1CAKA

Structural analysis of the zinc hydroxide-thr 199-glu 106 hydrogen bonding network in human carbonic anhydrase ii
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
Knots found
sequence length
258
structure length
258
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSQHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONIC ANHYDRASE II
publication title Structural analysis of the zinc hydroxide-Thr-199-Glu-106 hydrogen-bond network in human carbonic anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase(oxo-acid)
total genus 75
structure length 258
sequence length 258
other databases KnotProt 2.0: K +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1992-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1cakA00
3V3HB 4TWLA 2GD8A 4Q7PA 4QIZA 4QJPA 4PYYA 1ZSCA 4Q99A 3V2MA 1HEAA 3JXHC 3DC3A 2NXRA 4M2WA 3U47A 2CBAA 1FQRA 3D92A 2CBBA 5EKJA 4YGLA 1IF8A 3RYYA 1Z93A 1THKA 1HUGA 4PQ7A 1KOPA 1BNMA 3P3HA 3RYVB 1RZCA 1G0EA 1OKNA 3HFPA 3Q31A 4YWPA 1G54A 1EOUA 1HCBA 4FPTA 3OKVA 1XPZA 3EFIA 3P5AA 4E4AA 3KWAA 2NXTA 4YGFA 5AMGA 2ZNCA 3KIGA 1CVEA 3S97A 1AM6A 1CVCA 2POUA 3OIKA 5JDVB 4QK2A 2FNMA 1IF4A 4Q90A 4JSAA 3RGEA 4BF6A 2CBEA 2W2JA 4Q9YA 4HT0A 3SBHA 1FSQA 4RFDA 3OY0A 5FLPA 4G7AA 2WD2A 3JXFA 3FW3A 4Q6EA 3U7CA 4JSWA 5E28A 1HECA 1HEDA 3U45X 1ZGFA 3S9TA 3P3JA 4CNVA 3M5TA 1CNCA 3V3FA 5EH5A 4YHAA 3N4BA 3T5ZA 3T5UA 1RZDA 4Q08A 1UGCA 2CBDA 4K1QA 2ABEA 4WW6A 1RZEA 4FVOA 4YXOA 1YDDA 1G4OA 3S77B 3DVBA 5EHVA 3NI5A 1I9QA 5CACA 3KKXA 3OYQA 5JGSB 3T82A 5E2SA 5FLRA 1YO1A 3LXEA 4KNNA 3M2XA 5DSMA 3SAXA 2NN7A 4YGKA 3R16A 1G4JA 5DSOA 4QSJA 3CYUA 1CNGA 2HL4A 4Q87A 1TH9A 5E5RA 4MDMA 3V7XA 5L3OA 5DVXA 5JG3B 1ZFKA 3MHMA 4BCWA 3TVOX 4WUQA 4E9OX 3IBLA 2VVAX 1RJ5A 1YO0A 2FOQA 3F8EA 4L5VA 5FL5A 2NNSA 3DAZA 1CAZA 1BICA 2CA2A 4PYXA 5FNJA 4MLTA 1BNWA 5SZ0A 5BRVA 2NNOA 1FSRA 3V5GA 4QK3A 5SZ4A 3RG4A 3CAJA 2POWA 1CILA 1V9IC 4K0ZA 3M1JA 4R5BA 3RZ8A 5DSNA 1BNTA 1TEQX 2WEJA 2NMXA 1RJ6A 4HBAA 2H4NA 3P58A 3KNEA 5DSPA 4BF1A 1BN3A 4Q7WA 1UGGA 2WD3A 3TMJA 5EHEA 5SZ1A 3V2JA 1G45A 3N2PA 1I9PA 3NJ9A 1CANA 2EZ7A 1Z97A 4QJ0A 1CA3A 4XE1A 1I9NA 4MDLA 2ILIA 1Y7WA 1KEQA 4K0SA 3UYQA 3CA2A 5FNGA 3M1KA 4E3HA 4XZ5A 5EKHA 5C8IA 1T9NA 3KLDB 1JCZA 1I9MA 1BNVA 3RJ7A 3HKNA 4HT2A 4KP8A 3OKUA 4Z1NA 5FLOA 5G0CA 1FSNA 4WW8A 1CCSA 4K0TA 4FU5A 5JGTB 3M96A 1TB0X 4YGJA 1CINA 4QJXA 3R17B 4ZWIA 1BNUA 4RUYA 4R59A 3RZ0B 4XIWA 3HKQA 3F4XA 2FW4A 1I91A 1XEGA 3FFPX 3DD0A 3P4VA 4PZHA 5EIJA 4YXUA 1RAYA 5E2NA 1TG9A 8CA2A 1CALA 2H15A 5G0BA 1IF6A 4WR7A 5JEPB 3T83A 1LZVA 3IAIA 2HNCA 4LP6A 3MDZA 1DCAA 3IBNA 4TWMA 3K7KA 4CQ0A 4CACA 5A25A 2F14A 4FL7A 4LU3A 4DZ7A 4M2VA 4IDRX 5CLUA 4HEWA 3DCSA 4Q7SA 4K13A 2FMGA 4Q09A 4KUYA 1OQ5A 3OYSA 4KV0A 5FL6A 5JEGB 4Q06A 1CRAA 4ILXA 1FQNA 1G48A 3DVCA 4KNJA 4GL1X 1OKMA 4QJWA 1DCBA 1CVAA 3V3JA 4QEFA 1HUHA 3P44A 4JSZA 1RZAA 4MDGA 3PJJA 2FOYA 4L5UA 3DA2A 3HLJA 4PXXA 5JG5B 5JQ0A 1G3ZA 1TG3A 3M40A 1CRMA 3JXGA 4FIKA 1V9EA 5A6HA 1JD0A 1URTA 4E5QA 4YVYA 5DOGA 3DC9A 1CNYA 1I9LA 2X7UA 4FRCA 4Q8XA 4QJMA 3MNUA 4Q7VA 4WUPA 1MUAA 1FQLA 1CCTA 5E2MA 3CZVA 4ETQC 3ML5A 4YX4A 1UGAA 3MHIA 3S75B 3FE4A 4JSSA 4E3DA 4KUWA 5FLQA 12CAA 1BNQA 3RYXB 1CAKA 4ZX1A 4UOVA 4RFCA 1UGEA 5FDIA 3V3IB 1CAOA 3M98A 4Y0JA 1FR7A 1AZMA 3M1WA 3DBUA 4ITPA 1HCAA 4RIUA 6CA2A 1Z9YA 5FL4A 5BYIA 1G52A 4FVNA 3IBUA 4MTYA 5EH7A 4N0XB 1G1DA 3PYKA 3N3JA 3RZ5A 2NWPA 2Q1QA 4ZWXA 1CAMA 5FNLA 1CAHA 1JV0A 4QSBA 3DD8A 4QY3A 3W6HA 2Q1BA 1I9OA 3OILA 4KAPA 4Q81A 3UYNA 3F7UA 1CVDA 1KOQA 3IBIA 5BRUA 1H9NA 3HKTA 2CBCA 5CJFA 2IT4A 3S71B 2NXSA 4ITOA 1IF5A 2QOAA 3K2FA 1MOOA 1YDAA 3K34A 3U3AX 5BNLA 1BV3A 3MNHA 2WEGA 4RUZA 5SZ3A 4XFWA 4RN4A 1CAJA 1J9WA 4C3TA 3D9ZA 5DSRA 3S74B 3RG3A 1BN4A 5FNHA 3M04A 2EU3A 3VBDA 1ZNCA 3OIMA 4KNMA 1TBTX 4E3GA 5DSKA 1LUGA 1CNXA 2FOVA 4Q83A 5EOIA 1I8ZA 3MNKA 5JESB 2HFWA 4Z0QA 3M2YA 3RZ7A 1YDBA 2FOSA 3HS4A 3RLDA 1BNNA 1G6VA 7CA2A 4X5SA 2AX2A 5DSLA 3DCCA 3L14A 4ZX0A 1FQMA 3GZ0A 4RUXA 5DRSA 5J8ZA 1RAZA 5FNKA 2CABA 4CNWA 3IEOA 1YO2A 2NNGA 3M2ZA 5L6KA 2WEHA 5SZ2A 5CA2A 1BN1A 4Q07A 1CNBA 4E49A 5JEHB 3B1BA 2FNKA 4Z1JA 1LG6A 4R5AA 3MNIA 1CNKA 5AMLA 3ZNCA 4JS6A 4RIVA 3V3GB 4COQA 2OSFA 1CAYA 1LGDA 1A42A 1BCDA 3EFTA 1ZFQA 3MHOA 4Q8ZA 2NWYA 2HKKA 3D93A 5FNMA 4CNXA 2QP6A 1CNHA 2X7SA 2FMZA 4YYTA 3T85A 1TTMA 2QO8A 4ZAOA 4QTLA 4KP5A 3ZP9A 5FLSA 2AW1A 3KONA 1H9QA 3NB5A 3PO6A 2HD6A 4KNIA 2NN1A 3QYKA 4ZWYA 1G46A 4ZWZA 1ZGEA 1UGBA 5EZTX 1F2WA 1FR4A 4RH2A 3ML2A 5IPZA 1RZBA 3KOIA 4XIXA 5DSQA 1I90A 4Q8YA 4YXIA 4M2UA 3RYJB 5FLTA 3HKUA 3MHLA 3M1QA 3IGPA 5LMDA 3TVNX 3D8WA 4M2RA 2NNVA 1CNJA 4N16A 5BRWA 1ZSAA 3S73B 1DMXA 3N0NA 5FNIA 2NWZA 2OSMA 3D0NA 4IWZA 5SZ5A 4HEYA 1IF9A 4DZ9A 3MZCA 1CA2A 2FNNA 3MYQA 3BL1A 1IF7A 5SZ7A 1CVFA 3M14A 2FOUA 2Q38A 3M5EA 2WEOA 5DOHA 1H4NA 3B4FA 3KS3A 5JQTA 4Z1EA 5SZ6A 1CZMA 1XEVA 2O4ZA 3DV7A 3M5SA 4HEZA 1FLJA 1UGDA 3BETA 4Q0LA 1ZSBA 2EU2A 9CA2A 2POVA 4HU1A 1KWQA 5DSIA 3M3XA 3DVDA 5EKMA 4E3FA 3RZ1B 4HF3A 4G0CA 4QJOA 1CVHA 5E5UA 4MLXA 4LHIA 3MWOA 1G53A 4WL4A 3MHCA 3KOKA 3S72B 4QSAA 4Q6DA 1HVAA 5AMDA 3S78B 2HOCA 4CNRA 3P55A 4Q49A 5DSJA 1TE3X 3BL0A 3F7BA 5EHWA 4QK1A 1CIMA 4YGNA 3MNAA 5G01A 2GEHA 3S76A 4CA2A 4Q78A 3S8XA 1BZMA 1CAIA 1CNIA 1ZE8A 4Z1KA 5E2KA 1CCUA 1AVNA 3M67A 5E2RA 3W6IA 1G0FA 2NWOA 1DMYA 3RYZA 3SBIA 1UGFA 1CNWA 1XQ0A 1TEUX 5FDCA 5HPJA 1HEBA 3DCWA 4KUVA 1KWRA 5EH8A 1LG5A 3MMFA 3C7PA 1OKLA 3P5LA 4QIYA 4QSIA 3MNJA 3T84A 3M2NA 2X7TA 2VVBX 5G03A 4MO8A 4L5WA 1ZH9A 3SAPA 1CVBA 1YDCA
chains in the Genus database with same CATH superfamily
3V3HB 4TWLA 2GD8A 4Q7PA 4QIZA 4QJPA 4PYYA 1ZSCA 4Q99A 3V2MA 1HEAA 3JXHC 3DC3A 2NXRA 4M2WA 3U47A 2CBAA 1FQRA 3D92A 2CBBA 5EKJA 4YGLA 1IF8A 3RYYA 1Z93A 1THKA 1HUGA 4PQ7A 1KOPA 1BNMA 3P3HA 3RYVB 1RZCA 1G0EA 1OKNA 3HFPA 3Q31A 4YWPA 1G54A 1EOUA 1HCBA 4FPTA 3OKVA 1XPZA 3EFIA 3P5AA 4E4AA 3KWAA 2NXTA 4YGFA 5AMGA 2ZNCA 3KIGA 1CVEA 3S97A 1AM6A 1CVCA 2POUA 3OIKA 5JDVB 4QK2A 2FNMA 1IF4A 4Q90A 4JSAA 3RGEA 4BF6A 2CBEA 2W2JA 4Q9YA 4HT0A 3SBHA 1FSQA 4RFDA 3OY0A 5FLPA 4G7AA 2WD2A 3JXFA 3FW3A 4Q6EA 3U7CA 4JSWA 5E28A 1HECA 1HEDA 3U45X 1ZGFA 3S9TA 3P3JA 4CNVA 3M5TA 1CNCA 3V3FA 5EH5A 4YHAA 3N4BA 3T5ZA 3T5UA 1RZDA 4Q08A 1UGCA 2CBDA 4K1QA 2ABEA 4WW6A 1RZEA 4FVOA 4YXOA 1YDDA 1G4OA 3S77B 3DVBA 5EHVA 3NI5A 1I9QA 5CACA 3KKXA 3OYQA 5JGSB 3T82A 5E2SA 5FLRA 1YO1A 3LXEA 4KNNA 3M2XA 5DSMA 3SAXA 2NN7A 4YGKA 3R16A 1G4JA 5DSOA 4QSJA 3CYUA 1CNGA 2HL4A 4Q87A 1TH9A 5E5RA 4MDMA 3V7XA 5L3OA 5DVXA 5JG3B 1ZFKA 3MHMA 4BCWA 3TVOX 4WUQA 4E9OX 3IBLA 2VVAX 1RJ5A 1YO0A 2FOQA 3F8EA 4L5VA 5FL5A 2NNSA 3DAZA 1CAZA 1BICA 2CA2A 4PYXA 5FNJA 4MLTA 1BNWA 5SZ0A 5BRVA 2NNOA 1FSRA 3V5GA 4QK3A 5SZ4A 3RG4A 3CAJA 2POWA 1CILA 1V9IC 4K0ZA 3M1JA 4R5BA 3RZ8A 5DSNA 1BNTA 1TEQX 2WEJA 2NMXA 1RJ6A 4HBAA 2H4NA 3P58A 3KNEA 5DSPA 4BF1A 1BN3A 4Q7WA 1UGGA 2WD3A 3TMJA 5EHEA 5SZ1A 3V2JA 1G45A 3N2PA 1I9PA 3NJ9A 1CANA 2EZ7A 1Z97A 4QJ0A 1CA3A 4XE1A 1I9NA 4MDLA 2ILIA 1Y7WA 1KEQA 4K0SA 3UYQA 3CA2A 5FNGA 3M1KA 4E3HA 4XZ5A 5EKHA 5C8IA 1T9NA 3KLDB 1JCZA 1I9MA 1BNVA 3RJ7A 3HKNA 4HT2A 4KP8A 3OKUA 4Z1NA 5FLOA 5G0CA 1FSNA 4WW8A 1CCSA 4K0TA 4FU5A 5JGTB 3M96A 1TB0X 4YGJA 1CINA 4QJXA 3R17B 4ZWIA 1BNUA 4RUYA 4R59A 3RZ0B 4XIWA 3HKQA 3F4XA 2FW4A 1I91A 1XEGA 3FFPX 3DD0A 3P4VA 4PZHA 5EIJA 4YXUA 1RAYA 5E2NA 1TG9A 8CA2A 1CALA 2H15A 5G0BA 1IF6A 4WR7A 5JEPB 3T83A 1LZVA 3IAIA 2HNCA 4LP6A 3MDZA 1DCAA 3IBNA 4TWMA 3K7KA 4CQ0A 4CACA 5A25A 2F14A 4FL7A 4LU3A 4DZ7A 4M2VA 4IDRX 5CLUA 4HEWA 3DCSA 4Q7SA 4K13A 2FMGA 4Q09A 4KUYA 1OQ5A 3OYSA 4KV0A 5FL6A 5JEGB 4Q06A 1CRAA 4ILXA 1FQNA 1G48A 3DVCA 4KNJA 4GL1X 1OKMA 4QJWA 1DCBA 1CVAA 3V3JA 4QEFA 1HUHA 3P44A 4JSZA 1RZAA 4MDGA 3PJJA 2FOYA 4L5UA 3DA2A 3HLJA 4PXXA 5JG5B 5JQ0A 1G3ZA 1TG3A 3M40A 1CRMA 3JXGA 4FIKA 1V9EA 5A6HA 1JD0A 1URTA 4E5QA 4YVYA 5DOGA 3DC9A 1CNYA 1I9LA 2X7UA 4FRCA 4Q8XA 4QJMA 3MNUA 4Q7VA 4WUPA 1MUAA 1FQLA 1CCTA 5E2MA 3CZVA 4ETQC 3ML5A 4YX4A 1UGAA 3MHIA 3S75B 3FE4A 4JSSA 4E3DA 4KUWA 5FLQA 12CAA 1BNQA 3RYXB 1CAKA 4ZX1A 4UOVA 4RFCA 1UGEA 5FDIA 3V3IB 1CAOA 3M98A 4Y0JA 1FR7A 1AZMA 3M1WA 3DBUA 4ITPA 1HCAA 4RIUA 6CA2A 1Z9YA 5FL4A 5BYIA 1G52A 4FVNA 3IBUA 4MTYA 5EH7A 4N0XB 1G1DA 3PYKA 3N3JA 3RZ5A 2NWPA 2Q1QA 4ZWXA 1CAMA 5FNLA 1CAHA 1JV0A 4QSBA 3DD8A 4QY3A 3W6HA 2Q1BA 1I9OA 3OILA 4KAPA 4Q81A 3UYNA 3F7UA 1CVDA 1KOQA 3IBIA 5BRUA 1H9NA 3HKTA 2CBCA 5CJFA 2IT4A 3S71B 2NXSA 4ITOA 1IF5A 2QOAA 3K2FA 1MOOA 1YDAA 3K34A 3U3AX 5BNLA 1BV3A 3MNHA 2WEGA 4RUZA 5SZ3A 4XFWA 4RN4A 1CAJA 1J9WA 4C3TA 3D9ZA 5DSRA 3S74B 3RG3A 1BN4A 5FNHA 3M04A 2EU3A 3VBDA 1ZNCA 3OIMA 4KNMA 1TBTX 4E3GA 5DSKA 1LUGA 1CNXA 2FOVA 4Q83A 5EOIA 1I8ZA 3MNKA 5JESB 2HFWA 4Z0QA 3M2YA 3RZ7A 1YDBA 2FOSA 3HS4A 3RLDA 1BNNA 1G6VA 7CA2A 4X5SA 2AX2A 5DSLA 3DCCA 3L14A 4ZX0A 1FQMA 3GZ0A 4RUXA 5DRSA 5J8ZA 1RAZA 5FNKA 2CABA 4CNWA 3IEOA 1YO2A 2NNGA 3M2ZA 5L6KA 2WEHA 5SZ2A 5CA2A 1BN1A 4Q07A 1CNBA 4E49A 5JEHB 3B1BA 2FNKA 4Z1JA 1LG6A 4R5AA 3MNIA 1CNKA 5AMLA 3ZNCA 4JS6A 4RIVA 3V3GB 4COQA 2OSFA 1CAYA 1LGDA 1A42A 1BCDA 3EFTA 1ZFQA 3MHOA 4Q8ZA 2NWYA 2HKKA 3D93A 5FNMA 4CNXA 2QP6A 1CNHA 2X7SA 2FMZA 4YYTA 3T85A 1TTMA 2QO8A 4ZAOA 4QTLA 4KP5A 3ZP9A 5FLSA 2AW1A 3KONA 1H9QA 3NB5A 3PO6A 2HD6A 4KNIA 2NN1A 3QYKA 4ZWYA 1G46A 4ZWZA 1ZGEA 1UGBA 5EZTX 1F2WA 1FR4A 4RH2A 3ML2A 5IPZA 1RZBA 3KOIA 4XIXA 5DSQA 1I90A 4Q8YA 4YXIA 4M2UA 3RYJB 5FLTA 3HKUA 3MHLA 3M1QA 3IGPA 5LMDA 3TVNX 3D8WA 4M2RA 2NNVA 1CNJA 4N16A 5BRWA 1ZSAA 3S73B 1DMXA 3N0NA 5FNIA 2NWZA 2OSMA 3D0NA 4IWZA 5SZ5A 4HEYA 1IF9A 4DZ9A 3MZCA 1CA2A 2FNNA 3MYQA 3BL1A 1IF7A 5SZ7A 1CVFA 3M14A 2FOUA 2Q38A 3M5EA 2WEOA 5DOHA 1H4NA 3B4FA 3KS3A 5JQTA 4Z1EA 5SZ6A 1CZMA 1XEVA 2O4ZA 3DV7A 3M5SA 4HEZA 1FLJA 1UGDA 3BETA 4Q0LA 1ZSBA 2EU2A 9CA2A 2POVA 4HU1A 1KWQA 5DSIA 3M3XA 3DVDA 5EKMA 4E3FA 3RZ1B 4HF3A 4G0CA 4QJOA 1CVHA 5E5UA 4MLXA 4LHIA 3MWOA 1G53A 4WL4A 3MHCA 3KOKA 3S72B 4QSAA 4Q6DA 1HVAA 5AMDA 3S78B 2HOCA 4CNRA 3P55A 4Q49A 5DSJA 1TE3X 3BL0A 3F7BA 5EHWA 4QK1A 1CIMA 4YGNA 3MNAA 5G01A 2GEHA 3S76A 4CA2A 4Q78A 3S8XA 1BZMA 1CAIA 1CNIA 1ZE8A 4Z1KA 5E2KA 1CCUA 1AVNA 3M67A 5E2RA 3W6IA 1G0FA 2NWOA 1DMYA 3RYZA 3SBIA 1UGFA 1CNWA 1XQ0A 1TEUX 5FDCA 5HPJA 1HEBA 3DCWA 4KUVA 1KWRA 5EH8A 1LG5A 3MMFA 3C7PA 1OKLA 3P5LA 4QIYA 4QSIA 3MNJA 3T84A 3M2NA 2X7TA 2VVBX 5G03A 4MO8A 4L5WA 1ZH9A 3SAPA 1CVBA 1YDCA
chains in the Genus database with same CATH topology
3V3HB 4TWLA 2GD8A 4Q7PA 4QIZA 4QJPA 4PYYA 1ZSCA 4Q99A 3V2MA 1HEAA 3JXHC 3DC3A 2NXRA 4M2WA 3U47A 2CBAA 1FQRA 3D92A 2CBBA 5EKJA 4YGLA 1IF8A 3RYYA 1Z93A 1THKA 1HUGA 4PQ7A 1KOPA 1BNMA 3P3HA 3RYVB 1RZCA 1G0EA 1OKNA 3HFPA 3Q31A 4YWPA 1G54A 1EOUA 1HCBA 4FPTA 3OKVA 1XPZA 3EFIA 3P5AA 4E4AA 3KWAA 2NXTA 4YGFA 5AMGA 2ZNCA 3KIGA 1CVEA 3S97A 1AM6A 1CVCA 2POUA 3OIKA 5JDVB 4QK2A 2FNMA 1IF4A 4Q90A 4JSAA 3RGEA 4BF6A 2CBEA 2W2JA 4Q9YA 4HT0A 3SBHA 1FSQA 4RFDA 3OY0A 5FLPA 4G7AA 2WD2A 3JXFA 3FW3A 4Q6EA 3U7CA 4JSWA 5E28A 1HECA 1HEDA 3U45X 1ZGFA 3S9TA 3P3JA 4CNVA 3M5TA 1CNCA 3V3FA 5EH5A 4YHAA 3N4BA 3T5ZA 3T5UA 1RZDA 4Q08A 1UGCA 2CBDA 4K1QA 2ABEA 4WW6A 1RZEA 4FVOA 4YXOA 1YDDA 1G4OA 3S77B 3DVBA 5EHVA 3NI5A 1I9QA 5CACA 3KKXA 3OYQA 5JGSB 3T82A 5E2SA 5FLRA 1YO1A 3LXEA 4KNNA 3M2XA 5DSMA 3SAXA 2NN7A 4YGKA 3R16A 1G4JA 5DSOA 4QSJA 3CYUA 1CNGA 2HL4A 4Q87A 1TH9A 5E5RA 4MDMA 3V7XA 5L3OA 5DVXA 5JG3B 1ZFKA 3MHMA 4BCWA 3TVOX 4WUQA 4E9OX 3IBLA 2VVAX 1RJ5A 1YO0A 2FOQA 3F8EA 4L5VA 5FL5A 2NNSA 3DAZA 1CAZA 1BICA 2CA2A 4PYXA 5FNJA 4MLTA 1BNWA 5SZ0A 5BRVA 2NNOA 1FSRA 3V5GA 4QK3A 5SZ4A 3RG4A 3CAJA 2POWA 1CILA 1V9IC 4K0ZA 3M1JA 4R5BA 3RZ8A 5DSNA 1BNTA 1TEQX 2WEJA 2NMXA 1RJ6A 4HBAA 2H4NA 3P58A 3KNEA 5DSPA 4BF1A 1BN3A 4Q7WA 1UGGA 2WD3A 3TMJA 5EHEA 5SZ1A 3V2JA 1G45A 3N2PA 1I9PA 3NJ9A 1CANA 2EZ7A 1Z97A 4QJ0A 1CA3A 4XE1A 1I9NA 4MDLA 2ILIA 1Y7WA 1KEQA 4K0SA 3UYQA 3CA2A 5FNGA 3M1KA 4E3HA 4XZ5A 5EKHA 5C8IA 1T9NA 3KLDB 1JCZA 1I9MA 1BNVA 3RJ7A 3HKNA 4HT2A 4KP8A 3OKUA 4Z1NA 5FLOA 5G0CA 1FSNA 4WW8A 1CCSA 4K0TA 4FU5A 5JGTB 3M96A 1TB0X 4YGJA 1CINA 4QJXA 3R17B 4ZWIA 1BNUA 4RUYA 4R59A 3RZ0B 4XIWA 3HKQA 3F4XA 2FW4A 1I91A 1XEGA 3FFPX 3DD0A 3P4VA 4PZHA 5EIJA 4YXUA 1RAYA 5E2NA 1TG9A 8CA2A 1CALA 2H15A 5G0BA 1IF6A 4WR7A 5JEPB 3T83A 1LZVA 3IAIA 2HNCA 4LP6A 3MDZA 1DCAA 3IBNA 4TWMA 3K7KA 4CQ0A 4CACA 5A25A 2F14A 4FL7A 4LU3A 4DZ7A 4M2VA 4IDRX 5CLUA 4HEWA 3DCSA 4Q7SA 4K13A 2FMGA 4Q09A 4KUYA 1OQ5A 3OYSA 4KV0A 5FL6A 5JEGB 4Q06A 1CRAA 4ILXA 1FQNA 1G48A 3DVCA 4KNJA 4GL1X 1OKMA 4QJWA 1DCBA 1CVAA 3V3JA 4QEFA 1HUHA 3P44A 4JSZA 1RZAA 4MDGA 3PJJA 2FOYA 4L5UA 3DA2A 3HLJA 4PXXA 5JG5B 5JQ0A 1G3ZA 1TG3A 3M40A 1CRMA 3JXGA 4FIKA 1V9EA 5A6HA 1JD0A 1URTA 4E5QA 4YVYA 5DOGA 3DC9A 1CNYA 1I9LA 2X7UA 4FRCA 4Q8XA 4QJMA 3MNUA 4Q7VA 4WUPA 1MUAA 1FQLA 1CCTA 5E2MA 3CZVA 4ETQC 3ML5A 4YX4A 1UGAA 3MHIA 3S75B 3FE4A 4JSSA 4E3DA 4KUWA 5FLQA 12CAA 1BNQA 3RYXB 1CAKA 4ZX1A 4UOVA 4RFCA 1UGEA 5FDIA 3V3IB 1CAOA 3M98A 4Y0JA 1FR7A 1AZMA 3M1WA 3DBUA 4ITPA 1HCAA 4RIUA 6CA2A 1Z9YA 5FL4A 5BYIA 1G52A 4FVNA 3IBUA 4MTYA 5EH7A 4N0XB 1G1DA 3PYKA 3N3JA 3RZ5A 2NWPA 2Q1QA 4ZWXA 1CAMA 5FNLA 1CAHA 1JV0A 4QSBA 3DD8A 4QY3A 3W6HA 2Q1BA 1I9OA 3OILA 4KAPA 4Q81A 3UYNA 3F7UA 1CVDA 1KOQA 3IBIA 5BRUA 1H9NA 3HKTA 2CBCA 5CJFA 2IT4A 3S71B 2NXSA 4ITOA 1IF5A 2QOAA 3K2FA 1MOOA 1YDAA 3K34A 3U3AX 5BNLA 1BV3A 3MNHA 2WEGA 4RUZA 5SZ3A 4XFWA 4RN4A 1CAJA 1J9WA 4C3TA 3D9ZA 5DSRA 3S74B 3RG3A 1BN4A 5FNHA 3M04A 2EU3A 3VBDA 1ZNCA 3OIMA 4KNMA 1TBTX 4E3GA 5DSKA 1LUGA 1CNXA 2FOVA 4Q83A 5EOIA 1I8ZA 3MNKA 5JESB 2HFWA 4Z0QA 3M2YA 3RZ7A 1YDBA 2FOSA 3HS4A 3RLDA 1BNNA 1G6VA 7CA2A 4X5SA 2AX2A 5DSLA 3DCCA 3L14A 4ZX0A 1FQMA 3GZ0A 4RUXA 5DRSA 5J8ZA 1RAZA 5FNKA 2CABA 4CNWA 3IEOA 1YO2A 2NNGA 3M2ZA 5L6KA 2WEHA 5SZ2A 5CA2A 1BN1A 4Q07A 1CNBA 4E49A 5JEHB 3B1BA 2FNKA 4Z1JA 1LG6A 4R5AA 3MNIA 1CNKA 5AMLA 3ZNCA 4JS6A 4RIVA 3V3GB 4COQA 2OSFA 1CAYA 1LGDA 1A42A 1BCDA 3EFTA 1ZFQA 3MHOA 4Q8ZA 2NWYA 2HKKA 3D93A 5FNMA 4CNXA 2QP6A 1CNHA 2X7SA 2FMZA 4YYTA 3T85A 1TTMA 2QO8A 4ZAOA 4QTLA 4KP5A 3ZP9A 5FLSA 2AW1A 3KONA 1H9QA 3NB5A 3PO6A 2HD6A 4KNIA 2NN1A 3QYKA 4ZWYA 1G46A 4ZWZA 1ZGEA 1UGBA 5EZTX 1F2WA 1FR4A 4RH2A 3ML2A 5IPZA 1RZBA 3KOIA 4XIXA 5DSQA 1I90A 4Q8YA 4YXIA 4M2UA 3RYJB 5FLTA 3HKUA 3MHLA 3M1QA 3IGPA 5LMDA 3TVNX 3D8WA 4M2RA 2NNVA 1CNJA 4N16A 5BRWA 1ZSAA 3S73B 1DMXA 3N0NA 5FNIA 2NWZA 2OSMA 3D0NA 4IWZA 5SZ5A 4HEYA 1IF9A 4DZ9A 3MZCA 1CA2A 2FNNA 3MYQA 3BL1A 1IF7A 5SZ7A 1CVFA 3M14A 2FOUA 2Q38A 3M5EA 2WEOA 5DOHA 1H4NA 3B4FA 3KS3A 5JQTA 4Z1EA 5SZ6A 1CZMA 1XEVA 2O4ZA 3DV7A 3M5SA 4HEZA 1FLJA 1UGDA 3BETA 4Q0LA 1ZSBA 2EU2A 9CA2A 2POVA 4HU1A 1KWQA 5DSIA 3M3XA 3DVDA 5EKMA 4E3FA 3RZ1B 4HF3A 4G0CA 4QJOA 1CVHA 5E5UA 4MLXA 4LHIA 3MWOA 1G53A 4WL4A 3MHCA 3KOKA 3S72B 4QSAA 4Q6DA 1HVAA 5AMDA 3S78B 2HOCA 4CNRA 3P55A 4Q49A 5DSJA 1TE3X 3BL0A 3F7BA 5EHWA 4QK1A 1CIMA 4YGNA 3MNAA 5G01A 2GEHA 3S76A 4CA2A 4Q78A 3S8XA 1BZMA 1CAIA 1CNIA 1ZE8A 4Z1KA 5E2KA 1CCUA 1AVNA 3M67A 5E2RA 3W6IA 1G0FA 2NWOA 1DMYA 3RYZA 3SBIA 1UGFA 1CNWA 1XQ0A 1TEUX 5FDCA 5HPJA 1HEBA 3DCWA 4KUVA 1KWRA 5EH8A 1LG5A 3MMFA 3C7PA 1OKLA 3P5LA 4QIYA 4QSIA 3MNJA 3T84A 3M2NA 2X7TA 2VVBX 5G03A 4MO8A 4L5WA 1ZH9A 3SAPA 1CVBA 1YDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V3H B;  4TWL A;  2GD8 A;  4Q7P A;  4QIZ A;  4QJP A;  4PYY A;  1ZSC A;  4Q99 A;  3V2M A;  1HEA A;  3JXH C;  3DC3 A;  2NXR A;  4M2W A;  3U47 A;  2CBA A;  1FQR A;  3D92 A;  2CBB A;  5EKJ A;  4YGL A;  1IF8 A;  3RYY A;  1Z93 A;  1THK A;  1HUG A;  4PQ7 A;  1KOP A;  1BNM A;  3P3H A;  3RYV B;  1RZC A;  1G0E A;  1OKN A;  3HFP A;  3Q31 A;  4YWP A;  1G54 A;  1EOU A;  1HCB A;  4FPT A;  3OKV A;  1XPZ A;  3EFI A;  3P5A A;  4E4A A;  3KWA A;  2NXT A;  4YGF A;  5AMG A;  2ZNC A;  3KIG A;  1CVE A;  3S97 A;  1AM6 A;  1CVC A;  2POU A;  3OIK A;  5JDV B;  4QK2 A;  2FNM A;  1IF4 A;  4Q90 A;  4JSA A;  3RGE A;  4BF6 A;  2CBE A;  2W2J A;  4Q9Y A;  4HT0 A;  3SBH A;  1FSQ A;  4RFD A;  3OY0 A;  5FLP A;  4G7A A;  2WD2 A;  3JXF A;  3FW3 A;  4Q6E A;  3U7C A;  4JSW A;  5E28 A;  1HEC A;  1HED A;  3U45 X;  1ZGF A;  3S9T A;  3P3J A;  4CNV A;  3M5T A;  1CNC A;  3V3F A;  5EH5 A;  4YHA A;  3N4B A;  3T5Z A;  3T5U A;  1RZD A;  4Q08 A;  1UGC A;  2CBD A;  4K1Q A;  2ABE A;  4WW6 A;  1RZE A;  4FVO A;  4YXO A;  1YDD A;  1G4O A;  3S77 B;  3DVB A;  5EHV A;  3NI5 A;  1I9Q A;  5CAC A;  3KKX A;  3OYQ A;  5JGS B;  3T82 A;  5E2S A;  5FLR A;  1YO1 A;  3LXE A;  4KNN A;  3M2X A;  5DSM A;  3SAX A;  2NN7 A;  4YGK A;  3R16 A;  1G4J A;  5DSO A;  4QSJ A;  3CYU A;  1CNG A;  2HL4 A;  4Q87 A;  1TH9 A;  5E5R A;  4MDM A;  3V7X A;  5L3O A;  5DVX A;  5JG3 B;  1ZFK A;  3MHM A;  4BCW A;  3TVO X;  4WUQ A;  4E9O X;  3IBL A;  2VVA X;  1RJ5 A;  1YO0 A;  2FOQ A;  3F8E A;  4L5V A;  5FL5 A;  2NNS A;  3DAZ A;  1CAZ A;  1BIC A;  2CA2 A;  4PYX A;  5FNJ A;  4MLT A;  1BNW A;  5SZ0 A;  5BRV A;  2NNO A;  1FSR A;  3V5G A;  4QK3 A;  5SZ4 A;  3RG4 A;  3CAJ A;  2POW A;  1CIL A;  1V9I C;  4K0Z A;  3M1J A;  4R5B A;  3RZ8 A;  5DSN A;  1BNT A;  1TEQ X;  2WEJ A;  2NMX A;  1RJ6 A;  4HBA A;  2H4N A;  3P58 A;  3KNE A;  5DSP A;  4BF1 A;  1BN3 A;  4Q7W A;  1UGG A;  2WD3 A;  3TMJ A;  5EHE A;  5SZ1 A;  3V2J A;  1G45 A;  3N2P A;  1I9P A;  3NJ9 A;  1CAN A;  2EZ7 A;  1Z97 A;  4QJ0 A;  1CA3 A;  4XE1 A;  1I9N A;  4MDL A;  2ILI A;  1Y7W A;  1KEQ A;  4K0S A;  3UYQ A;  3CA2 A;  5FNG A;  3M1K A;  4E3H A;  4XZ5 A;  5EKH A;  5C8I A;  1T9N A;  3KLD B;  1JCZ A;  1I9M A;  1BNV A;  3RJ7 A;  3HKN A;  4HT2 A;  4KP8 A;  3OKU A;  4Z1N A;  5FLO A;  5G0C A;  1FSN A;  4WW8 A;  1CCS A;  4K0T A;  4FU5 A;  5JGT B;  3M96 A;  1TB0 X;  4YGJ A;  1CIN A;  4QJX A;  3R17 B;  4ZWI A;  1BNU A;  4RUY A;  4R59 A;  3RZ0 B;  4XIW A;  3HKQ A;  3F4X A;  2FW4 A;  1I91 A;  1XEG A;  3FFP X;  3DD0 A;  3P4V A;  4PZH A;  5EIJ A;  4YXU A;  1RAY A;  5E2N A;  1TG9 A;  8CA2 A;  1CAL A;  2H15 A;  5G0B A;  1IF6 A;  4WR7 A;  5JEP B;  3T83 A;  1LZV A;  3IAI A;  2HNC A;  4LP6 A;  3MDZ A;  1DCA A;  3IBN A;  4TWM A;  3K7K A;  4CQ0 A;  4CAC A;  5A25 A;  2F14 A;  4FL7 A;  4LU3 A;  4DZ7 A;  4M2V A;  4IDR X;  5CLU A;  4HEW A;  3DCS A;  4Q7S A;  4K13 A;  2FMG A;  4Q09 A;  4KUY A;  1OQ5 A;  3OYS A;  4KV0 A;  5FL6 A;  5JEG B;  4Q06 A;  1CRA A;  4ILX A;  1FQN A;  1G48 A;  3DVC A;  4KNJ A;  4GL1 X;  1OKM A;  4QJW A;  1DCB A;  1CVA A;  3V3J A;  4QEF A;  1HUH A;  3P44 A;  4JSZ A;  1RZA A;  4MDG A;  3PJJ A;  2FOY A;  4L5U A;  3DA2 A;  3HLJ A;  4PXX A;  5JG5 B;  5JQ0 A;  1G3Z A;  1TG3 A;  3M40 A;  1CRM A;  3JXG A;  4FIK A;  1V9E A;  5A6H A;  1JD0 A;  1URT A;  4E5Q A;  4YVY A;  5DOG A;  3DC9 A;  1CNY A;  1I9L A;  2X7U A;  4FRC A;  4Q8X A;  4QJM A;  3MNU A;  4Q7V A;  4WUP A;  1MUA A;  1FQL A;  1CCT A;  5E2M A;  3CZV A;  4ETQ C;  3ML5 A;  4YX4 A;  1UGA A;  3MHI A;  3S75 B;  3FE4 A;  4JSS A;  4E3D A;  4KUW A;  5FLQ A;  12CA A;  1BNQ A;  3RYX B;  1CAK A;  4ZX1 A;  4UOV A;  4RFC A;  1UGE A;  5FDI A;  3V3I B;  1CAO A;  3M98 A;  4Y0J A;  1FR7 A;  1AZM A;  3M1W A;  3DBU A;  4ITP A;  1HCA A;  4RIU A;  6CA2 A;  1Z9Y A;  5FL4 A;  5BYI A;  1G52 A;  4FVN A;  3IBU A;  4MTY A;  5EH7 A;  4N0X B;  1G1D A;  3PYK A;  3N3J A;  3RZ5 A;  2NWP A;  2Q1Q A;  4ZWX A;  1CAM A;  5FNL A;  1CAH A;  1JV0 A;  4QSB A;  3DD8 A;  4QY3 A;  3W6H A;  2Q1B A;  1I9O A;  3OIL A;  4KAP A;  4Q81 A;  3UYN A;  3F7U A;  1CVD A;  1KOQ A;  3IBI A;  5BRU A;  1H9N A;  3HKT A;  2CBC A;  5CJF A;  2IT4 A;  3S71 B;  2NXS A;  4ITO A;  1IF5 A;  2QOA A;  3K2F A;  1MOO A;  1YDA A;  3K34 A;  3U3A X;  5BNL A;  1BV3 A;  3MNH A;  2WEG A;  4RUZ A;  5SZ3 A;  4XFW A;  4RN4 A;  1CAJ A;  1J9W A;  4C3T A;  3D9Z A;  5DSR A;  3S74 B;  3RG3 A;  1BN4 A;  5FNH A;  3M04 A;  2EU3 A;  3VBD A;  1ZNC A;  3OIM A;  4KNM A;  1TBT X;  4E3G A;  5DSK A;  1LUG A;  1CNX A;  2FOV A;  4Q83 A;  5EOI A;  1I8Z A;  3MNK A;  5JES B;  2HFW A;  4Z0Q A;  3M2Y A;  3RZ7 A;  1YDB A;  2FOS A;  3HS4 A;  3RLD A;  1BNN A;  1G6V A;  7CA2 A;  4X5S A;  2AX2 A;  5DSL A;  3DCC A;  3L14 A;  4ZX0 A;  1FQM A;  3GZ0 A;  4RUX A;  5DRS A;  5J8Z A;  1RAZ A;  5FNK A;  2CAB A;  4CNW A;  3IEO A;  1YO2 A;  2NNG A;  3M2Z A;  5L6K A;  2WEH A;  5SZ2 A;  5CA2 A;  1BN1 A;  4Q07 A;  1CNB A;  4E49 A;  5JEH B;  3B1B A;  2FNK A;  4Z1J A;  1LG6 A;  4R5A A;  3MNI A;  1CNK A;  5AML A;  3ZNC A;  4JS6 A;  4RIV A;  3V3G B;  4COQ A;  2OSF A;  1CAY A;  1LGD A;  1A42 A;  1BCD A;  3EFT A;  1ZFQ A;  3MHO A;  4Q8Z A;  2NWY A;  2HKK A;  3D93 A;  5FNM A;  4CNX A;  2QP6 A;  1CNH A;  2X7S A;  2FMZ A;  4YYT A;  3T85 A;  1TTM A;  2QO8 A;  4ZAO A;  4QTL A;  4KP5 A;  3ZP9 A;  5FLS A;  2AW1 A;  3KON A;  1H9Q A;  3NB5 A;  3PO6 A;  2HD6 A;  4KNI A;  2NN1 A;  3QYK A;  4ZWY A;  1G46 A;  4ZWZ A;  1ZGE A;  1UGB A;  5EZT X;  1F2W A;  1FR4 A;  4RH2 A;  3ML2 A;  5IPZ A;  1RZB A;  3KOI A;  4XIX A;  5DSQ A;  1I90 A;  4Q8Y A;  4YXI A;  4M2U A;  3RYJ B;  5FLT A;  3HKU A;  3MHL A;  3M1Q A;  3IGP A;  5LMD A;  3TVN X;  3D8W A;  4M2R A;  2NNV A;  1CNJ A;  4N16 A;  5BRW A;  1ZSA A;  3S73 B;  1DMX A;  3N0N A;  5FNI A;  2NWZ A;  2OSM A;  3D0N A;  4IWZ A;  5SZ5 A;  4HEY A;  1IF9 A;  4DZ9 A;  3MZC A;  1CA2 A;  2FNN A;  3MYQ A;  3BL1 A;  1IF7 A;  5SZ7 A;  1CVF A;  3M14 A;  2FOU A;  2Q38 A;  3M5E A;  2WEO A;  5DOH A;  1H4N A;  3B4F A;  3KS3 A;  5JQT A;  4Z1E A;  5SZ6 A;  1CZM A;  1XEV A;  2O4Z A;  3DV7 A;  3M5S A;  4HEZ A;  1FLJ A;  1UGD A;  3BET A;  4Q0L A;  1ZSB A;  2EU2 A;  9CA2 A;  2POV A;  4HU1 A;  1KWQ A;  5DSI A;  3M3X A;  3DVD A;  5EKM A;  4E3F A;  3RZ1 B;  4HF3 A;  4G0C A;  4QJO A;  1CVH A;  5E5U A;  4MLX A;  4LHI A;  3MWO A;  1G53 A;  4WL4 A;  3MHC A;  3KOK A;  3S72 B;  4QSA A;  4Q6D A;  1HVA A;  5AMD A;  3S78 B;  2HOC A;  4CNR A;  3P55 A;  4Q49 A;  5DSJ A;  1TE3 X;  3BL0 A;  3F7B A;  5EHW A;  4QK1 A;  1CIM A;  4YGN A;  3MNA A;  5G01 A;  2GEH A;  3S76 A;  4CA2 A;  4Q78 A;  3S8X A;  1BZM A;  1CAI A;  1CNI A;  1ZE8 A;  4Z1K A;  5E2K A;  1CCU A;  1AVN A;  3M67 A;  5E2R A;  3W6I A;  1G0F A;  2NWO A;  1DMY A;  3RYZ A;  3SBI A;  1UGF A;  1CNW A;  1XQ0 A;  1TEU X;  5FDC A;  5HPJ A;  1HEB A;  3DCW A;  4KUV A;  1KWR A;  5EH8 A;  1LG5 A;  3MMF A;  3C7P A;  1OKL A;  3P5L A;  4QIY A;  4QSI A;  3MNJ A;  3T84 A;  3M2N A;  2X7T A;  2VVB X;  5G03 A;  4MO8 A;  4L5W A;  1ZH9 A;  3SAP A;  1CVB A;  1YDC A; 
#chains in the Genus database with same CATH topology
 3V3H B;  4TWL A;  2GD8 A;  4Q7P A;  4QIZ A;  4QJP A;  4PYY A;  1ZSC A;  4Q99 A;  3V2M A;  1HEA A;  3JXH C;  3DC3 A;  2NXR A;  4M2W A;  3U47 A;  2CBA A;  1FQR A;  3D92 A;  2CBB A;  5EKJ A;  4YGL A;  1IF8 A;  3RYY A;  1Z93 A;  1THK A;  1HUG A;  4PQ7 A;  1KOP A;  1BNM A;  3P3H A;  3RYV B;  1RZC A;  1G0E A;  1OKN A;  3HFP A;  3Q31 A;  4YWP A;  1G54 A;  1EOU A;  1HCB A;  4FPT A;  3OKV A;  1XPZ A;  3EFI A;  3P5A A;  4E4A A;  3KWA A;  2NXT A;  4YGF A;  5AMG A;  2ZNC A;  3KIG A;  1CVE A;  3S97 A;  1AM6 A;  1CVC A;  2POU A;  3OIK A;  5JDV B;  4QK2 A;  2FNM A;  1IF4 A;  4Q90 A;  4JSA A;  3RGE A;  4BF6 A;  2CBE A;  2W2J A;  4Q9Y A;  4HT0 A;  3SBH A;  1FSQ A;  4RFD A;  3OY0 A;  5FLP A;  4G7A A;  2WD2 A;  3JXF A;  3FW3 A;  4Q6E A;  3U7C A;  4JSW A;  5E28 A;  1HEC A;  1HED A;  3U45 X;  1ZGF A;  3S9T A;  3P3J A;  4CNV A;  3M5T A;  1CNC A;  3V3F A;  5EH5 A;  4YHA A;  3N4B A;  3T5Z A;  3T5U A;  1RZD A;  4Q08 A;  1UGC A;  2CBD A;  4K1Q A;  2ABE A;  4WW6 A;  1RZE A;  4FVO A;  4YXO A;  1YDD A;  1G4O A;  3S77 B;  3DVB A;  5EHV A;  3NI5 A;  1I9Q A;  5CAC A;  3KKX A;  3OYQ A;  5JGS B;  3T82 A;  5E2S A;  5FLR A;  1YO1 A;  3LXE A;  4KNN A;  3M2X A;  5DSM A;  3SAX A;  2NN7 A;  4YGK A;  3R16 A;  1G4J A;  5DSO A;  4QSJ A;  3CYU A;  1CNG A;  2HL4 A;  4Q87 A;  1TH9 A;  5E5R A;  4MDM A;  3V7X A;  5L3O A;  5DVX A;  5JG3 B;  1ZFK A;  3MHM A;  4BCW A;  3TVO X;  4WUQ A;  4E9O X;  3IBL A;  2VVA X;  1RJ5 A;  1YO0 A;  2FOQ A;  3F8E A;  4L5V A;  5FL5 A;  2NNS A;  3DAZ A;  1CAZ A;  1BIC A;  2CA2 A;  4PYX A;  5FNJ A;  4MLT A;  1BNW A;  5SZ0 A;  5BRV A;  2NNO A;  1FSR A;  3V5G A;  4QK3 A;  5SZ4 A;  3RG4 A;  3CAJ A;  2POW A;  1CIL A;  1V9I C;  4K0Z A;  3M1J A;  4R5B A;  3RZ8 A;  5DSN A;  1BNT A;  1TEQ X;  2WEJ A;  2NMX A;  1RJ6 A;  4HBA A;  2H4N A;  3P58 A;  3KNE A;  5DSP A;  4BF1 A;  1BN3 A;  4Q7W A;  1UGG A;  2WD3 A;  3TMJ A;  5EHE A;  5SZ1 A;  3V2J A;  1G45 A;  3N2P A;  1I9P A;  3NJ9 A;  1CAN A;  2EZ7 A;  1Z97 A;  4QJ0 A;  1CA3 A;  4XE1 A;  1I9N A;  4MDL A;  2ILI A;  1Y7W A;  1KEQ A;  4K0S A;  3UYQ A;  3CA2 A;  5FNG A;  3M1K A;  4E3H A;  4XZ5 A;  5EKH A;  5C8I A;  1T9N A;  3KLD B;  1JCZ A;  1I9M A;  1BNV A;  3RJ7 A;  3HKN A;  4HT2 A;  4KP8 A;  3OKU A;  4Z1N A;  5FLO A;  5G0C A;  1FSN A;  4WW8 A;  1CCS A;  4K0T A;  4FU5 A;  5JGT B;  3M96 A;  1TB0 X;  4YGJ A;  1CIN A;  4QJX A;  3R17 B;  4ZWI A;  1BNU A;  4RUY A;  4R59 A;  3RZ0 B;  4XIW A;  3HKQ A;  3F4X A;  2FW4 A;  1I91 A;  1XEG A;  3FFP X;  3DD0 A;  3P4V A;  4PZH A;  5EIJ A;  4YXU A;  1RAY A;  5E2N A;  1TG9 A;  8CA2 A;  1CAL A;  2H15 A;  5G0B A;  1IF6 A;  4WR7 A;  5JEP B;  3T83 A;  1LZV A;  3IAI A;  2HNC A;  4LP6 A;  3MDZ A;  1DCA A;  3IBN A;  4TWM A;  3K7K A;  4CQ0 A;  4CAC A;  5A25 A;  2F14 A;  4FL7 A;  4LU3 A;  4DZ7 A;  4M2V A;  4IDR X;  5CLU A;  4HEW A;  3DCS A;  4Q7S A;  4K13 A;  2FMG A;  4Q09 A;  4KUY A;  1OQ5 A;  3OYS A;  4KV0 A;  5FL6 A;  5JEG B;  4Q06 A;  1CRA A;  4ILX A;  1FQN A;  1G48 A;  3DVC A;  4KNJ A;  4GL1 X;  1OKM A;  4QJW A;  1DCB A;  1CVA A;  3V3J A;  4QEF A;  1HUH A;  3P44 A;  4JSZ A;  1RZA A;  4MDG A;  3PJJ A;  2FOY A;  4L5U A;  3DA2 A;  3HLJ A;  4PXX A;  5JG5 B;  5JQ0 A;  1G3Z A;  1TG3 A;  3M40 A;  1CRM A;  3JXG A;  4FIK A;  1V9E A;  5A6H A;  1JD0 A;  1URT A;  4E5Q A;  4YVY A;  5DOG A;  3DC9 A;  1CNY A;  1I9L A;  2X7U A;  4FRC A;  4Q8X A;  4QJM A;  3MNU A;  4Q7V A;  4WUP A;  1MUA A;  1FQL A;  1CCT A;  5E2M A;  3CZV A;  4ETQ C;  3ML5 A;  4YX4 A;  1UGA A;  3MHI A;  3S75 B;  3FE4 A;  4JSS A;  4E3D A;  4KUW A;  5FLQ A;  12CA A;  1BNQ A;  3RYX B;  1CAK A;  4ZX1 A;  4UOV A;  4RFC A;  1UGE A;  5FDI A;  3V3I B;  1CAO A;  3M98 A;  4Y0J A;  1FR7 A;  1AZM A;  3M1W A;  3DBU A;  4ITP A;  1HCA A;  4RIU A;  6CA2 A;  1Z9Y A;  5FL4 A;  5BYI A;  1G52 A;  4FVN A;  3IBU A;  4MTY A;  5EH7 A;  4N0X B;  1G1D A;  3PYK A;  3N3J A;  3RZ5 A;  2NWP A;  2Q1Q A;  4ZWX A;  1CAM A;  5FNL A;  1CAH A;  1JV0 A;  4QSB A;  3DD8 A;  4QY3 A;  3W6H A;  2Q1B A;  1I9O A;  3OIL A;  4KAP A;  4Q81 A;  3UYN A;  3F7U A;  1CVD A;  1KOQ A;  3IBI A;  5BRU A;  1H9N A;  3HKT A;  2CBC A;  5CJF A;  2IT4 A;  3S71 B;  2NXS A;  4ITO A;  1IF5 A;  2QOA A;  3K2F A;  1MOO A;  1YDA A;  3K34 A;  3U3A X;  5BNL A;  1BV3 A;  3MNH A;  2WEG A;  4RUZ A;  5SZ3 A;  4XFW A;  4RN4 A;  1CAJ A;  1J9W A;  4C3T A;  3D9Z A;  5DSR A;  3S74 B;  3RG3 A;  1BN4 A;  5FNH A;  3M04 A;  2EU3 A;  3VBD A;  1ZNC A;  3OIM A;  4KNM A;  1TBT X;  4E3G A;  5DSK A;  1LUG A;  1CNX A;  2FOV A;  4Q83 A;  5EOI A;  1I8Z A;  3MNK A;  5JES B;  2HFW A;  4Z0Q A;  3M2Y A;  3RZ7 A;  1YDB A;  2FOS A;  3HS4 A;  3RLD A;  1BNN A;  1G6V A;  7CA2 A;  4X5S A;  2AX2 A;  5DSL A;  3DCC A;  3L14 A;  4ZX0 A;  1FQM A;  3GZ0 A;  4RUX A;  5DRS A;  5J8Z A;  1RAZ A;  5FNK A;  2CAB A;  4CNW A;  3IEO A;  1YO2 A;  2NNG A;  3M2Z A;  5L6K A;  2WEH A;  5SZ2 A;  5CA2 A;  1BN1 A;  4Q07 A;  1CNB A;  4E49 A;  5JEH B;  3B1B A;  2FNK A;  4Z1J A;  1LG6 A;  4R5A A;  3MNI A;  1CNK A;  5AML A;  3ZNC A;  4JS6 A;  4RIV A;  3V3G B;  4COQ A;  2OSF A;  1CAY A;  1LGD A;  1A42 A;  1BCD A;  3EFT A;  1ZFQ A;  3MHO A;  4Q8Z A;  2NWY A;  2HKK A;  3D93 A;  5FNM A;  4CNX A;  2QP6 A;  1CNH A;  2X7S A;  2FMZ A;  4YYT A;  3T85 A;  1TTM A;  2QO8 A;  4ZAO A;  4QTL A;  4KP5 A;  3ZP9 A;  5FLS A;  2AW1 A;  3KON A;  1H9Q A;  3NB5 A;  3PO6 A;  2HD6 A;  4KNI A;  2NN1 A;  3QYK A;  4ZWY A;  1G46 A;  4ZWZ A;  1ZGE A;  1UGB A;  5EZT X;  1F2W A;  1FR4 A;  4RH2 A;  3ML2 A;  5IPZ A;  1RZB A;  3KOI A;  4XIX A;  5DSQ A;  1I90 A;  4Q8Y A;  4YXI A;  4M2U A;  3RYJ B;  5FLT A;  3HKU A;  3MHL A;  3M1Q A;  3IGP A;  5LMD A;  3TVN X;  3D8W A;  4M2R A;  2NNV A;  1CNJ A;  4N16 A;  5BRW A;  1ZSA A;  3S73 B;  1DMX A;  3N0N A;  5FNI A;  2NWZ A;  2OSM A;  3D0N A;  4IWZ A;  5SZ5 A;  4HEY A;  1IF9 A;  4DZ9 A;  3MZC A;  1CA2 A;  2FNN A;  3MYQ A;  3BL1 A;  1IF7 A;  5SZ7 A;  1CVF A;  3M14 A;  2FOU A;  2Q38 A;  3M5E A;  2WEO A;  5DOH A;  1H4N A;  3B4F A;  3KS3 A;  5JQT A;  4Z1E A;  5SZ6 A;  1CZM A;  1XEV A;  2O4Z A;  3DV7 A;  3M5S A;  4HEZ A;  1FLJ A;  1UGD A;  3BET A;  4Q0L A;  1ZSB A;  2EU2 A;  9CA2 A;  2POV A;  4HU1 A;  1KWQ A;  5DSI A;  3M3X A;  3DVD A;  5EKM A;  4E3F A;  3RZ1 B;  4HF3 A;  4G0C A;  4QJO A;  1CVH A;  5E5U A;  4MLX A;  4LHI A;  3MWO A;  1G53 A;  4WL4 A;  3MHC A;  3KOK A;  3S72 B;  4QSA A;  4Q6D A;  1HVA A;  5AMD A;  3S78 B;  2HOC A;  4CNR A;  3P55 A;  4Q49 A;  5DSJ A;  1TE3 X;  3BL0 A;  3F7B A;  5EHW A;  4QK1 A;  1CIM A;  4YGN A;  3MNA A;  5G01 A;  2GEH A;  3S76 A;  4CA2 A;  4Q78 A;  3S8X A;  1BZM A;  1CAI A;  1CNI A;  1ZE8 A;  4Z1K A;  5E2K A;  1CCU A;  1AVN A;  3M67 A;  5E2R A;  3W6I A;  1G0F A;  2NWO A;  1DMY A;  3RYZ A;  3SBI A;  1UGF A;  1CNW A;  1XQ0 A;  1TEU X;  5FDC A;  5HPJ A;  1HEB A;  3DCW A;  4KUV A;  1KWR A;  5EH8 A;  1LG5 A;  3MMF A;  3C7P A;  1OKL A;  3P5L A;  4QIY A;  4QSI A;  3MNJ A;  3T84 A;  3M2N A;  2X7T A;  2VVB X;  5G03 A;  4MO8 A;  4L5W A;  1ZH9 A;  3SAP A;  1CVB A;  1YDC A; 
#chains in the Genus database with same CATH homology
 3V3H B;  4TWL A;  2GD8 A;  4Q7P A;  4QIZ A;  4QJP A;  4PYY A;  1ZSC A;  4Q99 A;  3V2M A;  1HEA A;  3JXH C;  3DC3 A;  2NXR A;  4M2W A;  3U47 A;  2CBA A;  1FQR A;  3D92 A;  2CBB A;  5EKJ A;  4YGL A;  1IF8 A;  3RYY A;  1Z93 A;  1THK A;  1HUG A;  4PQ7 A;  1KOP A;  1BNM A;  3P3H A;  3RYV B;  1RZC A;  1G0E A;  1OKN A;  3HFP A;  3Q31 A;  4YWP A;  1G54 A;  1EOU A;  1HCB A;  4FPT A;  3OKV A;  1XPZ A;  3EFI A;  3P5A A;  4E4A A;  3KWA A;  2NXT A;  4YGF A;  5AMG A;  2ZNC A;  3KIG A;  1CVE A;  3S97 A;  1AM6 A;  1CVC A;  2POU A;  3OIK A;  5JDV B;  4QK2 A;  2FNM A;  1IF4 A;  4Q90 A;  4JSA A;  3RGE A;  4BF6 A;  2CBE A;  2W2J A;  4Q9Y A;  4HT0 A;  3SBH A;  1FSQ A;  4RFD A;  3OY0 A;  5FLP A;  4G7A A;  2WD2 A;  3JXF A;  3FW3 A;  4Q6E A;  3U7C A;  4JSW A;  5E28 A;  1HEC A;  1HED A;  3U45 X;  1ZGF A;  3S9T A;  3P3J A;  4CNV A;  3M5T A;  1CNC A;  3V3F A;  5EH5 A;  4YHA A;  3N4B A;  3T5Z A;  3T5U A;  1RZD A;  4Q08 A;  1UGC A;  2CBD A;  4K1Q A;  2ABE A;  4WW6 A;  1RZE A;  4FVO A;  4YXO A;  1YDD A;  1G4O A;  3S77 B;  3DVB A;  5EHV A;  3NI5 A;  1I9Q A;  5CAC A;  3KKX A;  3OYQ A;  5JGS B;  3T82 A;  5E2S A;  5FLR A;  1YO1 A;  3LXE A;  4KNN A;  3M2X A;  5DSM A;  3SAX A;  2NN7 A;  4YGK A;  3R16 A;  1G4J A;  5DSO A;  4QSJ A;  3CYU A;  1CNG A;  2HL4 A;  4Q87 A;  1TH9 A;  5E5R A;  4MDM A;  3V7X A;  5L3O A;  5DVX A;  5JG3 B;  1ZFK A;  3MHM A;  4BCW A;  3TVO X;  4WUQ A;  4E9O X;  3IBL A;  2VVA X;  1RJ5 A;  1YO0 A;  2FOQ A;  3F8E A;  4L5V A;  5FL5 A;  2NNS A;  3DAZ A;  1CAZ A;  1BIC A;  2CA2 A;  4PYX A;  5FNJ A;  4MLT A;  1BNW A;  5SZ0 A;  5BRV A;  2NNO A;  1FSR A;  3V5G A;  4QK3 A;  5SZ4 A;  3RG4 A;  3CAJ A;  2POW A;  1CIL A;  1V9I C;  4K0Z A;  3M1J A;  4R5B A;  3RZ8 A;  5DSN A;  1BNT A;  1TEQ X;  2WEJ A;  2NMX A;  1RJ6 A;  4HBA A;  2H4N A;  3P58 A;  3KNE A;  5DSP A;  4BF1 A;  1BN3 A;  4Q7W A;  1UGG A;  2WD3 A;  3TMJ A;  5EHE A;  5SZ1 A;  3V2J A;  1G45 A;  3N2P A;  1I9P A;  3NJ9 A;  1CAN A;  2EZ7 A;  1Z97 A;  4QJ0 A;  1CA3 A;  4XE1 A;  1I9N A;  4MDL A;  2ILI A;  1Y7W A;  1KEQ A;  4K0S A;  3UYQ A;  3CA2 A;  5FNG A;  3M1K A;  4E3H A;  4XZ5 A;  5EKH A;  5C8I A;  1T9N A;  3KLD B;  1JCZ A;  1I9M A;  1BNV A;  3RJ7 A;  3HKN A;  4HT2 A;  4KP8 A;  3OKU A;  4Z1N A;  5FLO A;  5G0C A;  1FSN A;  4WW8 A;  1CCS A;  4K0T A;  4FU5 A;  5JGT B;  3M96 A;  1TB0 X;  4YGJ A;  1CIN A;  4QJX A;  3R17 B;  4ZWI A;  1BNU A;  4RUY A;  4R59 A;  3RZ0 B;  4XIW A;  3HKQ A;  3F4X A;  2FW4 A;  1I91 A;  1XEG A;  3FFP X;  3DD0 A;  3P4V A;  4PZH A;  5EIJ A;  4YXU A;  1RAY A;  5E2N A;  1TG9 A;  8CA2 A;  1CAL A;  2H15 A;  5G0B A;  1IF6 A;  4WR7 A;  5JEP B;  3T83 A;  1LZV A;  3IAI A;  2HNC A;  4LP6 A;  3MDZ A;  1DCA A;  3IBN A;  4TWM A;  3K7K A;  4CQ0 A;  4CAC A;  5A25 A;  2F14 A;  4FL7 A;  4LU3 A;  4DZ7 A;  4M2V A;  4IDR X;  5CLU A;  4HEW A;  3DCS A;  4Q7S A;  4K13 A;  2FMG A;  4Q09 A;  4KUY A;  1OQ5 A;  3OYS A;  4KV0 A;  5FL6 A;  5JEG B;  4Q06 A;  1CRA A;  4ILX A;  1FQN A;  1G48 A;  3DVC A;  4KNJ A;  4GL1 X;  1OKM A;  4QJW A;  1DCB A;  1CVA A;  3V3J A;  4QEF A;  1HUH A;  3P44 A;  4JSZ A;  1RZA A;  4MDG A;  3PJJ A;  2FOY A;  4L5U A;  3DA2 A;  3HLJ A;  4PXX A;  5JG5 B;  5JQ0 A;  1G3Z A;  1TG3 A;  3M40 A;  1CRM A;  3JXG A;  4FIK A;  1V9E A;  5A6H A;  1JD0 A;  1URT A;  4E5Q A;  4YVY A;  5DOG A;  3DC9 A;  1CNY A;  1I9L A;  2X7U A;  4FRC A;  4Q8X A;  4QJM A;  3MNU A;  4Q7V A;  4WUP A;  1MUA A;  1FQL A;  1CCT A;  5E2M A;  3CZV A;  4ETQ C;  3ML5 A;  4YX4 A;  1UGA A;  3MHI A;  3S75 B;  3FE4 A;  4JSS A;  4E3D A;  4KUW A;  5FLQ A;  12CA A;  1BNQ A;  3RYX B;  1CAK A;  4ZX1 A;  4UOV A;  4RFC A;  1UGE A;  5FDI A;  3V3I B;  1CAO A;  3M98 A;  4Y0J A;  1FR7 A;  1AZM A;  3M1W A;  3DBU A;  4ITP A;  1HCA A;  4RIU A;  6CA2 A;  1Z9Y A;  5FL4 A;  5BYI A;  1G52 A;  4FVN A;  3IBU A;  4MTY A;  5EH7 A;  4N0X B;  1G1D A;  3PYK A;  3N3J A;  3RZ5 A;  2NWP A;  2Q1Q A;  4ZWX A;  1CAM A;  5FNL A;  1CAH A;  1JV0 A;  4QSB A;  3DD8 A;  4QY3 A;  3W6H A;  2Q1B A;  1I9O A;  3OIL A;  4KAP A;  4Q81 A;  3UYN A;  3F7U A;  1CVD A;  1KOQ A;  3IBI A;  5BRU A;  1H9N A;  3HKT A;  2CBC A;  5CJF A;  2IT4 A;  3S71 B;  2NXS A;  4ITO A;  1IF5 A;  2QOA A;  3K2F A;  1MOO A;  1YDA A;  3K34 A;  3U3A X;  5BNL A;  1BV3 A;  3MNH A;  2WEG A;  4RUZ A;  5SZ3 A;  4XFW A;  4RN4 A;  1CAJ A;  1J9W A;  4C3T A;  3D9Z A;  5DSR A;  3S74 B;  3RG3 A;  1BN4 A;  5FNH A;  3M04 A;  2EU3 A;  3VBD A;  1ZNC A;  3OIM A;  4KNM A;  1TBT X;  4E3G A;  5DSK A;  1LUG A;  1CNX A;  2FOV A;  4Q83 A;  5EOI A;  1I8Z A;  3MNK A;  5JES B;  2HFW A;  4Z0Q A;  3M2Y A;  3RZ7 A;  1YDB A;  2FOS A;  3HS4 A;  3RLD A;  1BNN A;  1G6V A;  7CA2 A;  4X5S A;  2AX2 A;  5DSL A;  3DCC A;  3L14 A;  4ZX0 A;  1FQM A;  3GZ0 A;  4RUX A;  5DRS A;  5J8Z A;  1RAZ A;  5FNK A;  2CAB A;  4CNW A;  3IEO A;  1YO2 A;  2NNG A;  3M2Z A;  5L6K A;  2WEH A;  5SZ2 A;  5CA2 A;  1BN1 A;  4Q07 A;  1CNB A;  4E49 A;  5JEH B;  3B1B A;  2FNK A;  4Z1J A;  1LG6 A;  4R5A A;  3MNI A;  1CNK A;  5AML A;  3ZNC A;  4JS6 A;  4RIV A;  3V3G B;  4COQ A;  2OSF A;  1CAY A;  1LGD A;  1A42 A;  1BCD A;  3EFT A;  1ZFQ A;  3MHO A;  4Q8Z A;  2NWY A;  2HKK A;  3D93 A;  5FNM A;  4CNX A;  2QP6 A;  1CNH A;  2X7S A;  2FMZ A;  4YYT A;  3T85 A;  1TTM A;  2QO8 A;  4ZAO A;  4QTL A;  4KP5 A;  3ZP9 A;  5FLS A;  2AW1 A;  3KON A;  1H9Q A;  3NB5 A;  3PO6 A;  2HD6 A;  4KNI A;  2NN1 A;  3QYK A;  4ZWY A;  1G46 A;  4ZWZ A;  1ZGE A;  1UGB A;  5EZT X;  1F2W A;  1FR4 A;  4RH2 A;  3ML2 A;  5IPZ A;  1RZB A;  3KOI A;  4XIX A;  5DSQ A;  1I90 A;  4Q8Y A;  4YXI A;  4M2U A;  3RYJ B;  5FLT A;  3HKU A;  3MHL A;  3M1Q A;  3IGP A;  5LMD A;  3TVN X;  3D8W A;  4M2R A;  2NNV A;  1CNJ A;  4N16 A;  5BRW A;  1ZSA A;  3S73 B;  1DMX A;  3N0N A;  5FNI A;  2NWZ A;  2OSM A;  3D0N A;  4IWZ A;  5SZ5 A;  4HEY A;  1IF9 A;  4DZ9 A;  3MZC A;  1CA2 A;  2FNN A;  3MYQ A;  3BL1 A;  1IF7 A;  5SZ7 A;  1CVF A;  3M14 A;  2FOU A;  2Q38 A;  3M5E A;  2WEO A;  5DOH A;  1H4N A;  3B4F A;  3KS3 A;  5JQT A;  4Z1E A;  5SZ6 A;  1CZM A;  1XEV A;  2O4Z A;  3DV7 A;  3M5S A;  4HEZ A;  1FLJ A;  1UGD A;  3BET A;  4Q0L A;  1ZSB A;  2EU2 A;  9CA2 A;  2POV A;  4HU1 A;  1KWQ A;  5DSI A;  3M3X A;  3DVD A;  5EKM A;  4E3F A;  3RZ1 B;  4HF3 A;  4G0C A;  4QJO A;  1CVH A;  5E5U A;  4MLX A;  4LHI A;  3MWO A;  1G53 A;  4WL4 A;  3MHC A;  3KOK A;  3S72 B;  4QSA A;  4Q6D A;  1HVA A;  5AMD A;  3S78 B;  2HOC A;  4CNR A;  3P55 A;  4Q49 A;  5DSJ A;  1TE3 X;  3BL0 A;  3F7B A;  5EHW A;  4QK1 A;  1CIM A;  4YGN A;  3MNA A;  5G01 A;  2GEH A;  3S76 A;  4CA2 A;  4Q78 A;  3S8X A;  1BZM A;  1CAI A;  1CNI A;  1ZE8 A;  4Z1K A;  5E2K A;  1CCU A;  1AVN A;  3M67 A;  5E2R A;  3W6I A;  1G0F A;  2NWO A;  1DMY A;  3RYZ A;  3SBI A;  1UGF A;  1CNW A;  1XQ0 A;  1TEU X;  5FDC A;  5HPJ A;  1HEB A;  3DCW A;  4KUV A;  1KWR A;  5EH8 A;  1LG5 A;  3MMF A;  3C7P A;  1OKL A;  3P5L A;  4QIY A;  4QSI A;  3MNJ A;  3T84 A;  3M2N A;  2X7T A;  2VVB X;  5G03 A;  4MO8 A;  4L5W A;  1ZH9 A;  3SAP A;  1CVB A;  1YDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...