1CAZA

Wild-type and e106q mutant carbonic anhydrase complexed with acetate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
Knots found
sequence length
258
structure length
258
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSQHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONIC ANHYDRASE II
publication title Wild-type and E106Q mutant carbonic anhydrase complexed with acetate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase(oxo-acid)
total genus 78
structure length 258
sequence length 258
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1993-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1cazA00
5FDCA 4PZHA 5FNJA 5DSNA 4COQA 4E3HA 1F2WA 1XEVA 3IBUA 2QP6A 4HEYA 3PYKA 1BNUA 4JSWA 4MTYA 5FLQA 4L5WA 4XFWA 1JCZA 4K0TA 4Q07A 2POVA 3V3GB 3DCSA 3EFIA 5FNHA 3R17B 4MDMA 3T5ZA 4Q8XA 3RYJB 5SZ7A 4KUWA 3V3JA 3RYXB 1BNTA 1RJ6A 3P5AA 5L6KA 1RZAA 4Z1NA 2FMZA 5DSPA 3SAPA 6CA2A 4CNXA 3V2JA 1YDCA 4RH2A 4XE1A 4ITOA 5CLUA 3RZ5A 4QSIA 3V3HB 5JG5B 4HEZA 4YGFA 4GL1X 3U45X 3OKVA 1BCDA 1UGCA 2FOQA 3CZVA 1CNBA 2HL4A 3DBUA 5EZTX 3IBNA 5FLSA 1CINA 3RZ8A 5G0BA 5DSQA 2WD3A 4RFCA 4ZWXA 1TEUX 5BNLA 1CNJA 1AZMA 3V3IB 2FNKA 2HFWA 1CZMA 2Q1QA 2Q38A 5DSJA 5J8ZA 3VBDA 5BRVA 1UGBA 4KV0A 3S75B 4BCWA 1UGAA 4WW6A 5E28A 2FOUA 4QJPA 3DV7A 5E2NA 5EKMA 3S72B 1CAKA 3ML2A 2NMXA 3RJ7A 1CNCA 3B1BA 1OKLA 1HUGA 1G46A 5DSLA 1G4OA 1G53A 1BN1A 4Q6EA 1J9WA 5SZ4A 1IF4A 4RUYA 5EHVA 3T83A 4FVNA 5DSOA 4ZWIA 4Q83A 3NB5A 3F8EA 1CVDA 1FR4A 3DA2A 1V9IC 5SZ0A 8CA2A 4QJWA 2NNSA 3MNJA 5DOHA 3K34A 5SZ2A 3KWAA 5FLOA 4YYTA 2ABEA 4PYYA 4ILXA 3U7CA 1IF8A 3DVCA 5CACA 2IT4A 1RZBA 3BETA 1CVHA 3S8XA 1G3ZA 1CA3A 1V9EA 3C7PA 3FW3A 1I9NA 1YDAA 3OKUA 1ZFQA 1FQRA 4FRCA 4JS6A 2CBEA 3DVBA 1Z97A 3ZP9A 4CNRA 4CNWA 1ZSAA 1TG9A 5BYIA 1IF5A 3M14A 1UGGA 3HLJA 5G03A 4RIUA 1RJ5A 1OQ5A 3D0NA 5DRSA 4R5AA 3M3XA 2NWYA 3DC9A 1G54A 3UYQA 2EU2A 1DMXA 3JXGA 1CAZA 4ITPA 2FW4A 1XPZA 4K13A 1G52A 1MOOA 3M1KA 1YDBA 4KNIA 4YVYA 2OSFA 3V7XA 5SZ1A 4FVOA 4E3DA 4XIWA 1G48A 5FNMA 3S97A 4E3FA 3LXEA 4YX4A 4FIKA 1FQNA 4WUPA 5IPZA 4Z0QA 4QJMA 5AMLA 1I9QA 1ZH9A 3ZNCA 3S77B 5FLTA 4MLXA 1HCBA 1KWQA 5FL4A 3S73B 3MHOA 1AM6A 1T9NA 2HKKA 1ZGEA 3M96A 5EHWA 4CQ0A 1CRMA 5FNKA 3S71B 3K7KA 3M1WA 3T84A 3JXHC 2FOVA 4Q7PA 3QYKA 4Q81A 3M98A 1KEQA 5JEPB 3MHCA 3TMJA 5AMGA 4RFDA 2NN7A 1IF7A 1LUGA 2ZNCA 2FOYA 3P55A 5G0CA 1CVAA 3T82A 1TTMA 1CNXA 4HEWA 1CAYA 3ML5A 1CAIA 1A42A 3F4XA 1RAZA 3RGEA 4HF3A 4E5QA 2FOSA 3MMFA 1BNMA 3KKXA 5SZ6A 1UGEA 4QIYA 3NI5A 1LG5A 3HS4A 1XEGA 3MZCA 4Y0JA 4M2VA 4Q87A 4LU3A 3RG3A 3RG4A 3FE4A 4Q9YA 4FPTA 2NXSA 3DVDA 4XIXA 2NXTA 5E2RA 1IF9A 3Q31A 1BV3A 5SZ3A 5EIJA 3W6HA 3OIKA 4PYXA 3IGPA 4Q7VA 1BZMA 3KOKA 2GD8A 4BF1A 2WEHA 1G0EA 4QK1A 4YXIA 4KP8A 1CAMA 4BF6A 3JXFA 3V2MA 1YO0A 3RZ1B 2CABA 2POUA 1CNYA 4TWLA 5JGSB 4R5BA 1ZFKA 1HUHA 2AW1A 4R59A 5E2SA 5G01A 3OY0A 3DCWA 1BN3A 1CVEA 3D8WA 3DD8A 3IBIA 4Q08A 4QIZA 5FNGA 1URTA 3V3FA 1H4NA 1CAOA 3HFPA 4CA2A 4Z1EA 1RZEA 3GZ0A 3MNKA 4HT0A 1FR7A 3BL0A 5AMDA 4C3TA 1BNVA 4Z1KA 4K0SA 5A6HA 5EKJA 5L3OA 3HKUA 3M5TA 3DAZA 4MLTA 3EFTA 5DOGA 3FFPX 5E2KA 1DCAA 1TEQX 1THKA 3N4BA 3D92A 3KONA 3CA2A 1FSNA 3SBHA 5FLRA 3S74B 4YGLA 5JQ0A 3TVNX 3CAJA 4JSZA 1BN4A 2VVBX 4RIVA 4MDLA 4M2UA 3SBIA 1ZNCA 2H4NA 3S9TA 1LGDA 3P4VA 1CA2A 3S76A 5JDVB 4G0CA 2AX2A 1ZSBA 1IF6A 3MNIA 4L5UA 2EU3A 1OKNA 3B4FA 3S78B 3P3HA 3N3JA 4Q7WA 1Z93A 1CILA 4YGKA 2POWA 4N16A 1Y7WA 1HVAA 1ZE8A 1TE3X 4KNJA 1CRAA 4JSAA 3KOIA 1MUAA 5EH8A 3T85A 4E4AA 3OYSA 1I9OA 1CVBA 5EH5A 2NNOA 1FLJA 4HT2A 5EKHA 5FL6A 1CNIA 4G7AA 5FLPA 4DZ9A 3M67A 4QSAA 5E5RA 2HOCA 2X7UA 4ZX1A 4Q6DA 1AVNA 3RYZA 1KOQA 3F7BA 4KNNA 3D93A 4PQ7A 1I8ZA 3RYYA 3RZ0B 1OKMA 5BRUA 2QO8A 3U3AX 2F14A 2H15A 4X5SA 1CANA 1G4JA 5EOIA 2X7TA 2NXRA 3L14A 4RN4A 4JSSA 1TH9A 3SAXA 3M40A 1BICA 1CCSA 1FSQA 2WD2A 3HKNA 2QOAA 3KIGA 4KUYA 3PO6A 3RYVB 2CBBA 1DCBA 1YDDA 4KUVA 4ZX0A 1FQMA 1I9LA 3IAIA 2NWPA 3P3JA 1JV0A 4WL4A 1G6VA 1HEBA 3M2XA 1I9MA 2ILIA 4Q99A 4QJXA 2CBCA 1YO1A 2O4ZA 1BNWA 4ZWZA 4L5VA 2HD6A 2W2JA 3RLDA 1RZCA 2NNVA 2WEJA 2X7SA 5JG3B 4XZ5A 4E9OX 1I90A 3MNUA 1CNGA 4YGNA 1CVFA 7CA2A 4UOVA 2NN1A 1DMYA 3M5EA 3P58A 5FDIA 3MHLA 1CAJA 4QEFA 1UGFA 4Q09A 5BRWA 3M04A 4Q8ZA 1CIMA 3HKQA 5HPJA 3P5LA 4ZAOA 5JQTA 3RZ7A 1RZDA 4KAPA 4CNVA 1G1DA 4FU5A 4QY3A 1LG6A 4IWZA 3W6IA 5DSRA 3N0NA 3MNAA 4YGJA 3P44A 1BNNA 3BL1A 1I91A 1TG3A 3D9ZA 4K0ZA 5DSIA 1BNQA 1EOUA 1G45A 3DCCA 2Q1BA 4Q90A 5C8IA 1CCTA 3UYNA 3OIMA 3M5SA 4N0XB 3MHIA 1I9PA 4M2RA 1H9QA 4FL7A 4QSBA 4WUQA 3HKTA 4QJ0A 4CACA 5CJFA 5A25A 4Q7SA 4YXOA 3KNEA 4QK3A 4QSJA 4RUZA 1UGDA 1CALA 1RAYA 3CYUA 4Z1JA 1TBTX 4Q49A 2WEGA 2GEHA 1HCAA 5FNLA 4M2WA 3OYQA 1KWRA 5E2MA 1ZGFA 4ETQC 3TVOX 5DSKA 3V5GA 3KS3A 4E3GA 3MWOA 4YWPA 5JESB 4YHAA 2FNNA 1CCUA 4QK2A 3MNHA 2HNCA 1XQ0A 1H9NA 5EH7A 4QTLA 3M1QA 4PXXA 3M2NA 4HBAA 4MDGA 12CAA 3F7UA 4IDRX 1KOPA 4K1QA 4TWMA 1HECA 4YXUA 1CNHA 1CAHA 1CNWA 5FNIA 1YO2A 2CA2A 3MYQA 2CBDA 4Q06A 1FSRA 1TB0X 1JD0A 4DZ7A 4Q8YA 1ZSCA 3KLDB 4RUXA 4LHIA 3M2ZA 3DD0A 1FQLA 3MHMA 4E49A 4WW8A 2NWOA 2WEOA 5SZ5A 2FMGA 1CNKA 4ZWYA 5FL5A 4KNMA 3PJJA 3U47A 2NWZA 4Q0LA 1HEAA 2OSMA 5DSMA 2NNGA 1CVCA 2CBAA 3M1JA 4Q78A 5EHEA 1Z9YA 5CA2A 5LMDA 3T5UA 5JGTB 4LP6A 9CA2A 3DC3A 3IBLA 5E5UA 5DVXA 2FNMA 3K2FA 3M2YA 1G0FA 4HU1A 2EZ7A 4QJOA 3MDZA 1HEDA 5JEHB 3N2PA 3OILA 4WR7A 1LZVA 3IEOA 2VVAX 3R16A 4KP5A 4MO8A 5JEGB 3NJ9A
chains in the Genus database with same CATH superfamily
5FDCA 4PZHA 5FNJA 5DSNA 4COQA 4E3HA 1F2WA 1XEVA 3IBUA 2QP6A 4HEYA 3PYKA 1BNUA 4JSWA 4MTYA 5FLQA 4L5WA 4XFWA 1JCZA 4K0TA 4Q07A 2POVA 3V3GB 3DCSA 3EFIA 5FNHA 3R17B 4MDMA 3T5ZA 4Q8XA 3RYJB 5SZ7A 4KUWA 3V3JA 3RYXB 1BNTA 1RJ6A 3P5AA 5L6KA 1RZAA 4Z1NA 2FMZA 5DSPA 3SAPA 6CA2A 4CNXA 3V2JA 1YDCA 4RH2A 4XE1A 4ITOA 5CLUA 3RZ5A 4QSIA 3V3HB 5JG5B 4HEZA 4YGFA 4GL1X 3U45X 3OKVA 1BCDA 1UGCA 2FOQA 3CZVA 1CNBA 2HL4A 3DBUA 5EZTX 3IBNA 5FLSA 1CINA 3RZ8A 5G0BA 5DSQA 2WD3A 4RFCA 4ZWXA 1TEUX 5BNLA 1CNJA 1AZMA 3V3IB 2FNKA 2HFWA 1CZMA 2Q1QA 2Q38A 5DSJA 5J8ZA 3VBDA 5BRVA 1UGBA 4KV0A 3S75B 4BCWA 1UGAA 4WW6A 5E28A 2FOUA 4QJPA 3DV7A 5E2NA 5EKMA 3S72B 1CAKA 3ML2A 2NMXA 3RJ7A 1CNCA 3B1BA 1OKLA 1HUGA 1G46A 5DSLA 1G4OA 1G53A 1BN1A 4Q6EA 1J9WA 5SZ4A 1IF4A 4RUYA 5EHVA 3T83A 4FVNA 5DSOA 4ZWIA 4Q83A 3NB5A 3F8EA 1CVDA 1FR4A 3DA2A 1V9IC 5SZ0A 8CA2A 4QJWA 2NNSA 3MNJA 5DOHA 3K34A 5SZ2A 3KWAA 5FLOA 4YYTA 2ABEA 4PYYA 4ILXA 3U7CA 1IF8A 3DVCA 5CACA 2IT4A 1RZBA 3BETA 1CVHA 3S8XA 1G3ZA 1CA3A 1V9EA 3C7PA 3FW3A 1I9NA 1YDAA 3OKUA 1ZFQA 1FQRA 4FRCA 4JS6A 2CBEA 3DVBA 1Z97A 3ZP9A 4CNRA 4CNWA 1ZSAA 1TG9A 5BYIA 1IF5A 3M14A 1UGGA 3HLJA 5G03A 4RIUA 1RJ5A 1OQ5A 3D0NA 5DRSA 4R5AA 3M3XA 2NWYA 3DC9A 1G54A 3UYQA 2EU2A 1DMXA 3JXGA 1CAZA 4ITPA 2FW4A 1XPZA 4K13A 1G52A 1MOOA 3M1KA 1YDBA 4KNIA 4YVYA 2OSFA 3V7XA 5SZ1A 4FVOA 4E3DA 4XIWA 1G48A 5FNMA 3S97A 4E3FA 3LXEA 4YX4A 4FIKA 1FQNA 4WUPA 5IPZA 4Z0QA 4QJMA 5AMLA 1I9QA 1ZH9A 3ZNCA 3S77B 5FLTA 4MLXA 1HCBA 1KWQA 5FL4A 3S73B 3MHOA 1AM6A 1T9NA 2HKKA 1ZGEA 3M96A 5EHWA 4CQ0A 1CRMA 5FNKA 3S71B 3K7KA 3M1WA 3T84A 3JXHC 2FOVA 4Q7PA 3QYKA 4Q81A 3M98A 1KEQA 5JEPB 3MHCA 3TMJA 5AMGA 4RFDA 2NN7A 1IF7A 1LUGA 2ZNCA 2FOYA 3P55A 5G0CA 1CVAA 3T82A 1TTMA 1CNXA 4HEWA 1CAYA 3ML5A 1CAIA 1A42A 3F4XA 1RAZA 3RGEA 4HF3A 4E5QA 2FOSA 3MMFA 1BNMA 3KKXA 5SZ6A 1UGEA 4QIYA 3NI5A 1LG5A 3HS4A 1XEGA 3MZCA 4Y0JA 4M2VA 4Q87A 4LU3A 3RG3A 3RG4A 3FE4A 4Q9YA 4FPTA 2NXSA 3DVDA 4XIXA 2NXTA 5E2RA 1IF9A 3Q31A 1BV3A 5SZ3A 5EIJA 3W6HA 3OIKA 4PYXA 3IGPA 4Q7VA 1BZMA 3KOKA 2GD8A 4BF1A 2WEHA 1G0EA 4QK1A 4YXIA 4KP8A 1CAMA 4BF6A 3JXFA 3V2MA 1YO0A 3RZ1B 2CABA 2POUA 1CNYA 4TWLA 5JGSB 4R5BA 1ZFKA 1HUHA 2AW1A 4R59A 5E2SA 5G01A 3OY0A 3DCWA 1BN3A 1CVEA 3D8WA 3DD8A 3IBIA 4Q08A 4QIZA 5FNGA 1URTA 3V3FA 1H4NA 1CAOA 3HFPA 4CA2A 4Z1EA 1RZEA 3GZ0A 3MNKA 4HT0A 1FR7A 3BL0A 5AMDA 4C3TA 1BNVA 4Z1KA 4K0SA 5A6HA 5EKJA 5L3OA 3HKUA 3M5TA 3DAZA 4MLTA 3EFTA 5DOGA 3FFPX 5E2KA 1DCAA 1TEQX 1THKA 3N4BA 3D92A 3KONA 3CA2A 1FSNA 3SBHA 5FLRA 3S74B 4YGLA 5JQ0A 3TVNX 3CAJA 4JSZA 1BN4A 2VVBX 4RIVA 4MDLA 4M2UA 3SBIA 1ZNCA 2H4NA 3S9TA 1LGDA 3P4VA 1CA2A 3S76A 5JDVB 4G0CA 2AX2A 1ZSBA 1IF6A 3MNIA 4L5UA 2EU3A 1OKNA 3B4FA 3S78B 3P3HA 3N3JA 4Q7WA 1Z93A 1CILA 4YGKA 2POWA 4N16A 1Y7WA 1HVAA 1ZE8A 1TE3X 4KNJA 1CRAA 4JSAA 3KOIA 1MUAA 5EH8A 3T85A 4E4AA 3OYSA 1I9OA 1CVBA 5EH5A 2NNOA 1FLJA 4HT2A 5EKHA 5FL6A 1CNIA 4G7AA 5FLPA 4DZ9A 3M67A 4QSAA 5E5RA 2HOCA 2X7UA 4ZX1A 4Q6DA 1AVNA 3RYZA 1KOQA 3F7BA 4KNNA 3D93A 4PQ7A 1I8ZA 3RYYA 3RZ0B 1OKMA 5BRUA 2QO8A 3U3AX 2F14A 2H15A 4X5SA 1CANA 1G4JA 5EOIA 2X7TA 2NXRA 3L14A 4RN4A 4JSSA 1TH9A 3SAXA 3M40A 1BICA 1CCSA 1FSQA 2WD2A 3HKNA 2QOAA 3KIGA 4KUYA 3PO6A 3RYVB 2CBBA 1DCBA 1YDDA 4KUVA 4ZX0A 1FQMA 1I9LA 3IAIA 2NWPA 3P3JA 1JV0A 4WL4A 1G6VA 1HEBA 3M2XA 1I9MA 2ILIA 4Q99A 4QJXA 2CBCA 1YO1A 2O4ZA 1BNWA 4ZWZA 4L5VA 2HD6A 2W2JA 3RLDA 1RZCA 2NNVA 2WEJA 2X7SA 5JG3B 4XZ5A 4E9OX 1I90A 3MNUA 1CNGA 4YGNA 1CVFA 7CA2A 4UOVA 2NN1A 1DMYA 3M5EA 3P58A 5FDIA 3MHLA 1CAJA 4QEFA 1UGFA 4Q09A 5BRWA 3M04A 4Q8ZA 1CIMA 3HKQA 5HPJA 3P5LA 4ZAOA 5JQTA 3RZ7A 1RZDA 4KAPA 4CNVA 1G1DA 4FU5A 4QY3A 1LG6A 4IWZA 3W6IA 5DSRA 3N0NA 3MNAA 4YGJA 3P44A 1BNNA 3BL1A 1I91A 1TG3A 3D9ZA 4K0ZA 5DSIA 1BNQA 1EOUA 1G45A 3DCCA 2Q1BA 4Q90A 5C8IA 1CCTA 3UYNA 3OIMA 3M5SA 4N0XB 3MHIA 1I9PA 4M2RA 1H9QA 4FL7A 4QSBA 4WUQA 3HKTA 4QJ0A 4CACA 5CJFA 5A25A 4Q7SA 4YXOA 3KNEA 4QK3A 4QSJA 4RUZA 1UGDA 1CALA 1RAYA 3CYUA 4Z1JA 1TBTX 4Q49A 2WEGA 2GEHA 1HCAA 5FNLA 4M2WA 3OYQA 1KWRA 5E2MA 1ZGFA 4ETQC 3TVOX 5DSKA 3V5GA 3KS3A 4E3GA 3MWOA 4YWPA 5JESB 4YHAA 2FNNA 1CCUA 4QK2A 3MNHA 2HNCA 1XQ0A 1H9NA 5EH7A 4QTLA 3M1QA 4PXXA 3M2NA 4HBAA 4MDGA 12CAA 3F7UA 4IDRX 1KOPA 4K1QA 4TWMA 1HECA 4YXUA 1CNHA 1CAHA 1CNWA 5FNIA 1YO2A 2CA2A 3MYQA 2CBDA 4Q06A 1FSRA 1TB0X 1JD0A 4DZ7A 4Q8YA 1ZSCA 3KLDB 4RUXA 4LHIA 3M2ZA 3DD0A 1FQLA 3MHMA 4E49A 4WW8A 2NWOA 2WEOA 5SZ5A 2FMGA 1CNKA 4ZWYA 5FL5A 4KNMA 3PJJA 3U47A 2NWZA 4Q0LA 1HEAA 2OSMA 5DSMA 2NNGA 1CVCA 2CBAA 3M1JA 4Q78A 5EHEA 1Z9YA 5CA2A 5LMDA 3T5UA 5JGTB 4LP6A 9CA2A 3DC3A 3IBLA 5E5UA 5DVXA 2FNMA 3K2FA 3M2YA 1G0FA 4HU1A 2EZ7A 4QJOA 3MDZA 1HEDA 5JEHB 3N2PA 3OILA 4WR7A 1LZVA 3IEOA 2VVAX 3R16A 4KP5A 4MO8A 5JEGB 3NJ9A
chains in the Genus database with same CATH topology
5FDCA 4PZHA 5FNJA 5DSNA 4COQA 4E3HA 1F2WA 1XEVA 3IBUA 2QP6A 4HEYA 3PYKA 1BNUA 4JSWA 4MTYA 5FLQA 4L5WA 4XFWA 1JCZA 4K0TA 4Q07A 2POVA 3V3GB 3DCSA 3EFIA 5FNHA 3R17B 4MDMA 3T5ZA 4Q8XA 3RYJB 5SZ7A 4KUWA 3V3JA 3RYXB 1BNTA 1RJ6A 3P5AA 5L6KA 1RZAA 4Z1NA 2FMZA 5DSPA 3SAPA 6CA2A 4CNXA 3V2JA 1YDCA 4RH2A 4XE1A 4ITOA 5CLUA 3RZ5A 4QSIA 3V3HB 5JG5B 4HEZA 4YGFA 4GL1X 3U45X 3OKVA 1BCDA 1UGCA 2FOQA 3CZVA 1CNBA 2HL4A 3DBUA 5EZTX 3IBNA 5FLSA 1CINA 3RZ8A 5G0BA 5DSQA 2WD3A 4RFCA 4ZWXA 1TEUX 5BNLA 1CNJA 1AZMA 3V3IB 2FNKA 2HFWA 1CZMA 2Q1QA 2Q38A 5DSJA 5J8ZA 3VBDA 5BRVA 1UGBA 4KV0A 3S75B 4BCWA 1UGAA 4WW6A 5E28A 2FOUA 4QJPA 3DV7A 5E2NA 5EKMA 3S72B 1CAKA 3ML2A 2NMXA 3RJ7A 1CNCA 3B1BA 1OKLA 1HUGA 1G46A 5DSLA 1G4OA 1G53A 1BN1A 4Q6EA 1J9WA 5SZ4A 1IF4A 4RUYA 5EHVA 3T83A 4FVNA 5DSOA 4ZWIA 4Q83A 3NB5A 3F8EA 1CVDA 1FR4A 3DA2A 1V9IC 5SZ0A 8CA2A 4QJWA 2NNSA 3MNJA 5DOHA 3K34A 5SZ2A 3KWAA 5FLOA 4YYTA 2ABEA 4PYYA 4ILXA 3U7CA 1IF8A 3DVCA 5CACA 2IT4A 1RZBA 3BETA 1CVHA 3S8XA 1G3ZA 1CA3A 1V9EA 3C7PA 3FW3A 1I9NA 1YDAA 3OKUA 1ZFQA 1FQRA 4FRCA 4JS6A 2CBEA 3DVBA 1Z97A 3ZP9A 4CNRA 4CNWA 1ZSAA 1TG9A 5BYIA 1IF5A 3M14A 1UGGA 3HLJA 5G03A 4RIUA 1RJ5A 1OQ5A 3D0NA 5DRSA 4R5AA 3M3XA 2NWYA 3DC9A 1G54A 3UYQA 2EU2A 1DMXA 3JXGA 1CAZA 4ITPA 2FW4A 1XPZA 4K13A 1G52A 1MOOA 3M1KA 1YDBA 4KNIA 4YVYA 2OSFA 3V7XA 5SZ1A 4FVOA 4E3DA 4XIWA 1G48A 5FNMA 3S97A 4E3FA 3LXEA 4YX4A 4FIKA 1FQNA 4WUPA 5IPZA 4Z0QA 4QJMA 5AMLA 1I9QA 1ZH9A 3ZNCA 3S77B 5FLTA 4MLXA 1HCBA 1KWQA 5FL4A 3S73B 3MHOA 1AM6A 1T9NA 2HKKA 1ZGEA 3M96A 5EHWA 4CQ0A 1CRMA 5FNKA 3S71B 3K7KA 3M1WA 3T84A 3JXHC 2FOVA 4Q7PA 3QYKA 4Q81A 3M98A 1KEQA 5JEPB 3MHCA 3TMJA 5AMGA 4RFDA 2NN7A 1IF7A 1LUGA 2ZNCA 2FOYA 3P55A 5G0CA 1CVAA 3T82A 1TTMA 1CNXA 4HEWA 1CAYA 3ML5A 1CAIA 1A42A 3F4XA 1RAZA 3RGEA 4HF3A 4E5QA 2FOSA 3MMFA 1BNMA 3KKXA 5SZ6A 1UGEA 4QIYA 3NI5A 1LG5A 3HS4A 1XEGA 3MZCA 4Y0JA 4M2VA 4Q87A 4LU3A 3RG3A 3RG4A 3FE4A 4Q9YA 4FPTA 2NXSA 3DVDA 4XIXA 2NXTA 5E2RA 1IF9A 3Q31A 1BV3A 5SZ3A 5EIJA 3W6HA 3OIKA 4PYXA 3IGPA 4Q7VA 1BZMA 3KOKA 2GD8A 4BF1A 2WEHA 1G0EA 4QK1A 4YXIA 4KP8A 1CAMA 4BF6A 3JXFA 3V2MA 1YO0A 3RZ1B 2CABA 2POUA 1CNYA 4TWLA 5JGSB 4R5BA 1ZFKA 1HUHA 2AW1A 4R59A 5E2SA 5G01A 3OY0A 3DCWA 1BN3A 1CVEA 3D8WA 3DD8A 3IBIA 4Q08A 4QIZA 5FNGA 1URTA 3V3FA 1H4NA 1CAOA 3HFPA 4CA2A 4Z1EA 1RZEA 3GZ0A 3MNKA 4HT0A 1FR7A 3BL0A 5AMDA 4C3TA 1BNVA 4Z1KA 4K0SA 5A6HA 5EKJA 5L3OA 3HKUA 3M5TA 3DAZA 4MLTA 3EFTA 5DOGA 3FFPX 5E2KA 1DCAA 1TEQX 1THKA 3N4BA 3D92A 3KONA 3CA2A 1FSNA 3SBHA 5FLRA 3S74B 4YGLA 5JQ0A 3TVNX 3CAJA 4JSZA 1BN4A 2VVBX 4RIVA 4MDLA 4M2UA 3SBIA 1ZNCA 2H4NA 3S9TA 1LGDA 3P4VA 1CA2A 3S76A 5JDVB 4G0CA 2AX2A 1ZSBA 1IF6A 3MNIA 4L5UA 2EU3A 1OKNA 3B4FA 3S78B 3P3HA 3N3JA 4Q7WA 1Z93A 1CILA 4YGKA 2POWA 4N16A 1Y7WA 1HVAA 1ZE8A 1TE3X 4KNJA 1CRAA 4JSAA 3KOIA 1MUAA 5EH8A 3T85A 4E4AA 3OYSA 1I9OA 1CVBA 5EH5A 2NNOA 1FLJA 4HT2A 5EKHA 5FL6A 1CNIA 4G7AA 5FLPA 4DZ9A 3M67A 4QSAA 5E5RA 2HOCA 2X7UA 4ZX1A 4Q6DA 1AVNA 3RYZA 1KOQA 3F7BA 4KNNA 3D93A 4PQ7A 1I8ZA 3RYYA 3RZ0B 1OKMA 5BRUA 2QO8A 3U3AX 2F14A 2H15A 4X5SA 1CANA 1G4JA 5EOIA 2X7TA 2NXRA 3L14A 4RN4A 4JSSA 1TH9A 3SAXA 3M40A 1BICA 1CCSA 1FSQA 2WD2A 3HKNA 2QOAA 3KIGA 4KUYA 3PO6A 3RYVB 2CBBA 1DCBA 1YDDA 4KUVA 4ZX0A 1FQMA 1I9LA 3IAIA 2NWPA 3P3JA 1JV0A 4WL4A 1G6VA 1HEBA 3M2XA 1I9MA 2ILIA 4Q99A 4QJXA 2CBCA 1YO1A 2O4ZA 1BNWA 4ZWZA 4L5VA 2HD6A 2W2JA 3RLDA 1RZCA 2NNVA 2WEJA 2X7SA 5JG3B 4XZ5A 4E9OX 1I90A 3MNUA 1CNGA 4YGNA 1CVFA 7CA2A 4UOVA 2NN1A 1DMYA 3M5EA 3P58A 5FDIA 3MHLA 1CAJA 4QEFA 1UGFA 4Q09A 5BRWA 3M04A 4Q8ZA 1CIMA 3HKQA 5HPJA 3P5LA 4ZAOA 5JQTA 3RZ7A 1RZDA 4KAPA 4CNVA 1G1DA 4FU5A 4QY3A 1LG6A 4IWZA 3W6IA 5DSRA 3N0NA 3MNAA 4YGJA 3P44A 1BNNA 3BL1A 1I91A 1TG3A 3D9ZA 4K0ZA 5DSIA 1BNQA 1EOUA 1G45A 3DCCA 2Q1BA 4Q90A 5C8IA 1CCTA 3UYNA 3OIMA 3M5SA 4N0XB 3MHIA 1I9PA 4M2RA 1H9QA 4FL7A 4QSBA 4WUQA 3HKTA 4QJ0A 4CACA 5CJFA 5A25A 4Q7SA 4YXOA 3KNEA 4QK3A 4QSJA 4RUZA 1UGDA 1CALA 1RAYA 3CYUA 4Z1JA 1TBTX 4Q49A 2WEGA 2GEHA 1HCAA 5FNLA 4M2WA 3OYQA 1KWRA 5E2MA 1ZGFA 4ETQC 3TVOX 5DSKA 3V5GA 3KS3A 4E3GA 3MWOA 4YWPA 5JESB 4YHAA 2FNNA 1CCUA 4QK2A 3MNHA 2HNCA 1XQ0A 1H9NA 5EH7A 4QTLA 3M1QA 4PXXA 3M2NA 4HBAA 4MDGA 12CAA 3F7UA 4IDRX 1KOPA 4K1QA 4TWMA 1HECA 4YXUA 1CNHA 1CAHA 1CNWA 5FNIA 1YO2A 2CA2A 3MYQA 2CBDA 4Q06A 1FSRA 1TB0X 1JD0A 4DZ7A 4Q8YA 1ZSCA 3KLDB 4RUXA 4LHIA 3M2ZA 3DD0A 1FQLA 3MHMA 4E49A 4WW8A 2NWOA 2WEOA 5SZ5A 2FMGA 1CNKA 4ZWYA 5FL5A 4KNMA 3PJJA 3U47A 2NWZA 4Q0LA 1HEAA 2OSMA 5DSMA 2NNGA 1CVCA 2CBAA 3M1JA 4Q78A 5EHEA 1Z9YA 5CA2A 5LMDA 3T5UA 5JGTB 4LP6A 9CA2A 3DC3A 3IBLA 5E5UA 5DVXA 2FNMA 3K2FA 3M2YA 1G0FA 4HU1A 2EZ7A 4QJOA 3MDZA 1HEDA 5JEHB 3N2PA 3OILA 4WR7A 1LZVA 3IEOA 2VVAX 3R16A 4KP5A 4MO8A 5JEGB 3NJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FDC A;  4PZH A;  5FNJ A;  5DSN A;  4COQ A;  4E3H A;  1F2W A;  1XEV A;  3IBU A;  2QP6 A;  4HEY A;  3PYK A;  1BNU A;  4JSW A;  4MTY A;  5FLQ A;  4L5W A;  4XFW A;  1JCZ A;  4K0T A;  4Q07 A;  2POV A;  3V3G B;  3DCS A;  3EFI A;  5FNH A;  3R17 B;  4MDM A;  3T5Z A;  4Q8X A;  3RYJ B;  5SZ7 A;  4KUW A;  3V3J A;  3RYX B;  1BNT A;  1RJ6 A;  3P5A A;  5L6K A;  1RZA A;  4Z1N A;  2FMZ A;  5DSP A;  3SAP A;  6CA2 A;  4CNX A;  3V2J A;  1YDC A;  4RH2 A;  4XE1 A;  4ITO A;  5CLU A;  3RZ5 A;  4QSI A;  3V3H B;  5JG5 B;  4HEZ A;  4YGF A;  4GL1 X;  3U45 X;  3OKV A;  1BCD A;  1UGC A;  2FOQ A;  3CZV A;  1CNB A;  2HL4 A;  3DBU A;  5EZT X;  3IBN A;  5FLS A;  1CIN A;  3RZ8 A;  5G0B A;  5DSQ A;  2WD3 A;  4RFC A;  4ZWX A;  1TEU X;  5BNL A;  1CNJ A;  1AZM A;  3V3I B;  2FNK A;  2HFW A;  1CZM A;  2Q1Q A;  2Q38 A;  5DSJ A;  5J8Z A;  3VBD A;  5BRV A;  1UGB A;  4KV0 A;  3S75 B;  4BCW A;  1UGA A;  4WW6 A;  5E28 A;  2FOU A;  4QJP A;  3DV7 A;  5E2N A;  5EKM A;  3S72 B;  1CAK A;  3ML2 A;  2NMX A;  3RJ7 A;  1CNC A;  3B1B A;  1OKL A;  1HUG A;  1G46 A;  5DSL A;  1G4O A;  1G53 A;  1BN1 A;  4Q6E A;  1J9W A;  5SZ4 A;  1IF4 A;  4RUY A;  5EHV A;  3T83 A;  4FVN A;  5DSO A;  4ZWI A;  4Q83 A;  3NB5 A;  3F8E A;  1CVD A;  1FR4 A;  3DA2 A;  1V9I C;  5SZ0 A;  8CA2 A;  4QJW A;  2NNS A;  3MNJ A;  5DOH A;  3K34 A;  5SZ2 A;  3KWA A;  5FLO A;  4YYT A;  2ABE A;  4PYY A;  4ILX A;  3U7C A;  1IF8 A;  3DVC A;  5CAC A;  2IT4 A;  1RZB A;  3BET A;  1CVH A;  3S8X A;  1G3Z A;  1CA3 A;  1V9E A;  3C7P A;  3FW3 A;  1I9N A;  1YDA A;  3OKU A;  1ZFQ A;  1FQR A;  4FRC A;  4JS6 A;  2CBE A;  3DVB A;  1Z97 A;  3ZP9 A;  4CNR A;  4CNW A;  1ZSA A;  1TG9 A;  5BYI A;  1IF5 A;  3M14 A;  1UGG A;  3HLJ A;  5G03 A;  4RIU A;  1RJ5 A;  1OQ5 A;  3D0N A;  5DRS A;  4R5A A;  3M3X A;  2NWY A;  3DC9 A;  1G54 A;  3UYQ A;  2EU2 A;  1DMX A;  3JXG A;  1CAZ A;  4ITP A;  2FW4 A;  1XPZ A;  4K13 A;  1G52 A;  1MOO A;  3M1K A;  1YDB A;  4KNI A;  4YVY A;  2OSF A;  3V7X A;  5SZ1 A;  4FVO A;  4E3D A;  4XIW A;  1G48 A;  5FNM A;  3S97 A;  4E3F A;  3LXE A;  4YX4 A;  4FIK A;  1FQN A;  4WUP A;  5IPZ A;  4Z0Q A;  4QJM A;  5AML A;  1I9Q A;  1ZH9 A;  3ZNC A;  3S77 B;  5FLT A;  4MLX A;  1HCB A;  1KWQ A;  5FL4 A;  3S73 B;  3MHO A;  1AM6 A;  1T9N A;  2HKK A;  1ZGE A;  3M96 A;  5EHW A;  4CQ0 A;  1CRM A;  5FNK A;  3S71 B;  3K7K A;  3M1W A;  3T84 A;  3JXH C;  2FOV A;  4Q7P A;  3QYK A;  4Q81 A;  3M98 A;  1KEQ A;  5JEP B;  3MHC A;  3TMJ A;  5AMG A;  4RFD A;  2NN7 A;  1IF7 A;  1LUG A;  2ZNC A;  2FOY A;  3P55 A;  5G0C A;  1CVA A;  3T82 A;  1TTM A;  1CNX A;  4HEW A;  1CAY A;  3ML5 A;  1CAI A;  1A42 A;  3F4X A;  1RAZ A;  3RGE A;  4HF3 A;  4E5Q A;  2FOS A;  3MMF A;  1BNM A;  3KKX A;  5SZ6 A;  1UGE A;  4QIY A;  3NI5 A;  1LG5 A;  3HS4 A;  1XEG A;  3MZC A;  4Y0J A;  4M2V A;  4Q87 A;  4LU3 A;  3RG3 A;  3RG4 A;  3FE4 A;  4Q9Y A;  4FPT A;  2NXS A;  3DVD A;  4XIX A;  2NXT A;  5E2R A;  1IF9 A;  3Q31 A;  1BV3 A;  5SZ3 A;  5EIJ A;  3W6H A;  3OIK A;  4PYX A;  3IGP A;  4Q7V A;  1BZM A;  3KOK A;  2GD8 A;  4BF1 A;  2WEH A;  1G0E A;  4QK1 A;  4YXI A;  4KP8 A;  1CAM A;  4BF6 A;  3JXF A;  3V2M A;  1YO0 A;  3RZ1 B;  2CAB A;  2POU A;  1CNY A;  4TWL A;  5JGS B;  4R5B A;  1ZFK A;  1HUH A;  2AW1 A;  4R59 A;  5E2S A;  5G01 A;  3OY0 A;  3DCW A;  1BN3 A;  1CVE A;  3D8W A;  3DD8 A;  3IBI A;  4Q08 A;  4QIZ A;  5FNG A;  1URT A;  3V3F A;  1H4N A;  1CAO A;  3HFP A;  4CA2 A;  4Z1E A;  1RZE A;  3GZ0 A;  3MNK A;  4HT0 A;  1FR7 A;  3BL0 A;  5AMD A;  4C3T A;  1BNV A;  4Z1K A;  4K0S A;  5A6H A;  5EKJ A;  5L3O A;  3HKU A;  3M5T A;  3DAZ A;  4MLT A;  3EFT A;  5DOG A;  3FFP X;  5E2K A;  1DCA A;  1TEQ X;  1THK A;  3N4B A;  3D92 A;  3KON A;  3CA2 A;  1FSN A;  3SBH A;  5FLR A;  3S74 B;  4YGL A;  5JQ0 A;  3TVN X;  3CAJ A;  4JSZ A;  1BN4 A;  2VVB X;  4RIV A;  4MDL A;  4M2U A;  3SBI A;  1ZNC A;  2H4N A;  3S9T A;  1LGD A;  3P4V A;  1CA2 A;  3S76 A;  5JDV B;  4G0C A;  2AX2 A;  1ZSB A;  1IF6 A;  3MNI A;  4L5U A;  2EU3 A;  1OKN A;  3B4F A;  3S78 B;  3P3H A;  3N3J A;  4Q7W A;  1Z93 A;  1CIL A;  4YGK A;  2POW A;  4N16 A;  1Y7W A;  1HVA A;  1ZE8 A;  1TE3 X;  4KNJ A;  1CRA A;  4JSA A;  3KOI A;  1MUA A;  5EH8 A;  3T85 A;  4E4A A;  3OYS A;  1I9O A;  1CVB A;  5EH5 A;  2NNO A;  1FLJ A;  4HT2 A;  5EKH A;  5FL6 A;  1CNI A;  4G7A A;  5FLP A;  4DZ9 A;  3M67 A;  4QSA A;  5E5R A;  2HOC A;  2X7U A;  4ZX1 A;  4Q6D A;  1AVN A;  3RYZ A;  1KOQ A;  3F7B A;  4KNN A;  3D93 A;  4PQ7 A;  1I8Z A;  3RYY A;  3RZ0 B;  1OKM A;  5BRU A;  2QO8 A;  3U3A X;  2F14 A;  2H15 A;  4X5S A;  1CAN A;  1G4J A;  5EOI A;  2X7T A;  2NXR A;  3L14 A;  4RN4 A;  4JSS A;  1TH9 A;  3SAX A;  3M40 A;  1BIC A;  1CCS A;  1FSQ A;  2WD2 A;  3HKN A;  2QOA A;  3KIG A;  4KUY A;  3PO6 A;  3RYV B;  2CBB A;  1DCB A;  1YDD A;  4KUV A;  4ZX0 A;  1FQM A;  1I9L A;  3IAI A;  2NWP A;  3P3J A;  1JV0 A;  4WL4 A;  1G6V A;  1HEB A;  3M2X A;  1I9M A;  2ILI A;  4Q99 A;  4QJX A;  2CBC A;  1YO1 A;  2O4Z A;  1BNW A;  4ZWZ A;  4L5V A;  2HD6 A;  2W2J A;  3RLD A;  1RZC A;  2NNV A;  2WEJ A;  2X7S A;  5JG3 B;  4XZ5 A;  4E9O X;  1I90 A;  3MNU A;  1CNG A;  4YGN A;  1CVF A;  7CA2 A;  4UOV A;  2NN1 A;  1DMY A;  3M5E A;  3P58 A;  5FDI A;  3MHL A;  1CAJ A;  4QEF A;  1UGF A;  4Q09 A;  5BRW A;  3M04 A;  4Q8Z A;  1CIM A;  3HKQ A;  5HPJ A;  3P5L A;  4ZAO A;  5JQT A;  3RZ7 A;  1RZD A;  4KAP A;  4CNV A;  1G1D A;  4FU5 A;  4QY3 A;  1LG6 A;  4IWZ A;  3W6I A;  5DSR A;  3N0N A;  3MNA A;  4YGJ A;  3P44 A;  1BNN A;  3BL1 A;  1I91 A;  1TG3 A;  3D9Z A;  4K0Z A;  5DSI A;  1BNQ A;  1EOU A;  1G45 A;  3DCC A;  2Q1B A;  4Q90 A;  5C8I A;  1CCT A;  3UYN A;  3OIM A;  3M5S A;  4N0X B;  3MHI A;  1I9P A;  4M2R A;  1H9Q A;  4FL7 A;  4QSB A;  4WUQ A;  3HKT A;  4QJ0 A;  4CAC A;  5CJF A;  5A25 A;  4Q7S A;  4YXO A;  3KNE A;  4QK3 A;  4QSJ A;  4RUZ A;  1UGD A;  1CAL A;  1RAY A;  3CYU A;  4Z1J A;  1TBT X;  4Q49 A;  2WEG A;  2GEH A;  1HCA A;  5FNL A;  4M2W A;  3OYQ A;  1KWR A;  5E2M A;  1ZGF A;  4ETQ C;  3TVO X;  5DSK A;  3V5G A;  3KS3 A;  4E3G A;  3MWO A;  4YWP A;  5JES B;  4YHA A;  2FNN A;  1CCU A;  4QK2 A;  3MNH A;  2HNC A;  1XQ0 A;  1H9N A;  5EH7 A;  4QTL A;  3M1Q A;  4PXX A;  3M2N A;  4HBA A;  4MDG A;  12CA A;  3F7U A;  4IDR X;  1KOP A;  4K1Q A;  4TWM A;  1HEC A;  4YXU A;  1CNH A;  1CAH A;  1CNW A;  5FNI A;  1YO2 A;  2CA2 A;  3MYQ A;  2CBD A;  4Q06 A;  1FSR A;  1TB0 X;  1JD0 A;  4DZ7 A;  4Q8Y A;  1ZSC A;  3KLD B;  4RUX A;  4LHI A;  3M2Z A;  3DD0 A;  1FQL A;  3MHM A;  4E49 A;  4WW8 A;  2NWO A;  2WEO A;  5SZ5 A;  2FMG A;  1CNK A;  4ZWY A;  5FL5 A;  4KNM A;  3PJJ A;  3U47 A;  2NWZ A;  4Q0L A;  1HEA A;  2OSM A;  5DSM A;  2NNG A;  1CVC A;  2CBA A;  3M1J A;  4Q78 A;  5EHE A;  1Z9Y A;  5CA2 A;  5LMD A;  3T5U A;  5JGT B;  4LP6 A;  9CA2 A;  3DC3 A;  3IBL A;  5E5U A;  5DVX A;  2FNM A;  3K2F A;  3M2Y A;  1G0F A;  4HU1 A;  2EZ7 A;  4QJO A;  3MDZ A;  1HED A;  5JEH B;  3N2P A;  3OIL A;  4WR7 A;  1LZV A;  3IEO A;  2VVA X;  3R16 A;  4KP5 A;  4MO8 A;  5JEG B;  3NJ9 A; 
#chains in the Genus database with same CATH topology
 5FDC A;  4PZH A;  5FNJ A;  5DSN A;  4COQ A;  4E3H A;  1F2W A;  1XEV A;  3IBU A;  2QP6 A;  4HEY A;  3PYK A;  1BNU A;  4JSW A;  4MTY A;  5FLQ A;  4L5W A;  4XFW A;  1JCZ A;  4K0T A;  4Q07 A;  2POV A;  3V3G B;  3DCS A;  3EFI A;  5FNH A;  3R17 B;  4MDM A;  3T5Z A;  4Q8X A;  3RYJ B;  5SZ7 A;  4KUW A;  3V3J A;  3RYX B;  1BNT A;  1RJ6 A;  3P5A A;  5L6K A;  1RZA A;  4Z1N A;  2FMZ A;  5DSP A;  3SAP A;  6CA2 A;  4CNX A;  3V2J A;  1YDC A;  4RH2 A;  4XE1 A;  4ITO A;  5CLU A;  3RZ5 A;  4QSI A;  3V3H B;  5JG5 B;  4HEZ A;  4YGF A;  4GL1 X;  3U45 X;  3OKV A;  1BCD A;  1UGC A;  2FOQ A;  3CZV A;  1CNB A;  2HL4 A;  3DBU A;  5EZT X;  3IBN A;  5FLS A;  1CIN A;  3RZ8 A;  5G0B A;  5DSQ A;  2WD3 A;  4RFC A;  4ZWX A;  1TEU X;  5BNL A;  1CNJ A;  1AZM A;  3V3I B;  2FNK A;  2HFW A;  1CZM A;  2Q1Q A;  2Q38 A;  5DSJ A;  5J8Z A;  3VBD A;  5BRV A;  1UGB A;  4KV0 A;  3S75 B;  4BCW A;  1UGA A;  4WW6 A;  5E28 A;  2FOU A;  4QJP A;  3DV7 A;  5E2N A;  5EKM A;  3S72 B;  1CAK A;  3ML2 A;  2NMX A;  3RJ7 A;  1CNC A;  3B1B A;  1OKL A;  1HUG A;  1G46 A;  5DSL A;  1G4O A;  1G53 A;  1BN1 A;  4Q6E A;  1J9W A;  5SZ4 A;  1IF4 A;  4RUY A;  5EHV A;  3T83 A;  4FVN A;  5DSO A;  4ZWI A;  4Q83 A;  3NB5 A;  3F8E A;  1CVD A;  1FR4 A;  3DA2 A;  1V9I C;  5SZ0 A;  8CA2 A;  4QJW A;  2NNS A;  3MNJ A;  5DOH A;  3K34 A;  5SZ2 A;  3KWA A;  5FLO A;  4YYT A;  2ABE A;  4PYY A;  4ILX A;  3U7C A;  1IF8 A;  3DVC A;  5CAC A;  2IT4 A;  1RZB A;  3BET A;  1CVH A;  3S8X A;  1G3Z A;  1CA3 A;  1V9E A;  3C7P A;  3FW3 A;  1I9N A;  1YDA A;  3OKU A;  1ZFQ A;  1FQR A;  4FRC A;  4JS6 A;  2CBE A;  3DVB A;  1Z97 A;  3ZP9 A;  4CNR A;  4CNW A;  1ZSA A;  1TG9 A;  5BYI A;  1IF5 A;  3M14 A;  1UGG A;  3HLJ A;  5G03 A;  4RIU A;  1RJ5 A;  1OQ5 A;  3D0N A;  5DRS A;  4R5A A;  3M3X A;  2NWY A;  3DC9 A;  1G54 A;  3UYQ A;  2EU2 A;  1DMX A;  3JXG A;  1CAZ A;  4ITP A;  2FW4 A;  1XPZ A;  4K13 A;  1G52 A;  1MOO A;  3M1K A;  1YDB A;  4KNI A;  4YVY A;  2OSF A;  3V7X A;  5SZ1 A;  4FVO A;  4E3D A;  4XIW A;  1G48 A;  5FNM A;  3S97 A;  4E3F A;  3LXE A;  4YX4 A;  4FIK A;  1FQN A;  4WUP A;  5IPZ A;  4Z0Q A;  4QJM A;  5AML A;  1I9Q A;  1ZH9 A;  3ZNC A;  3S77 B;  5FLT A;  4MLX A;  1HCB A;  1KWQ A;  5FL4 A;  3S73 B;  3MHO A;  1AM6 A;  1T9N A;  2HKK A;  1ZGE A;  3M96 A;  5EHW A;  4CQ0 A;  1CRM A;  5FNK A;  3S71 B;  3K7K A;  3M1W A;  3T84 A;  3JXH C;  2FOV A;  4Q7P A;  3QYK A;  4Q81 A;  3M98 A;  1KEQ A;  5JEP B;  3MHC A;  3TMJ A;  5AMG A;  4RFD A;  2NN7 A;  1IF7 A;  1LUG A;  2ZNC A;  2FOY A;  3P55 A;  5G0C A;  1CVA A;  3T82 A;  1TTM A;  1CNX A;  4HEW A;  1CAY A;  3ML5 A;  1CAI A;  1A42 A;  3F4X A;  1RAZ A;  3RGE A;  4HF3 A;  4E5Q A;  2FOS A;  3MMF A;  1BNM A;  3KKX A;  5SZ6 A;  1UGE A;  4QIY A;  3NI5 A;  1LG5 A;  3HS4 A;  1XEG A;  3MZC A;  4Y0J A;  4M2V A;  4Q87 A;  4LU3 A;  3RG3 A;  3RG4 A;  3FE4 A;  4Q9Y A;  4FPT A;  2NXS A;  3DVD A;  4XIX A;  2NXT A;  5E2R A;  1IF9 A;  3Q31 A;  1BV3 A;  5SZ3 A;  5EIJ A;  3W6H A;  3OIK A;  4PYX A;  3IGP A;  4Q7V A;  1BZM A;  3KOK A;  2GD8 A;  4BF1 A;  2WEH A;  1G0E A;  4QK1 A;  4YXI A;  4KP8 A;  1CAM A;  4BF6 A;  3JXF A;  3V2M A;  1YO0 A;  3RZ1 B;  2CAB A;  2POU A;  1CNY A;  4TWL A;  5JGS B;  4R5B A;  1ZFK A;  1HUH A;  2AW1 A;  4R59 A;  5E2S A;  5G01 A;  3OY0 A;  3DCW A;  1BN3 A;  1CVE A;  3D8W A;  3DD8 A;  3IBI A;  4Q08 A;  4QIZ A;  5FNG A;  1URT A;  3V3F A;  1H4N A;  1CAO A;  3HFP A;  4CA2 A;  4Z1E A;  1RZE A;  3GZ0 A;  3MNK A;  4HT0 A;  1FR7 A;  3BL0 A;  5AMD A;  4C3T A;  1BNV A;  4Z1K A;  4K0S A;  5A6H A;  5EKJ A;  5L3O A;  3HKU A;  3M5T A;  3DAZ A;  4MLT A;  3EFT A;  5DOG A;  3FFP X;  5E2K A;  1DCA A;  1TEQ X;  1THK A;  3N4B A;  3D92 A;  3KON A;  3CA2 A;  1FSN A;  3SBH A;  5FLR A;  3S74 B;  4YGL A;  5JQ0 A;  3TVN X;  3CAJ A;  4JSZ A;  1BN4 A;  2VVB X;  4RIV A;  4MDL A;  4M2U A;  3SBI A;  1ZNC A;  2H4N A;  3S9T A;  1LGD A;  3P4V A;  1CA2 A;  3S76 A;  5JDV B;  4G0C A;  2AX2 A;  1ZSB A;  1IF6 A;  3MNI A;  4L5U A;  2EU3 A;  1OKN A;  3B4F A;  3S78 B;  3P3H A;  3N3J A;  4Q7W A;  1Z93 A;  1CIL A;  4YGK A;  2POW A;  4N16 A;  1Y7W A;  1HVA A;  1ZE8 A;  1TE3 X;  4KNJ A;  1CRA A;  4JSA A;  3KOI A;  1MUA A;  5EH8 A;  3T85 A;  4E4A A;  3OYS A;  1I9O A;  1CVB A;  5EH5 A;  2NNO A;  1FLJ A;  4HT2 A;  5EKH A;  5FL6 A;  1CNI A;  4G7A A;  5FLP A;  4DZ9 A;  3M67 A;  4QSA A;  5E5R A;  2HOC A;  2X7U A;  4ZX1 A;  4Q6D A;  1AVN A;  3RYZ A;  1KOQ A;  3F7B A;  4KNN A;  3D93 A;  4PQ7 A;  1I8Z A;  3RYY A;  3RZ0 B;  1OKM A;  5BRU A;  2QO8 A;  3U3A X;  2F14 A;  2H15 A;  4X5S A;  1CAN A;  1G4J A;  5EOI A;  2X7T A;  2NXR A;  3L14 A;  4RN4 A;  4JSS A;  1TH9 A;  3SAX A;  3M40 A;  1BIC A;  1CCS A;  1FSQ A;  2WD2 A;  3HKN A;  2QOA A;  3KIG A;  4KUY A;  3PO6 A;  3RYV B;  2CBB A;  1DCB A;  1YDD A;  4KUV A;  4ZX0 A;  1FQM A;  1I9L A;  3IAI A;  2NWP A;  3P3J A;  1JV0 A;  4WL4 A;  1G6V A;  1HEB A;  3M2X A;  1I9M A;  2ILI A;  4Q99 A;  4QJX A;  2CBC A;  1YO1 A;  2O4Z A;  1BNW A;  4ZWZ A;  4L5V A;  2HD6 A;  2W2J A;  3RLD A;  1RZC A;  2NNV A;  2WEJ A;  2X7S A;  5JG3 B;  4XZ5 A;  4E9O X;  1I90 A;  3MNU A;  1CNG A;  4YGN A;  1CVF A;  7CA2 A;  4UOV A;  2NN1 A;  1DMY A;  3M5E A;  3P58 A;  5FDI A;  3MHL A;  1CAJ A;  4QEF A;  1UGF A;  4Q09 A;  5BRW A;  3M04 A;  4Q8Z A;  1CIM A;  3HKQ A;  5HPJ A;  3P5L A;  4ZAO A;  5JQT A;  3RZ7 A;  1RZD A;  4KAP A;  4CNV A;  1G1D A;  4FU5 A;  4QY3 A;  1LG6 A;  4IWZ A;  3W6I A;  5DSR A;  3N0N A;  3MNA A;  4YGJ A;  3P44 A;  1BNN A;  3BL1 A;  1I91 A;  1TG3 A;  3D9Z A;  4K0Z A;  5DSI A;  1BNQ A;  1EOU A;  1G45 A;  3DCC A;  2Q1B A;  4Q90 A;  5C8I A;  1CCT A;  3UYN A;  3OIM A;  3M5S A;  4N0X B;  3MHI A;  1I9P A;  4M2R A;  1H9Q A;  4FL7 A;  4QSB A;  4WUQ A;  3HKT A;  4QJ0 A;  4CAC A;  5CJF A;  5A25 A;  4Q7S A;  4YXO A;  3KNE A;  4QK3 A;  4QSJ A;  4RUZ A;  1UGD A;  1CAL A;  1RAY A;  3CYU A;  4Z1J A;  1TBT X;  4Q49 A;  2WEG A;  2GEH A;  1HCA A;  5FNL A;  4M2W A;  3OYQ A;  1KWR A;  5E2M A;  1ZGF A;  4ETQ C;  3TVO X;  5DSK A;  3V5G A;  3KS3 A;  4E3G A;  3MWO A;  4YWP A;  5JES B;  4YHA A;  2FNN A;  1CCU A;  4QK2 A;  3MNH A;  2HNC A;  1XQ0 A;  1H9N A;  5EH7 A;  4QTL A;  3M1Q A;  4PXX A;  3M2N A;  4HBA A;  4MDG A;  12CA A;  3F7U A;  4IDR X;  1KOP A;  4K1Q A;  4TWM A;  1HEC A;  4YXU A;  1CNH A;  1CAH A;  1CNW A;  5FNI A;  1YO2 A;  2CA2 A;  3MYQ A;  2CBD A;  4Q06 A;  1FSR A;  1TB0 X;  1JD0 A;  4DZ7 A;  4Q8Y A;  1ZSC A;  3KLD B;  4RUX A;  4LHI A;  3M2Z A;  3DD0 A;  1FQL A;  3MHM A;  4E49 A;  4WW8 A;  2NWO A;  2WEO A;  5SZ5 A;  2FMG A;  1CNK A;  4ZWY A;  5FL5 A;  4KNM A;  3PJJ A;  3U47 A;  2NWZ A;  4Q0L A;  1HEA A;  2OSM A;  5DSM A;  2NNG A;  1CVC A;  2CBA A;  3M1J A;  4Q78 A;  5EHE A;  1Z9Y A;  5CA2 A;  5LMD A;  3T5U A;  5JGT B;  4LP6 A;  9CA2 A;  3DC3 A;  3IBL A;  5E5U A;  5DVX A;  2FNM A;  3K2F A;  3M2Y A;  1G0F A;  4HU1 A;  2EZ7 A;  4QJO A;  3MDZ A;  1HED A;  5JEH B;  3N2P A;  3OIL A;  4WR7 A;  1LZV A;  3IEO A;  2VVA X;  3R16 A;  4KP5 A;  4MO8 A;  5JEG B;  3NJ9 A; 
#chains in the Genus database with same CATH homology
 5FDC A;  4PZH A;  5FNJ A;  5DSN A;  4COQ A;  4E3H A;  1F2W A;  1XEV A;  3IBU A;  2QP6 A;  4HEY A;  3PYK A;  1BNU A;  4JSW A;  4MTY A;  5FLQ A;  4L5W A;  4XFW A;  1JCZ A;  4K0T A;  4Q07 A;  2POV A;  3V3G B;  3DCS A;  3EFI A;  5FNH A;  3R17 B;  4MDM A;  3T5Z A;  4Q8X A;  3RYJ B;  5SZ7 A;  4KUW A;  3V3J A;  3RYX B;  1BNT A;  1RJ6 A;  3P5A A;  5L6K A;  1RZA A;  4Z1N A;  2FMZ A;  5DSP A;  3SAP A;  6CA2 A;  4CNX A;  3V2J A;  1YDC A;  4RH2 A;  4XE1 A;  4ITO A;  5CLU A;  3RZ5 A;  4QSI A;  3V3H B;  5JG5 B;  4HEZ A;  4YGF A;  4GL1 X;  3U45 X;  3OKV A;  1BCD A;  1UGC A;  2FOQ A;  3CZV A;  1CNB A;  2HL4 A;  3DBU A;  5EZT X;  3IBN A;  5FLS A;  1CIN A;  3RZ8 A;  5G0B A;  5DSQ A;  2WD3 A;  4RFC A;  4ZWX A;  1TEU X;  5BNL A;  1CNJ A;  1AZM A;  3V3I B;  2FNK A;  2HFW A;  1CZM A;  2Q1Q A;  2Q38 A;  5DSJ A;  5J8Z A;  3VBD A;  5BRV A;  1UGB A;  4KV0 A;  3S75 B;  4BCW A;  1UGA A;  4WW6 A;  5E28 A;  2FOU A;  4QJP A;  3DV7 A;  5E2N A;  5EKM A;  3S72 B;  1CAK A;  3ML2 A;  2NMX A;  3RJ7 A;  1CNC A;  3B1B A;  1OKL A;  1HUG A;  1G46 A;  5DSL A;  1G4O A;  1G53 A;  1BN1 A;  4Q6E A;  1J9W A;  5SZ4 A;  1IF4 A;  4RUY A;  5EHV A;  3T83 A;  4FVN A;  5DSO A;  4ZWI A;  4Q83 A;  3NB5 A;  3F8E A;  1CVD A;  1FR4 A;  3DA2 A;  1V9I C;  5SZ0 A;  8CA2 A;  4QJW A;  2NNS A;  3MNJ A;  5DOH A;  3K34 A;  5SZ2 A;  3KWA A;  5FLO A;  4YYT A;  2ABE A;  4PYY A;  4ILX A;  3U7C A;  1IF8 A;  3DVC A;  5CAC A;  2IT4 A;  1RZB A;  3BET A;  1CVH A;  3S8X A;  1G3Z A;  1CA3 A;  1V9E A;  3C7P A;  3FW3 A;  1I9N A;  1YDA A;  3OKU A;  1ZFQ A;  1FQR A;  4FRC A;  4JS6 A;  2CBE A;  3DVB A;  1Z97 A;  3ZP9 A;  4CNR A;  4CNW A;  1ZSA A;  1TG9 A;  5BYI A;  1IF5 A;  3M14 A;  1UGG A;  3HLJ A;  5G03 A;  4RIU A;  1RJ5 A;  1OQ5 A;  3D0N A;  5DRS A;  4R5A A;  3M3X A;  2NWY A;  3DC9 A;  1G54 A;  3UYQ A;  2EU2 A;  1DMX A;  3JXG A;  1CAZ A;  4ITP A;  2FW4 A;  1XPZ A;  4K13 A;  1G52 A;  1MOO A;  3M1K A;  1YDB A;  4KNI A;  4YVY A;  2OSF A;  3V7X A;  5SZ1 A;  4FVO A;  4E3D A;  4XIW A;  1G48 A;  5FNM A;  3S97 A;  4E3F A;  3LXE A;  4YX4 A;  4FIK A;  1FQN A;  4WUP A;  5IPZ A;  4Z0Q A;  4QJM A;  5AML A;  1I9Q A;  1ZH9 A;  3ZNC A;  3S77 B;  5FLT A;  4MLX A;  1HCB A;  1KWQ A;  5FL4 A;  3S73 B;  3MHO A;  1AM6 A;  1T9N A;  2HKK A;  1ZGE A;  3M96 A;  5EHW A;  4CQ0 A;  1CRM A;  5FNK A;  3S71 B;  3K7K A;  3M1W A;  3T84 A;  3JXH C;  2FOV A;  4Q7P A;  3QYK A;  4Q81 A;  3M98 A;  1KEQ A;  5JEP B;  3MHC A;  3TMJ A;  5AMG A;  4RFD A;  2NN7 A;  1IF7 A;  1LUG A;  2ZNC A;  2FOY A;  3P55 A;  5G0C A;  1CVA A;  3T82 A;  1TTM A;  1CNX A;  4HEW A;  1CAY A;  3ML5 A;  1CAI A;  1A42 A;  3F4X A;  1RAZ A;  3RGE A;  4HF3 A;  4E5Q A;  2FOS A;  3MMF A;  1BNM A;  3KKX A;  5SZ6 A;  1UGE A;  4QIY A;  3NI5 A;  1LG5 A;  3HS4 A;  1XEG A;  3MZC A;  4Y0J A;  4M2V A;  4Q87 A;  4LU3 A;  3RG3 A;  3RG4 A;  3FE4 A;  4Q9Y A;  4FPT A;  2NXS A;  3DVD A;  4XIX A;  2NXT A;  5E2R A;  1IF9 A;  3Q31 A;  1BV3 A;  5SZ3 A;  5EIJ A;  3W6H A;  3OIK A;  4PYX A;  3IGP A;  4Q7V A;  1BZM A;  3KOK A;  2GD8 A;  4BF1 A;  2WEH A;  1G0E A;  4QK1 A;  4YXI A;  4KP8 A;  1CAM A;  4BF6 A;  3JXF A;  3V2M A;  1YO0 A;  3RZ1 B;  2CAB A;  2POU A;  1CNY A;  4TWL A;  5JGS B;  4R5B A;  1ZFK A;  1HUH A;  2AW1 A;  4R59 A;  5E2S A;  5G01 A;  3OY0 A;  3DCW A;  1BN3 A;  1CVE A;  3D8W A;  3DD8 A;  3IBI A;  4Q08 A;  4QIZ A;  5FNG A;  1URT A;  3V3F A;  1H4N A;  1CAO A;  3HFP A;  4CA2 A;  4Z1E A;  1RZE A;  3GZ0 A;  3MNK A;  4HT0 A;  1FR7 A;  3BL0 A;  5AMD A;  4C3T A;  1BNV A;  4Z1K A;  4K0S A;  5A6H A;  5EKJ A;  5L3O A;  3HKU A;  3M5T A;  3DAZ A;  4MLT A;  3EFT A;  5DOG A;  3FFP X;  5E2K A;  1DCA A;  1TEQ X;  1THK A;  3N4B A;  3D92 A;  3KON A;  3CA2 A;  1FSN A;  3SBH A;  5FLR A;  3S74 B;  4YGL A;  5JQ0 A;  3TVN X;  3CAJ A;  4JSZ A;  1BN4 A;  2VVB X;  4RIV A;  4MDL A;  4M2U A;  3SBI A;  1ZNC A;  2H4N A;  3S9T A;  1LGD A;  3P4V A;  1CA2 A;  3S76 A;  5JDV B;  4G0C A;  2AX2 A;  1ZSB A;  1IF6 A;  3MNI A;  4L5U A;  2EU3 A;  1OKN A;  3B4F A;  3S78 B;  3P3H A;  3N3J A;  4Q7W A;  1Z93 A;  1CIL A;  4YGK A;  2POW A;  4N16 A;  1Y7W A;  1HVA A;  1ZE8 A;  1TE3 X;  4KNJ A;  1CRA A;  4JSA A;  3KOI A;  1MUA A;  5EH8 A;  3T85 A;  4E4A A;  3OYS A;  1I9O A;  1CVB A;  5EH5 A;  2NNO A;  1FLJ A;  4HT2 A;  5EKH A;  5FL6 A;  1CNI A;  4G7A A;  5FLP A;  4DZ9 A;  3M67 A;  4QSA A;  5E5R A;  2HOC A;  2X7U A;  4ZX1 A;  4Q6D A;  1AVN A;  3RYZ A;  1KOQ A;  3F7B A;  4KNN A;  3D93 A;  4PQ7 A;  1I8Z A;  3RYY A;  3RZ0 B;  1OKM A;  5BRU A;  2QO8 A;  3U3A X;  2F14 A;  2H15 A;  4X5S A;  1CAN A;  1G4J A;  5EOI A;  2X7T A;  2NXR A;  3L14 A;  4RN4 A;  4JSS A;  1TH9 A;  3SAX A;  3M40 A;  1BIC A;  1CCS A;  1FSQ A;  2WD2 A;  3HKN A;  2QOA A;  3KIG A;  4KUY A;  3PO6 A;  3RYV B;  2CBB A;  1DCB A;  1YDD A;  4KUV A;  4ZX0 A;  1FQM A;  1I9L A;  3IAI A;  2NWP A;  3P3J A;  1JV0 A;  4WL4 A;  1G6V A;  1HEB A;  3M2X A;  1I9M A;  2ILI A;  4Q99 A;  4QJX A;  2CBC A;  1YO1 A;  2O4Z A;  1BNW A;  4ZWZ A;  4L5V A;  2HD6 A;  2W2J A;  3RLD A;  1RZC A;  2NNV A;  2WEJ A;  2X7S A;  5JG3 B;  4XZ5 A;  4E9O X;  1I90 A;  3MNU A;  1CNG A;  4YGN A;  1CVF A;  7CA2 A;  4UOV A;  2NN1 A;  1DMY A;  3M5E A;  3P58 A;  5FDI A;  3MHL A;  1CAJ A;  4QEF A;  1UGF A;  4Q09 A;  5BRW A;  3M04 A;  4Q8Z A;  1CIM A;  3HKQ A;  5HPJ A;  3P5L A;  4ZAO A;  5JQT A;  3RZ7 A;  1RZD A;  4KAP A;  4CNV A;  1G1D A;  4FU5 A;  4QY3 A;  1LG6 A;  4IWZ A;  3W6I A;  5DSR A;  3N0N A;  3MNA A;  4YGJ A;  3P44 A;  1BNN A;  3BL1 A;  1I91 A;  1TG3 A;  3D9Z A;  4K0Z A;  5DSI A;  1BNQ A;  1EOU A;  1G45 A;  3DCC A;  2Q1B A;  4Q90 A;  5C8I A;  1CCT A;  3UYN A;  3OIM A;  3M5S A;  4N0X B;  3MHI A;  1I9P A;  4M2R A;  1H9Q A;  4FL7 A;  4QSB A;  4WUQ A;  3HKT A;  4QJ0 A;  4CAC A;  5CJF A;  5A25 A;  4Q7S A;  4YXO A;  3KNE A;  4QK3 A;  4QSJ A;  4RUZ A;  1UGD A;  1CAL A;  1RAY A;  3CYU A;  4Z1J A;  1TBT X;  4Q49 A;  2WEG A;  2GEH A;  1HCA A;  5FNL A;  4M2W A;  3OYQ A;  1KWR A;  5E2M A;  1ZGF A;  4ETQ C;  3TVO X;  5DSK A;  3V5G A;  3KS3 A;  4E3G A;  3MWO A;  4YWP A;  5JES B;  4YHA A;  2FNN A;  1CCU A;  4QK2 A;  3MNH A;  2HNC A;  1XQ0 A;  1H9N A;  5EH7 A;  4QTL A;  3M1Q A;  4PXX A;  3M2N A;  4HBA A;  4MDG A;  12CA A;  3F7U A;  4IDR X;  1KOP A;  4K1Q A;  4TWM A;  1HEC A;  4YXU A;  1CNH A;  1CAH A;  1CNW A;  5FNI A;  1YO2 A;  2CA2 A;  3MYQ A;  2CBD A;  4Q06 A;  1FSR A;  1TB0 X;  1JD0 A;  4DZ7 A;  4Q8Y A;  1ZSC A;  3KLD B;  4RUX A;  4LHI A;  3M2Z A;  3DD0 A;  1FQL A;  3MHM A;  4E49 A;  4WW8 A;  2NWO A;  2WEO A;  5SZ5 A;  2FMG A;  1CNK A;  4ZWY A;  5FL5 A;  4KNM A;  3PJJ A;  3U47 A;  2NWZ A;  4Q0L A;  1HEA A;  2OSM A;  5DSM A;  2NNG A;  1CVC A;  2CBA A;  3M1J A;  4Q78 A;  5EHE A;  1Z9Y A;  5CA2 A;  5LMD A;  3T5U A;  5JGT B;  4LP6 A;  9CA2 A;  3DC3 A;  3IBL A;  5E5U A;  5DVX A;  2FNM A;  3K2F A;  3M2Y A;  1G0F A;  4HU1 A;  2EZ7 A;  4QJO A;  3MDZ A;  1HED A;  5JEH B;  3N2P A;  3OIL A;  4WR7 A;  1LZV A;  3IEO A;  2VVA X;  3R16 A;  4KP5 A;  4MO8 A;  5JEG B;  3NJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...