB 1DAEA 3FGPA 3IMKA 3F0CA 3MNFA 3NRCA 1QVWA 1ODSA 2L9VA 2VODA 1Y56A 1XB4A 1OOEA 1AK2A 2QUFA 2A8YA 3FNQA 5EXPA 1VJ0A 2FZEA 4Y6PA 2P35A 4F7WA 2IZ1A 3RPUA 1R0ZA 4CTOA 1MC4A 3PYMA 4QT0A 2V26A 1NGMB 3JZIA 2GA9A 2EJWA 1OFUA 3FOWA 4MV4A 2J09A 2H4HA 3WLEA 3C97A 3FLBA 3ORSA 1WAMA 5B5EH 1GSIA 1LSSA 1T2AA 3GJ8A 4L18B 2E7ZA 2OCKA 2HB6A 4F1JA 1H2BA 2JAHA 2WMYA 2C7QA 3FHZA 2JL1A 1IU9A 3K6SB 3KZIE 4EG1A 3EDPA 1CVIA 3GFRA 3P32A 4BKOA 3OSZA 4TV8B 1JA9A 3M06A 4S1NA 2B63J 1MJNA 1MO4A 4MNUA 1MEJA 3BORA 1ND6A 1A69A 4IOJA 1HQCA 5BQTA 3DE5X 3KVNA 4HGZA 2ZDHA 4WN9A 3UH1A 1B8VA 1U5CA 2WWRA 3DGEC 2N1TC 1AQ6A 4FWIB 4P4GA 3LY5A 4R2MA 1K79A 1P9WA 3R24A 5D00A 1U9NA 4JUCA 4HLXA 4RV9A 4PAQA 1R6XA 4NPDA 1KQ9A 4PHHA 2QTFA 5L3CA 3AKZA 4IDCA 5AJTA 3WZMA 2XB4A 2FDRA 2WVHA 1XZKA 4B8YA 3KLNA 4H4KC 5EYRA 5IHPA 2ODNA 4XRSG 1YRAA 3BTSA 4QXMA 1SUCA 3CMAP 4C0BA 1CY6A 1KN7A 3TYXA 2FXVA 4GD3Q 4H17A 4BXFA 4O8CA 3ONDA 5JJLA 3OV8A 2REQA 4W6ZA 4WZZA 4AFNA 1Y9AA 3QLTA 1U8RA 1I6XA 5FKJA 5ALSA 5LQRA 1PR5A 2P0YA 3T1TA 4Q3AA 2MYNA 2C78A 2FUG1 3GPBA 4E6EA 1XRRA 3LUKA 1V71A 5E1WA 4Q9KA 1FYMA 5ILOA 1JFSA 2KB7P 2L7KA 1MZBA 1DHRA 1NXOA 1GTL1 2IIBA 1O0BA 3GIWA 2M87A 1RAEA 3FMIA 4JJEA 3OQNA 5HTKA 4KQKA 1DG3A 1ULAA 4PRZA 2O8VA 4CKBA 2A9PA 1LEAA 5SYNA 2FFHA 3ZV7A 3GLIA 1KJNA 4IJAA 5MFZA 1HFEL 2KJQA 4TLBA 4NBLA 4OGQD 2QPOA 3PXEA 1JY3N 2XYRA 4KKVA 1E3WB 3DXJF 1R0BA 1ZH2A 2IHTA 5AJUA 3AESB 5E18F 4Z6KA 5DTRA 2QUIA 2GEVA 1KY2A 4FI3C 1A76A 2QLLA 1BX0A 4YBZA 5H8WA 5CX4A 4CLRB 4HQNA 3KVRA 3I71A 1UFVA 1GZ6A 3IO5A 4KQCA 4EHJA 3A26A 4ERXA 4PFOA 3G2KA 3GPLA 3BZ6A 2P2GA 3CNBA 2ZDQA 2PJUA 2DA5A 3H83A 3HDVA 1Q7RA 4BUJA 4HN9A 4DCTA 1MNMC 1ITZA 2HF2A 5C7IO 5IC6A 4FDMA 1LB1B 4A93J 2ENWA 1U7DA 3QUQA 3JWEA 1RAHA 3KPEA 1UKCA 3FGOA 4LDNA 3FSGA 1M2FA 4CM5A 3PCRB 4XDZA 4CNBA 4H15A 2GARA 3EJWA 1IXCA 3ZWMA 2EEZA 4AMUA 2OARA 2J9RA 1Z26A 4I1LA 3KP6A 4JIMA 1N2IA 4O2BF 3FHJA 4RKWA 5I4IA 3RD5A 1F1JA 2HTEA 2IHJA 3GZNA 1QS0B 1VL0A 4YQEA 4FXOA 3CMCO 4XKVA 4JL8A 3WC4A 3DB2A 5AOAA 1LUJB 2FKNA 3LSPA 3H1EA 1IG3A 2VVTA 2CVOA 1WCIA 1I3AA 4HXYA 4NNPA 4HZFA 3V4QA 5FADA 4WXMA 2FAXA 2P58A 4ZHQA 1C9YA 1P4JA 4KIWA 1T6ZA 1RYMA 1G4HA 2G0NA 1JIUA 5A3VA 3AH8A 1SVMA 5K51A 2Y1CA 1G8HA 4NMWA 4ZGGA 2EINH 5KOJA 1EX9A 3SE0A 4YC7A 4PBTA 1NTMK 1FQJA 2P68A 3GEPA 1PT7A 4CCAA 3AONB 5KPDA 3AL0C 1RYDA 4ZFNA 4BUZA 4M8NE 5IT4A 3UGTA 4DR1B 3ZXSA 2E5NA 5KVRA 3EF1A 4DZZA 4CEJB 4M6WB 2HPAA 4QODA 3HRUA 4NVRA 4U0WA 5A5EA 2AQ8A 4ITRC 2NPSD 4JR1A 2QL7A 2Y92A 1NVVR 1Y4AE 4YFKF 3PDCA 1RPWA 3NBMA 1DFIA 2IEAA 2Z5LA 4MUMA 2QW0X 2OCDA 2RB4A 1ZOLA 3DXFA 4H3KB 3BT7A 1P84I 1UMDB 3PNTA 4ZAWA 3LO8A 5LNK6 2UXXA 3I45A 2QYTA 4H7KA 5AOCA 2BTQB 4MN4C 2P7HA 2XMSA 3UV3A 2ZSIA 5NULA 3NBYC 3IAHA 1JFTA 1PV3A 3PFIA 5FEUA 3IDFA 2GSDA 3C18A 3TB6A 1ORWA 4GWKA 4M4SA 3CCMI 2B6HA 1EE1A 3DOUA 1MRZA 3TDNA 4YLYA 3FBGA 4YJDA 4M1KA 4MW9A 1R4NA 1TYCA 1Z4QA 1SUAA 4L22A 1OJ7A 5FO5A 3B7PA 3MWDB 2AE2A 2Z08A 2J5BA 3CJQA 4HAMA 2JGIA 3ZHXA 2FSGA 2J0UA 2F55A 1LPMA 2TCTA 2DN0A 3MBOA 4V0OA 1L5ZA 1NQWA 2IEKA 4A8JB 1CF2O 1A6QA 4UAJA 1G1AA 1AGPA 5E3MA 2LGJA 2ZTSA 2YV1A 4G12A 4D44A 3CX3A 4PICA 1LQ2A 1TKAA 5CBPA 1SQXK 2MCFA 2OILA 1XV5A 2I0FA 4YJ2F 4DR2B 5IP9J 2GAUA 3ZDFA 1NVDA 1XZPA 1OX3A 4R2LA 5HF6A 5TGDA 2DAPA 1M73E 1K7FB 2YV3A 2H57A 2IYTA 3C0KA 1S1MA 2WJJA 3PXXA 5APVA 3SYMA 5I45A 2OAGA 4EOGA 4EI9A 3VSEA 3WTUC 2ZMEA 3PQ2A 1IBLB 1M2VB 1KJIA 4A73A 1K88A 3S14J 3ZI4A 1UQUA 2E89A 5MFPA 4HAWA 3RUCA 4UHEA 2ZPTX 3GFFA 1YHZA 5IDVA 4R51A 2YWHA 2OP0A 2NLOA 1IAVA 5LUBA 3QHAA 3PRHA 4LIVA 1SCAA 4Y98A 2X40A 4PRLA 1E2QA 1ZIDA 2VQGA 2ZIVB 1BE0A 1A2KC 2HIHA 4F6LA 3OQ6A 4C88A 3H75A 1EGQA 3T54A 2G88A 1JM0A 1G42A 2HNKA 4EKNB 4DYRA 2XB9A 2PN1A 1FSZA 3NYQA 4MV3A 4ZVVA 4IHXA 4PAMA 1I7NA 4GUAA 3K6JA 2C00A 4L5BA 2WPSA 3FXAA 4JXZA 2GAFA 2M3BA 2WKPA 4ZXPA 2B30A 1HKHA 4HAVA 1L5MA 1W47A 1BCRA 4DOJA 1IGNA 2CW0F 3S1LA 4EJTA 4P4SB 3T35A 3FLAA 4XM2A 1JR4A 3QY0A 3RUIA 3V8LA 1B8OA 3Q11A 2X0EA 2EIJH 3TSOA 3SLKA 4MQ5A 4A3BJ 5AW6A 1C8LA 2G9VA 3JTGA 3IALA 1YS4A 1ODFA 1GQFA 5TEVA 3MJCA 4M6XA 4QTZA 2BFPA 3VBCA 3FI0A 5K0BA 2DY1A 4AT1A 2BF7A 1LDGA 4CR6A 2JJ7A 2FYUD 3EQZA 3O1JC 4N7RA 2BKUA 4AURA 4G1BA 3BRTB 5C7LO 2DOFA 2BBYA 1JE1A 2E76D 2PFSA 2ETHA 3FRJA 4NYIQ 4HJGH 1I3MA 4MIOA 4LS3A 1BVHA 4MEXF 4Y2PA 2YJNA 3ZWNA 5ARBA 4B7UA 2GF9A 2AN5A 5LQAA 3GFQA 4Y33A 3HOUJ 1GVHA 5FPTA 2B94A 4V2UA 4BUPA 4QICA 4RVCA 1UG2A 3G9UA 4QO8A 4O3FA 4XOIA 1TVMA 3AQIA 2V45A 3S16J 3V7WA 2VQSA 2W84A 1RJGA 3FMSA 3T15A 1AKWA 1DMRA 3P5BA 1PTJC 4NKRA 2HXOA 3ZMDA 4QPDA 1UQRA 3KYJB 2PKQO 3CVVA 2IELA 1VQPP 4LXUA 1ZVJA 1P3Y1 4X94A 4KDPA 1UBSB 2XYHA 2Q5IA 4DMHA 5H20A 4WRRA 3U7QA 3UATA 4BLOA 1E17A 5IW8A 4HBZA 1MUUA 3SR0A 4QOJA 2Z1NA 4D9CA 2R8EA 2PKCA 3ZU5A 2JJ1A 5U1PA 1NNLA 1R0WA 2XGGA 1VOTA 3FPFA 1PG2A 3NKVA 4OAZA 2EF1A 4ZQFA 4IUYA 1ZKMA 1P62B 3AEBC 1ZGHA 3H11B 3JWIA 5JW6A 4DRXB 2ME6A 1E7QA 2OA0A 3K1NA 2XROA 2IWHA 4J4HA 4P98A 3NASA 3UJ9A 3W3CA 2FRVA 1D9ZA 5L7WA 3IUPA 4GOLD 1X0VA 4UW9A 5ALLA 2JFHA 4TTSA 2PLFA 1S72P 2DMRA 4A26A 1FYXA 2PAJA 1U7UA 4D6TJ 4DB2A 3MKYB 2YVUA 4HYYA 4INOA 1VSTA 3HCDA 4JYAB 3K9TA 5JWOA 4BWFB 3DZFA 4XM0A 2JGEA 3MVPA 3MN2A 1HBJA 4BNTA 1JR6A 1OWAA 2KS1A 2A30A 3HZZA 1L0LE 3RFUA 2XDAA 2J30A 1QONA 2C5LA 2CLLB 2P40A 5EJ9A 3D70A 1RIIA 1AA9A 1Z2PX 3H6HA 2DKFA 3L7LA 4H1HA 5BPHA 2DWOA 1BKYA 4P0PB 2FK8A 5AXDA 2GN4A 4BO5A 1WXFA 1T3UA 2A14A 3SS9X 2Q3HA 3M70A 4MHTA 1NKZB 2VJ4A 2I1WA 1M1YB 1URQB 4XLTA 2R8BA 1U8AA 4R54A 4RXMA 1DKPA 1HYQA 1GUDA 2HD4A 2HIMA 2Q99A 3SQWA 1G0NA 2YFHA 3VAZA 3IOYA 3VPFA 1BW6A 1M54A 1C30A 2VWPA 2FPIB 3K8YA 4LFUA 2R6CA 1QIMA 1CJTC 4TWRA 2CLKB 3C6QA 5F3WB 3M5DA 5F5NA 4LDPA 5FL7A 4CMKA 2JVGA 1HW5A 4WEQA 1XYYA 2YHSA 2JCYA 4DTIA 1OF1A 2AVDA 2KMLA 1Z75A 1SU6A 3ZRGA 3FNFA 2Q5UA 4W1RA 2DPLA 1GL9B 1CLUA 4ND8A 1GV0A 1E6UA 5CB4B 3GJ5A 4ZHQF 4CVNA 2A1UA 4O2BB 3NEJA 3USCS 4AI6A 5A5DA 1Y8QA 4EBFA 2ZJZA 5CFLA 1AG9A 3MTIA 3IBYA 3FKQA 5L3QA 4Q5SF 2QDXA 1JHQA 1PZXA 2EFCB 3RYIA 4HX4A 3UXHA 2ID4A 3VR4H 3W4KA 4Y7NJ 2NACA 1D0SA 4KHZA 3HBAA 3WGLA 2HKIA 3SWWA 3I04A 2WT7A 3ZQIA 2A5DA 3CO0S 4D8WA 3A37A 3EPJA 3ZDYB 1VQ6P 1LNZA 2B5WA 1PJ8A 3W04A 1LPSA 1V2GA 4NIMA 3AF3A 1ODTC 1FBSA 2XUBA 4GLLA 3FISA 4EAAA 2ODBA 1JB1A 3FXLA 2PIDA 2IL1A 1OJLA 4DA9A 4PPFA 2MU1A 2DRIA 2AL7A 4XCXA 3EBOA 4NYJQ 3VJKA 4WERA 1KV4A 3BQMB 2XNXA 2OBPA 2QG9A 2QRPA 1E9EA 2ZG6A 3B6CA 2RBGA 4DA0A 2BGIA 1RBQA 2W98A 4UC0A 4YRTA 2W8BB 1BWSA 1L0OC 1GYPA 4JQCA 4DKJA 3MWMA 5JANA 3U7IA 3OTOB 4TV8F 4KQEA 1FP4A 1PJ3A 2VTKA 2GPJA 2RGAA 4UAGA 3HDQA 2JFVA 2IHZA 3RARA 4Z3DA 4EWLA 1P9RA 3RE1A 4NU8X 2PRIA 4RF3A 2Y99A 3U7EB 4QG7A 2UXNA 2W6QA 5JALA 3VC7A 1WMKA 2I3GA 4RIHA 1YL5A 1SQSA 1X1RA 3I5CA 2P9ZA 4BMYA 1GL7A 4NFHA 1DP4A 1ECGA 2DMNA 5A2QK 3QUSA 5E20A 1KO8A 4B3TB 2JFPA 1YR7A 4UBKA 3EWSA 1S72I 1C9NA 2VDNB 2YICA 2NMVA 1TZKA 3IJRA 2K85A 4AJ1A 2P2ZA 2EIMH 4KGXA 3ZMTA 2OORC 5IFKA 3HBLA 2VCEA 4HXFB 3IVAA 4YRSA 1Y8RB 5FPYA 1DMSA 1FTZA 2OXIA 3FCYA 3WYDA 3HU1A 4JOCA 2UV1A 1ULYA 1H1LB 1W5CE 1EGVB 4PLVA 4S05A 1ZW6A 3V2IA 3HUSA 1H6BA 1O95D 5L7TA 3KAJA 2EGUA 1OBVA 1K8YB 4TM7A 4BB5A 4YV0A 3LP5A 4BO1A 4DY6A 3MUDC 4ANJA 3ZNNA 1M2KA 3JSPA 1KTIA 4V1CB 4KLAA 2N9YB 3F2VA 4JBWA 1US8B 3HABA 4FFLA 1EA7A 3OYIA 2CD9A 4JI0B 4P5DA 5FB2A 5B37A 2W6BA 2IYNA 1N33B 2B1IA 5AXBA 5ECGC 1V3UA 4CLEA 2H6CA 2D5BA 3RFCA 1ZU4A 2F5VA 2HRRA 2H2GA 5JQGB 4FOSA 2COEA 5T41A 3AOEC 4G2TA 5I7VA 2Z9DA 1TQDA 2GCGA 2DT7B 4QG3A 4DMUB 3M34A 3HY3A 2FXPA 3FIJA 3IH2A 2Y71A 1DEBA 2R5YA 3BFJA 5KTKA 2JI8A 3W5VA 1Z6PA 1LK7A 4YFNF 1MF7A 3VHLB 1E7WA 4JLWA 1Z1DA 1EDKA 4DNOA 3CJRA 4DA4A 3ZE8A 2WV1A 4EO4A 2VOEA 3W3AH 3C87A 1ELOA 4BGDA 2X51A 2G9ZA 5JNSA 1ZN8A 1UP4A 4AYBN 1R5GA 1GADO 4RJTA 3ASNH 1QCZA 2WDPA 2IU4A 4V3BA 2WAAA 3DWEX 2OBXA 2WB1N 3PUIA 2F5DA 3FX0A 4IQ8A 5F7ZA 1MT0A 3C5VA 5J47A 1ZH0A 5H3CA 1ZNZA 4ZK6A 4ZO9A 2BTEA 4TL7A 4ND5A 1V35A 1CQWA 3MS4A 1EDZA 2HA7A 4Q9AA 1T5LA 4PLYA 1ZCBA 1TWAJ 4LISA 3A1UA 3NETA 3JRFA 2VBIA 4NAUA 1NVAA 3N8IA 3KE2A 2JJQA 3PDIA 4DPLA 4XRMA 1KSGA 1P8AA 3IVMA 2HOEA 4FIZA 4LE2A 3VKHA 4R1UA 3PJEA 4W63A 5KWIA 2O59A 1TWCJ 4TTQA 1RQVA 4IH1A 1D0IA 3WO1A 1ORTA 3FNHA 1N7GA 3B9RA 1M66A 4C0QC 4N48A 4PLTA 4J6FA 2CJJA 1FX1A 2QUAA 3TO7A 2FHSA 4EUNA 4V38A 1LU9A 4ZKPA 4OXYA 4XE5A 4X97A 2OGTA 3JCUH 2NAPA 3UB3A 5F0CA 1GNPA 3CJNA 1MX3A 5AIPA 1IPFA 4OQMA 1MQSA 4BMVA 1XZCA 2RVCA 1Y34E 4LYDA 2P9FA 2CXUA 4QTUB 2EJRA 3H3ZA 4DLXA 2BMJA 1EUCB 4UPDA 2DPYA 1ORKA 3B60A 3KZXA 4L5EA 4FASD 1ECJA 1TTPB 2UZAA 4YUYA 4WOKA 3HEMA 1W52X 3CUUA 2X5XA 1HNNA 1JHMA 4RQBA 4AUXA 2QHXA 4A8TA 3S70A 3IP4B 3TEFA 3GTGJ 3PYLA 4KE6A 3DDHA 3INRA 1MJGM 1JAXA 5GONB 5JC1A 5KTNA 1V5GA 4JXXA 4CKZA 2WLTA 3GLXA 3EXFB 2VASA 4F60A 2Q0QA 4IDBA 3D2BA 4BVFA 3FI9A 2IH4A 2O3QA 2Q6IA 2JD0A 3QUTA 4D9BA 2FJ0A 3RS0A 1A04A 1FFGA 4LHZA 1SUBA 5IK2A 3C74A 5H70A 4EKDA 3O2JA 5BW4A 1AK9A 3VJLA 2R6AA 5A7GA 1R7RA 3DE7X 5J2UF 1G6HA 4JA2A 2RKHA 3KYCB 1CRQA 2C2HA 1NBMA 1JXQA 1Z8FA 1Q0TA 1ZJZA 3KQKA 4GQAA 3NS7A 3ILSA 4IL6X 1MG0A 3THSA 2HDOA 5FTLA 1KP2A 5I7SA 3V9AA 2QY9A 4NPEA 4ABYA 3NHBA 1V0JA 1OR7A 1UFMA 3WWZA 3WGYA 1ZGJA 1OTYA 2R97A 1HBXG 1C4KA 1RSZA 3NV7A 1VSUA 1NRJB 3L04A 1PRYA 4GMGA 3LGSA 2VHWA 3EA0A 3CXHE 4FDVA 1P0CA 5F98A 3CUWA 5CVDA 1QRYA 1QZ3A 2FPIA 3I9JA 2ZBPA 4LGWA 2DFKB 1Z7EA 3SP1A 1A5TA 4PINA 5I7AA 4KFUA 4N9QA 4MQ4A 3UV7A 1OBFO 4RFLA 2Z3WA 3IH5A 3ICQB 3ECCA 3K4NA 2AZXA 5DX8A 4IZOA 3RIXA 2K4JA 2XU6A 2E5WA 3QFHA 1Y7IA 3AF0A 3SJBA 2B78A 1H5NA 5DZSA 5K8JB 2BUBA 2GNAA 5DBHX 3ET4A 4C7JA 3TN7A 3JVVA 5IRCD 4N78E 1TKCA 1VECA 1NOIA 4YRRA 4ITVA 2JGJA 4V19K 3P2YA 4I4IA 3F47A 3I5UA 3L71J 4LWPA 2QV7A 1QZZA 1SCUA 2VN8A 3TNUB 5DEQA 3SIWA 3OWTA 2JAUA 2LKDA 5IANA 3UHAA 1EK1A 4CG1A 1L2TA 2HFKA 2JUGA 3ABZA 4XUEA 1EUDA 2XDQA 3O3KA 1EFPA 3OQIA 2HWUA 1LWUC 1M1ZA 4MVJI 1GLVA 1IMOA 4FMCB 4NZ9A 2HQBA 4LSGA 3PFCA 2NVOA 1CDDA 5CJ4A 3K7EA 4EPYA 2VBCA 1SQBK 4YJGA 3H1CA 3BG6A 2ZQZA 4MQEA 4BNDA 4JT8A 4UMEA 2JJ8A 5FWAA 1CBUA 2EBFX 3WFZA 3DO5A 3Q6IA 3U5TA 2FW6A 4NMMA 3AZQA 4OHCA 5GTDA 3K32A 3AM5A 1OA1A 2MC4A 3UXYA 5JZVA 4X6LA 4LC9A 3RI4A 3AXTA 3QPUA 1VCIA 5IAAA 4CMHA 3AIMA 1DINA 2UZ1B 1X1BA 4ZZ0A 3TINA 5I8WA 5H2FC 1OCZH 1IMJA 3I53A 2N1TB 2YVAA 3KU4A 4JP8A 1T3ZA 1Y9ZA 1JDUA 3PHLA 4Z0PA 1V26A 5EJ4A 5JRJA 4OKSA 1YZKA 1XDDA 2C2OA 3QYPA 4MYTA 1GDDA 2EBIA 3LKZA 3ADPA 1XK7A 3T7AA 4KRFA 1R4AA 3GFPA 1FZQA 4QLCU 5HRCA 3K0LA 4LXYA 4MVJM 1LFBA 2GZ3A 1VYTA 3PHBE 1MC5A 4CDRA 3VNQA 4BV3A 4FPXA 5FFNA 1D1SA 2ZXXA 1SXIA 1GZLA 1NTME 1V25A 3BTOA 4B4CA 2BFMA 3GUDA 3F3MA 2JEEA 4OB7A 1U3TA 3M33A 1LBSA 1D6MA 4YAGA 4YRKA 4O2BA 3K0KA 5KKZC 3RK3C 5AJZA 4BRUA 1PIWA 2O1SA 3AEQB 2H1IA 1PYVA 4QEDA 3B38A 2XOKA 1KI2A 3ZGYA 1SXQA 1W5FA 2UU9B 3C3BA 4PNPA 2D8AA 4MDEA 3TIVA 3MHTA 1IRXA 2ZBEA 3GO5A 1XSDA 4GG1A 2P4EA 2GIZA 5K5EA 1QGYA 3QYAA 4QE3A 4FEYA 5AJXA 4ZQCB 4UE2A 3AVQA 2CE7A 3ZY3A 2CHQA 2A45I 1ZRDA 4C4OA 4LC0A 4CKEB 4ZDWA 2QZPA 2FWPA 2HQ1A 4LK2A 4IHQA 4TKUA 1JVNA 3UWOA 3CMMA 2ZT5A 4CV2A 3EG9B 3RVOA 3O8QB 1JIVA 4JMLA 4MVWA 3QP6A 5B30A 3VPGA 5E3HA 3V4SA 3I2YX 2ECQA 3DONA 3D4BA 1H0RA 3UWKA 4KAXA 4H60A 5J8CA 1GQSA 5LA6F 5HDBB 5H2FE 4ZO4A 3RU9A 1CETA 3D6AA 4ESBA 3ZKWB 4XYMA 1W7PA 1TUBB 4DUPA 4JU8A 4NQWB 4TQAA 1P7CA 5EEAA 3IAXA 2HJ9A