1I9LA

Carbonic anhydrase ii (f131v) complexed with 4-(aminosulfonyl)-n-[(4-fluorophenyl)methyl]-benzamide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
Knots found
sequence length
258
structure length
258
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONIC ANHYDRASE II
publication title Fluoroaromatic-fluoroaromatic interactions between inhibitors bound in the crystal lattice of human carbonic anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 72
structure length 258
sequence length 258
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2001-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1i9lA00
3RZ5A 2CBEA 3V2JA 1ZGFA 3Q31A 2GEHA 5E28A 4PYYA 4R5BA 1IF4A 2NWOA 5AMDA 5FNLA 3M3XA 4DZ9A 4CA2A 4Q7SA 3V7XA 1UGCA 2HFWA 4KP8A 4WL4A 1DMXA 1RAYA 3W6IA 1HECA 2NWPA 4MO8A 4N0XB 1I9OA 3MHCA 4WW6A 1CAYA 1HCBA 3MYQA 2NXTA 3P3HA 1CRAA 1I91A 3S71B 1YDAA 3MHIA 5DVXA 3IBNA 5DSNA 3DCSA 1MUAA 1Z93A 3MNIA 3M2NA 3ML2A 5DRSA 1CNGA 4YXUA 5EKMA 4KUVA 1IF5A 2X7TA 4Z1EA 1BNQA 1CZMA 4QK2A 2CBBA 4Q78A 3RYXB 1KOQA 4KUYA 4MTYA 5DSMA 4ZWIA 1G53A 4PZHA 1CNJA 1F2WA 1RZBA 2AX2A 1YDDA 4DZ7A 4KP5A 2FNNA 1BZMA 2F14A 3DV7A 2WEOA 2FOVA 2FOYA 3RZ1B 1IF8A 1CVEA 3V3GB 4BCWA 3L14A 4FVOA 5BRVA 3RZ8A 1I9PA 5SZ6A 5FLRA 2WEHA 3IBLA 3IAIA 3KIGA 5EH5A 5DSOA 1FQRA 5SZ2A 1CNIA 1G6VA 2HKKA 4HT0A 5G03A 1CAJA 3P44A 4YHAA 5FDIA 2NNVA 4QJXA 3N0NA 5SZ4A 3IBIA 3M2XA 4Q8XA 3SBIA 4Q9YA 1CVAA 1FLJA 3S72B 3RYJB 1FSNA 4Q09A 4CNRA 4YGKA 1CAMA 4GL1X 6CA2A 3S74B 1CVFA 4MLXA 1CCTA 1RZEA 2FOUA 3FE4A 2Q1QA 1CIMA 5FLSA 2ABEA 4Q49A 1XEVA 1JCZA 1UGEA 3F4XA 3MNHA 3UYNA 3RYVB 4QK1A 4Q90A 3RZ0B 1H9QA 3KKXA 1XQ0A 4K13A 1IF9A 1FQNA 1XPZA 4M2RA 5AMGA 5E2SA 1G4OA 1IF7A 4KNIA 4WR7A 3OIMA 5CLUA 3KNEA 4E3DA 4E5QA 5FL4A 3N3JA 3IBUA 2WD2A 1YDCA 1Z97A 3DA2A 4RN4A 2NNSA 1V9EA 2NMXA 2NWYA 4G7AA 4L5UA 4Q99A 3JXFA 1BNVA 3M98A 3S97A 3S73B 1DMYA 4YWPA 5JDVB 1OKLA 2H15A 4Z1KA 4K1QA 4Q81A 5JGTB 5J8ZA 1RZDA 3R16A 4QJMA 4L5WA 1FSRA 3F8EA 5SZ7A 4QTLA 4QIZA 5CACA 3VBDA 4ZAOA 4E4AA 3MNJA 5EHWA 7CA2A 4Q6EA 4ZWYA 3S77B 4YX4A 1BNWA 1BV3A 2NN7A 1CNBA 5JGSB 5FNKA 1ZSBA 3P3JA 1I8ZA 4RH2A 5JEGB 1CAIA 2H4NA 3KLDB 1UGAA 4N16A 1UGDA 5LMDA 5FNJA 3RYZA 5FNHA 3MHMA 5JEHB 3TMJA 3CA2A 4HEZA 3RGEA 5A6HA 4ITPA 3M5TA 1TBTX 1CAKA 4Q7WA 1G0EA 4L5VA 2NNGA 1ZGEA 1CILA 3U3AX 1A42A 4ETQC 4CNXA 4PYXA 3KONA 4Z0QA 12CAA 3KOKA 1BN1A 3ZNCA 1CA3A 5G01A 3HKQA 1HEBA 3M5EA 1OKMA 1G54A 4MDLA 1CNHA 4TWMA 2POWA 4XIWA 4YGJA 1CINA 5EHVA 1HUGA 4M2UA 4LHIA 3MDZA 1BCDA 4HBAA 5JG5B 4XIXA 4Q87A 2POUA 3OYSA 4QJWA 1FQMA 4MDMA 2EU2A 3MHLA 4Y0JA 3MHOA 2QO8A 1IF6A 5EHEA 4QJ0A 1LZVA 5FNMA 3P5AA 4PXXA 3HLJA 1LGDA 3IEOA 4LU3A 1I90A 4KNNA 4KUWA 4RFCA 4C3TA 1KOPA 2ZNCA 5FL6A 4YGNA 2VVAX 1G4JA 3QYKA 3P55A 4QSJA 1HEAA 3C7PA 2HOCA 3IGPA 3V3JA 1UGBA 3MMFA 2QP6A 2WD3A 3OYQA 3GZ0A 5SZ0A 2HNCA 1CNYA 5EH7A 5SZ3A 4XE1A 1JD0A 1TG3A 4E3HA 1BN4A 3UYQA 3MZCA 5C8IA 3B4FA 3DAZA 3F7BA 3HFPA 4JS6A 4M2VA 4YGLA 1TEUX 3ML5A 3M40A 5FLOA 1CVDA 3D0NA 4QSAA 4QJOA 5E2MA 2NNOA 3F7UA 3D92A 4HEWA 3U45X 1RZCA 1HUHA 2EZ7A 3TVOX 4E3GA 2O4ZA 1CANA 3S9TA 1H4NA 1G1DA 3JXGA 3KWAA 5E5RA 3JXHC 3RLDA 3M96A 3OKVA 1CNXA 3V3IB 4CQ0A 5EKJA 1CNKA 1URTA 3M1JA 2X7UA 5JG3B 3D93A 1OQ5A 2HD6A 1TE3X 3N4BA 5DSJA 3NI5A 1G45A 1T9NA 2X7SA 2Q38A 4XZ5A 5FL5A 3T84A 2FNKA 1BICA 3M2ZA 5EKHA 1THKA 4JSWA 4E9OX 1HCAA 3DC9A 5JQ0A 4JSAA 4BF6A 3MNKA 4YVYA 3ZP9A 3P4VA 3SBHA 1UGGA 2FNMA 3LXEA 4RUXA 4Q7PA 4K0SA 4ZX1A 3EFIA 3V3HB 3KS3A 1FR7A 2NXSA 4MLTA 4X5SA 1BNNA 4RFDA 4E49A 5BNLA 4QSBA 3CAJA 3DCWA 1TG9A 1FR4A 3T85A 5SZ1A 1DCAA 1G48A 3BL1A 3M67A 5E2KA 2QOAA 5FDCA 3B1BA 3RYYA 3K2FA 5DSRA 4ZWZA 3K7KA 1CNWA 1TTMA 5FLQA 1CRMA 1RJ5A 1LUGA 3MWOA 1RJ6A 1Y7WA 4HT2A 5DSQA 4Q06A 5FLPA 5A25A 3DVCA 4KNMA 1YO2A 2FW4A 2HL4A 1CCSA 1G46A 4QJPA 4MDGA 3V3FA 1DCBA 4COQA 1AVNA 3RZ7A 4FIKA 2WEJA 4WUPA 3M1KA 2AW1A 4RIVA 3EFTA 2NXRA 3D8WA 1ZE8A 4G0CA 3RG3A 3OILA 5E2RA 3T5ZA 4TWLA 4Q83A 1BNMA 4QY3A 5BRWA 1H9NA 4CNWA 3DCCA 1FSQA 3K34A 1I9MA 4HF3A 5E2NA 4Q6DA 3SAPA 1KWRA 3DC3A 3DD8A 2CBDA 3MNUA 2EU3A 1CAHA 3KOIA 1OKNA 4K0TA 3OY0A 5CJFA 3S8XA 5L6KA 4YXIA 3S76A 4KAPA 3RG4A 3FFPX 2WEGA 1TH9A 3M5SA 3U7CA 3PJJA 1BN3A 5AMLA 1LG6A 2GD8A 1UGFA 3MNAA 2POVA 4Q8YA 4QEFA 1BNTA 1CVCA 4ILXA 1I9NA 3HKNA 2CBAA 2NWZA 5DSLA 1TEQX 4RIUA 1RZAA 4WUQA 3U47A 4QSIA 4KNJA 4QK3A 3NB5A 1I9LA 1RAZA 2FOQA 4IDRX 4UOVA 1G52A 3NJ9A 3D9ZA 3CZVA 1CNCA 1XEGA 1ZNCA 4WW8A 2OSFA 4FU5A 4BF1A 3S75B 1HEDA 5DSPA 5DOHA 5CA2A 1ZH9A 1V9IC 5JESB 4E3FA 5EZTX 3RJ7A 1HVAA 5FNIA 5E5UA 4R59A 3T82A 3M1WA 1I9QA 2FMGA 4FRCA 4YXOA 3HKUA 3W6HA 5G0BA 2IT4A 4JSSA 2FOSA 1CCUA 4FPTA 4LP6A 4R5AA 4QIYA 2OSMA 3DD0A 3M2YA 3S78B 1YDBA 3R17B 3V2MA 4FVNA 3P58A 4CNVA 1YO0A 3CYUA 3P5LA 1CALA 1CVHA 4Q7VA 1YO1A 3N2PA 2CABA 5HPJA 3FW3A 1JV0A 4KV0A 2NN1A 4PQ7A 5IPZA 9CA2A 4YGFA 5G0CA 3M1QA 4HEYA 1G3ZA 5L3OA 3V5GA 1EOUA 2Q1BA 2CBCA 5DSIA 1CAZA 1CA2A 5SZ5A 3T5UA 3DBUA 3HS4A 4JSZA 1CAOA 3PYKA 4RUYA 3PO6A 1TB0X 5DOGA 1FQLA 3OKUA 1Z9YA 2CA2A 1ZSAA 5FLTA 5BYIA 1ZFQA 4M2WA 5EH8A 4Q07A 8CA2A 5DSKA 2ILIA 2VVBX 4FL7A 4HU1A 4ITOA 4Q0LA 5EOIA 3M04A 3DVDA 5JQTA 1KWQA 4XFWA 5EIJA 4ZX0A 3OIKA 3TVNX 1ZFKA 4Q8ZA 3BL0A 1KEQA 5BRUA 3T83A 3HKTA 4Z1JA 5JEPB 2FMZA 4RUZA 4CACA 4YYTA 1CVBA 4Q08A 1LG5A 1ZSCA 2W2JA 4IWZA 4K0ZA 3DVBA 1AM6A 1AZMA 1J9WA 1G0FA 4ZWXA 1MOOA 3M14A 4Z1NA 5FNGA 3BETA 3SAXA 1BNUA
chains in the Genus database with same CATH superfamily
3RZ5A 2CBEA 3V2JA 1ZGFA 3Q31A 2GEHA 5E28A 4PYYA 4R5BA 1IF4A 2NWOA 5AMDA 5FNLA 3M3XA 4DZ9A 4CA2A 4Q7SA 3V7XA 1UGCA 2HFWA 4KP8A 4WL4A 1DMXA 1RAYA 3W6IA 1HECA 2NWPA 4MO8A 4N0XB 1I9OA 3MHCA 4WW6A 1CAYA 1HCBA 3MYQA 2NXTA 3P3HA 1CRAA 1I91A 3S71B 1YDAA 3MHIA 5DVXA 3IBNA 5DSNA 3DCSA 1MUAA 1Z93A 3MNIA 3M2NA 3ML2A 5DRSA 1CNGA 4YXUA 5EKMA 4KUVA 1IF5A 2X7TA 4Z1EA 1BNQA 1CZMA 4QK2A 2CBBA 4Q78A 3RYXB 1KOQA 4KUYA 4MTYA 5DSMA 4ZWIA 1G53A 4PZHA 1CNJA 1F2WA 1RZBA 2AX2A 1YDDA 4DZ7A 4KP5A 2FNNA 1BZMA 2F14A 3DV7A 2WEOA 2FOVA 2FOYA 3RZ1B 1IF8A 1CVEA 3V3GB 4BCWA 3L14A 4FVOA 5BRVA 3RZ8A 1I9PA 5SZ6A 5FLRA 2WEHA 3IBLA 3IAIA 3KIGA 5EH5A 5DSOA 1FQRA 5SZ2A 1CNIA 1G6VA 2HKKA 4HT0A 5G03A 1CAJA 3P44A 4YHAA 5FDIA 2NNVA 4QJXA 3N0NA 5SZ4A 3IBIA 3M2XA 4Q8XA 3SBIA 4Q9YA 1CVAA 1FLJA 3S72B 3RYJB 1FSNA 4Q09A 4CNRA 4YGKA 1CAMA 4GL1X 6CA2A 3S74B 1CVFA 4MLXA 1CCTA 1RZEA 2FOUA 3FE4A 2Q1QA 1CIMA 5FLSA 2ABEA 4Q49A 1XEVA 1JCZA 1UGEA 3F4XA 3MNHA 3UYNA 3RYVB 4QK1A 4Q90A 3RZ0B 1H9QA 3KKXA 1XQ0A 4K13A 1IF9A 1FQNA 1XPZA 4M2RA 5AMGA 5E2SA 1G4OA 1IF7A 4KNIA 4WR7A 3OIMA 5CLUA 3KNEA 4E3DA 4E5QA 5FL4A 3N3JA 3IBUA 2WD2A 1YDCA 1Z97A 3DA2A 4RN4A 2NNSA 1V9EA 2NMXA 2NWYA 4G7AA 4L5UA 4Q99A 3JXFA 1BNVA 3M98A 3S97A 3S73B 1DMYA 4YWPA 5JDVB 1OKLA 2H15A 4Z1KA 4K1QA 4Q81A 5JGTB 5J8ZA 1RZDA 3R16A 4QJMA 4L5WA 1FSRA 3F8EA 5SZ7A 4QTLA 4QIZA 5CACA 3VBDA 4ZAOA 4E4AA 3MNJA 5EHWA 7CA2A 4Q6EA 4ZWYA 3S77B 4YX4A 1BNWA 1BV3A 2NN7A 1CNBA 5JGSB 5FNKA 1ZSBA 3P3JA 1I8ZA 4RH2A 5JEGB 1CAIA 2H4NA 3KLDB 1UGAA 4N16A 1UGDA 5LMDA 5FNJA 3RYZA 5FNHA 3MHMA 5JEHB 3TMJA 3CA2A 4HEZA 3RGEA 5A6HA 4ITPA 3M5TA 1TBTX 1CAKA 4Q7WA 1G0EA 4L5VA 2NNGA 1ZGEA 1CILA 3U3AX 1A42A 4ETQC 4CNXA 4PYXA 3KONA 4Z0QA 12CAA 3KOKA 1BN1A 3ZNCA 1CA3A 5G01A 3HKQA 1HEBA 3M5EA 1OKMA 1G54A 4MDLA 1CNHA 4TWMA 2POWA 4XIWA 4YGJA 1CINA 5EHVA 1HUGA 4M2UA 4LHIA 3MDZA 1BCDA 4HBAA 5JG5B 4XIXA 4Q87A 2POUA 3OYSA 4QJWA 1FQMA 4MDMA 2EU2A 3MHLA 4Y0JA 3MHOA 2QO8A 1IF6A 5EHEA 4QJ0A 1LZVA 5FNMA 3P5AA 4PXXA 3HLJA 1LGDA 3IEOA 4LU3A 1I90A 4KNNA 4KUWA 4RFCA 4C3TA 1KOPA 2ZNCA 5FL6A 4YGNA 2VVAX 1G4JA 3QYKA 3P55A 4QSJA 1HEAA 3C7PA 2HOCA 3IGPA 3V3JA 1UGBA 3MMFA 2QP6A 2WD3A 3OYQA 3GZ0A 5SZ0A 2HNCA 1CNYA 5EH7A 5SZ3A 4XE1A 1JD0A 1TG3A 4E3HA 1BN4A 3UYQA 3MZCA 5C8IA 3B4FA 3DAZA 3F7BA 3HFPA 4JS6A 4M2VA 4YGLA 1TEUX 3ML5A 3M40A 5FLOA 1CVDA 3D0NA 4QSAA 4QJOA 5E2MA 2NNOA 3F7UA 3D92A 4HEWA 3U45X 1RZCA 1HUHA 2EZ7A 3TVOX 4E3GA 2O4ZA 1CANA 3S9TA 1H4NA 1G1DA 3JXGA 3KWAA 5E5RA 3JXHC 3RLDA 3M96A 3OKVA 1CNXA 3V3IB 4CQ0A 5EKJA 1CNKA 1URTA 3M1JA 2X7UA 5JG3B 3D93A 1OQ5A 2HD6A 1TE3X 3N4BA 5DSJA 3NI5A 1G45A 1T9NA 2X7SA 2Q38A 4XZ5A 5FL5A 3T84A 2FNKA 1BICA 3M2ZA 5EKHA 1THKA 4JSWA 4E9OX 1HCAA 3DC9A 5JQ0A 4JSAA 4BF6A 3MNKA 4YVYA 3ZP9A 3P4VA 3SBHA 1UGGA 2FNMA 3LXEA 4RUXA 4Q7PA 4K0SA 4ZX1A 3EFIA 3V3HB 3KS3A 1FR7A 2NXSA 4MLTA 4X5SA 1BNNA 4RFDA 4E49A 5BNLA 4QSBA 3CAJA 3DCWA 1TG9A 1FR4A 3T85A 5SZ1A 1DCAA 1G48A 3BL1A 3M67A 5E2KA 2QOAA 5FDCA 3B1BA 3RYYA 3K2FA 5DSRA 4ZWZA 3K7KA 1CNWA 1TTMA 5FLQA 1CRMA 1RJ5A 1LUGA 3MWOA 1RJ6A 1Y7WA 4HT2A 5DSQA 4Q06A 5FLPA 5A25A 3DVCA 4KNMA 1YO2A 2FW4A 2HL4A 1CCSA 1G46A 4QJPA 4MDGA 3V3FA 1DCBA 4COQA 1AVNA 3RZ7A 4FIKA 2WEJA 4WUPA 3M1KA 2AW1A 4RIVA 3EFTA 2NXRA 3D8WA 1ZE8A 4G0CA 3RG3A 3OILA 5E2RA 3T5ZA 4TWLA 4Q83A 1BNMA 4QY3A 5BRWA 1H9NA 4CNWA 3DCCA 1FSQA 3K34A 1I9MA 4HF3A 5E2NA 4Q6DA 3SAPA 1KWRA 3DC3A 3DD8A 2CBDA 3MNUA 2EU3A 1CAHA 3KOIA 1OKNA 4K0TA 3OY0A 5CJFA 3S8XA 5L6KA 4YXIA 3S76A 4KAPA 3RG4A 3FFPX 2WEGA 1TH9A 3M5SA 3U7CA 3PJJA 1BN3A 5AMLA 1LG6A 2GD8A 1UGFA 3MNAA 2POVA 4Q8YA 4QEFA 1BNTA 1CVCA 4ILXA 1I9NA 3HKNA 2CBAA 2NWZA 5DSLA 1TEQX 4RIUA 1RZAA 4WUQA 3U47A 4QSIA 4KNJA 4QK3A 3NB5A 1I9LA 1RAZA 2FOQA 4IDRX 4UOVA 1G52A 3NJ9A 3D9ZA 3CZVA 1CNCA 1XEGA 1ZNCA 4WW8A 2OSFA 4FU5A 4BF1A 3S75B 1HEDA 5DSPA 5DOHA 5CA2A 1ZH9A 1V9IC 5JESB 4E3FA 5EZTX 3RJ7A 1HVAA 5FNIA 5E5UA 4R59A 3T82A 3M1WA 1I9QA 2FMGA 4FRCA 4YXOA 3HKUA 3W6HA 5G0BA 2IT4A 4JSSA 2FOSA 1CCUA 4FPTA 4LP6A 4R5AA 4QIYA 2OSMA 3DD0A 3M2YA 3S78B 1YDBA 3R17B 3V2MA 4FVNA 3P58A 4CNVA 1YO0A 3CYUA 3P5LA 1CALA 1CVHA 4Q7VA 1YO1A 3N2PA 2CABA 5HPJA 3FW3A 1JV0A 4KV0A 2NN1A 4PQ7A 5IPZA 9CA2A 4YGFA 5G0CA 3M1QA 4HEYA 1G3ZA 5L3OA 3V5GA 1EOUA 2Q1BA 2CBCA 5DSIA 1CAZA 1CA2A 5SZ5A 3T5UA 3DBUA 3HS4A 4JSZA 1CAOA 3PYKA 4RUYA 3PO6A 1TB0X 5DOGA 1FQLA 3OKUA 1Z9YA 2CA2A 1ZSAA 5FLTA 5BYIA 1ZFQA 4M2WA 5EH8A 4Q07A 8CA2A 5DSKA 2ILIA 2VVBX 4FL7A 4HU1A 4ITOA 4Q0LA 5EOIA 3M04A 3DVDA 5JQTA 1KWQA 4XFWA 5EIJA 4ZX0A 3OIKA 3TVNX 1ZFKA 4Q8ZA 3BL0A 1KEQA 5BRUA 3T83A 3HKTA 4Z1JA 5JEPB 2FMZA 4RUZA 4CACA 4YYTA 1CVBA 4Q08A 1LG5A 1ZSCA 2W2JA 4IWZA 4K0ZA 3DVBA 1AM6A 1AZMA 1J9WA 1G0FA 4ZWXA 1MOOA 3M14A 4Z1NA 5FNGA 3BETA 3SAXA 1BNUA
chains in the Genus database with same CATH topology
3RZ5A 2CBEA 3V2JA 1ZGFA 3Q31A 2GEHA 5E28A 4PYYA 4R5BA 1IF4A 2NWOA 5AMDA 5FNLA 3M3XA 4DZ9A 4CA2A 4Q7SA 3V7XA 1UGCA 2HFWA 4KP8A 4WL4A 1DMXA 1RAYA 3W6IA 1HECA 2NWPA 4MO8A 4N0XB 1I9OA 3MHCA 4WW6A 1CAYA 1HCBA 3MYQA 2NXTA 3P3HA 1CRAA 1I91A 3S71B 1YDAA 3MHIA 5DVXA 3IBNA 5DSNA 3DCSA 1MUAA 1Z93A 3MNIA 3M2NA 3ML2A 5DRSA 1CNGA 4YXUA 5EKMA 4KUVA 1IF5A 2X7TA 4Z1EA 1BNQA 1CZMA 4QK2A 2CBBA 4Q78A 3RYXB 1KOQA 4KUYA 4MTYA 5DSMA 4ZWIA 1G53A 4PZHA 1CNJA 1F2WA 1RZBA 2AX2A 1YDDA 4DZ7A 4KP5A 2FNNA 1BZMA 2F14A 3DV7A 2WEOA 2FOVA 2FOYA 3RZ1B 1IF8A 1CVEA 3V3GB 4BCWA 3L14A 4FVOA 5BRVA 3RZ8A 1I9PA 5SZ6A 5FLRA 2WEHA 3IBLA 3IAIA 3KIGA 5EH5A 5DSOA 1FQRA 5SZ2A 1CNIA 1G6VA 2HKKA 4HT0A 5G03A 1CAJA 3P44A 4YHAA 5FDIA 2NNVA 4QJXA 3N0NA 5SZ4A 3IBIA 3M2XA 4Q8XA 3SBIA 4Q9YA 1CVAA 1FLJA 3S72B 3RYJB 1FSNA 4Q09A 4CNRA 4YGKA 1CAMA 4GL1X 6CA2A 3S74B 1CVFA 4MLXA 1CCTA 1RZEA 2FOUA 3FE4A 2Q1QA 1CIMA 5FLSA 2ABEA 4Q49A 1XEVA 1JCZA 1UGEA 3F4XA 3MNHA 3UYNA 3RYVB 4QK1A 4Q90A 3RZ0B 1H9QA 3KKXA 1XQ0A 4K13A 1IF9A 1FQNA 1XPZA 4M2RA 5AMGA 5E2SA 1G4OA 1IF7A 4KNIA 4WR7A 3OIMA 5CLUA 3KNEA 4E3DA 4E5QA 5FL4A 3N3JA 3IBUA 2WD2A 1YDCA 1Z97A 3DA2A 4RN4A 2NNSA 1V9EA 2NMXA 2NWYA 4G7AA 4L5UA 4Q99A 3JXFA 1BNVA 3M98A 3S97A 3S73B 1DMYA 4YWPA 5JDVB 1OKLA 2H15A 4Z1KA 4K1QA 4Q81A 5JGTB 5J8ZA 1RZDA 3R16A 4QJMA 4L5WA 1FSRA 3F8EA 5SZ7A 4QTLA 4QIZA 5CACA 3VBDA 4ZAOA 4E4AA 3MNJA 5EHWA 7CA2A 4Q6EA 4ZWYA 3S77B 4YX4A 1BNWA 1BV3A 2NN7A 1CNBA 5JGSB 5FNKA 1ZSBA 3P3JA 1I8ZA 4RH2A 5JEGB 1CAIA 2H4NA 3KLDB 1UGAA 4N16A 1UGDA 5LMDA 5FNJA 3RYZA 5FNHA 3MHMA 5JEHB 3TMJA 3CA2A 4HEZA 3RGEA 5A6HA 4ITPA 3M5TA 1TBTX 1CAKA 4Q7WA 1G0EA 4L5VA 2NNGA 1ZGEA 1CILA 3U3AX 1A42A 4ETQC 4CNXA 4PYXA 3KONA 4Z0QA 12CAA 3KOKA 1BN1A 3ZNCA 1CA3A 5G01A 3HKQA 1HEBA 3M5EA 1OKMA 1G54A 4MDLA 1CNHA 4TWMA 2POWA 4XIWA 4YGJA 1CINA 5EHVA 1HUGA 4M2UA 4LHIA 3MDZA 1BCDA 4HBAA 5JG5B 4XIXA 4Q87A 2POUA 3OYSA 4QJWA 1FQMA 4MDMA 2EU2A 3MHLA 4Y0JA 3MHOA 2QO8A 1IF6A 5EHEA 4QJ0A 1LZVA 5FNMA 3P5AA 4PXXA 3HLJA 1LGDA 3IEOA 4LU3A 1I90A 4KNNA 4KUWA 4RFCA 4C3TA 1KOPA 2ZNCA 5FL6A 4YGNA 2VVAX 1G4JA 3QYKA 3P55A 4QSJA 1HEAA 3C7PA 2HOCA 3IGPA 3V3JA 1UGBA 3MMFA 2QP6A 2WD3A 3OYQA 3GZ0A 5SZ0A 2HNCA 1CNYA 5EH7A 5SZ3A 4XE1A 1JD0A 1TG3A 4E3HA 1BN4A 3UYQA 3MZCA 5C8IA 3B4FA 3DAZA 3F7BA 3HFPA 4JS6A 4M2VA 4YGLA 1TEUX 3ML5A 3M40A 5FLOA 1CVDA 3D0NA 4QSAA 4QJOA 5E2MA 2NNOA 3F7UA 3D92A 4HEWA 3U45X 1RZCA 1HUHA 2EZ7A 3TVOX 4E3GA 2O4ZA 1CANA 3S9TA 1H4NA 1G1DA 3JXGA 3KWAA 5E5RA 3JXHC 3RLDA 3M96A 3OKVA 1CNXA 3V3IB 4CQ0A 5EKJA 1CNKA 1URTA 3M1JA 2X7UA 5JG3B 3D93A 1OQ5A 2HD6A 1TE3X 3N4BA 5DSJA 3NI5A 1G45A 1T9NA 2X7SA 2Q38A 4XZ5A 5FL5A 3T84A 2FNKA 1BICA 3M2ZA 5EKHA 1THKA 4JSWA 4E9OX 1HCAA 3DC9A 5JQ0A 4JSAA 4BF6A 3MNKA 4YVYA 3ZP9A 3P4VA 3SBHA 1UGGA 2FNMA 3LXEA 4RUXA 4Q7PA 4K0SA 4ZX1A 3EFIA 3V3HB 3KS3A 1FR7A 2NXSA 4MLTA 4X5SA 1BNNA 4RFDA 4E49A 5BNLA 4QSBA 3CAJA 3DCWA 1TG9A 1FR4A 3T85A 5SZ1A 1DCAA 1G48A 3BL1A 3M67A 5E2KA 2QOAA 5FDCA 3B1BA 3RYYA 3K2FA 5DSRA 4ZWZA 3K7KA 1CNWA 1TTMA 5FLQA 1CRMA 1RJ5A 1LUGA 3MWOA 1RJ6A 1Y7WA 4HT2A 5DSQA 4Q06A 5FLPA 5A25A 3DVCA 4KNMA 1YO2A 2FW4A 2HL4A 1CCSA 1G46A 4QJPA 4MDGA 3V3FA 1DCBA 4COQA 1AVNA 3RZ7A 4FIKA 2WEJA 4WUPA 3M1KA 2AW1A 4RIVA 3EFTA 2NXRA 3D8WA 1ZE8A 4G0CA 3RG3A 3OILA 5E2RA 3T5ZA 4TWLA 4Q83A 1BNMA 4QY3A 5BRWA 1H9NA 4CNWA 3DCCA 1FSQA 3K34A 1I9MA 4HF3A 5E2NA 4Q6DA 3SAPA 1KWRA 3DC3A 3DD8A 2CBDA 3MNUA 2EU3A 1CAHA 3KOIA 1OKNA 4K0TA 3OY0A 5CJFA 3S8XA 5L6KA 4YXIA 3S76A 4KAPA 3RG4A 3FFPX 2WEGA 1TH9A 3M5SA 3U7CA 3PJJA 1BN3A 5AMLA 1LG6A 2GD8A 1UGFA 3MNAA 2POVA 4Q8YA 4QEFA 1BNTA 1CVCA 4ILXA 1I9NA 3HKNA 2CBAA 2NWZA 5DSLA 1TEQX 4RIUA 1RZAA 4WUQA 3U47A 4QSIA 4KNJA 4QK3A 3NB5A 1I9LA 1RAZA 2FOQA 4IDRX 4UOVA 1G52A 3NJ9A 3D9ZA 3CZVA 1CNCA 1XEGA 1ZNCA 4WW8A 2OSFA 4FU5A 4BF1A 3S75B 1HEDA 5DSPA 5DOHA 5CA2A 1ZH9A 1V9IC 5JESB 4E3FA 5EZTX 3RJ7A 1HVAA 5FNIA 5E5UA 4R59A 3T82A 3M1WA 1I9QA 2FMGA 4FRCA 4YXOA 3HKUA 3W6HA 5G0BA 2IT4A 4JSSA 2FOSA 1CCUA 4FPTA 4LP6A 4R5AA 4QIYA 2OSMA 3DD0A 3M2YA 3S78B 1YDBA 3R17B 3V2MA 4FVNA 3P58A 4CNVA 1YO0A 3CYUA 3P5LA 1CALA 1CVHA 4Q7VA 1YO1A 3N2PA 2CABA 5HPJA 3FW3A 1JV0A 4KV0A 2NN1A 4PQ7A 5IPZA 9CA2A 4YGFA 5G0CA 3M1QA 4HEYA 1G3ZA 5L3OA 3V5GA 1EOUA 2Q1BA 2CBCA 5DSIA 1CAZA 1CA2A 5SZ5A 3T5UA 3DBUA 3HS4A 4JSZA 1CAOA 3PYKA 4RUYA 3PO6A 1TB0X 5DOGA 1FQLA 3OKUA 1Z9YA 2CA2A 1ZSAA 5FLTA 5BYIA 1ZFQA 4M2WA 5EH8A 4Q07A 8CA2A 5DSKA 2ILIA 2VVBX 4FL7A 4HU1A 4ITOA 4Q0LA 5EOIA 3M04A 3DVDA 5JQTA 1KWQA 4XFWA 5EIJA 4ZX0A 3OIKA 3TVNX 1ZFKA 4Q8ZA 3BL0A 1KEQA 5BRUA 3T83A 3HKTA 4Z1JA 5JEPB 2FMZA 4RUZA 4CACA 4YYTA 1CVBA 4Q08A 1LG5A 1ZSCA 2W2JA 4IWZA 4K0ZA 3DVBA 1AM6A 1AZMA 1J9WA 1G0FA 4ZWXA 1MOOA 3M14A 4Z1NA 5FNGA 3BETA 3SAXA 1BNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZ5 A;  2CBE A;  3V2J A;  1ZGF A;  3Q31 A;  2GEH A;  5E28 A;  4PYY A;  4R5B A;  1IF4 A;  2NWO A;  5AMD A;  5FNL A;  3M3X A;  4DZ9 A;  4CA2 A;  4Q7S A;  3V7X A;  1UGC A;  2HFW A;  4KP8 A;  4WL4 A;  1DMX A;  1RAY A;  3W6I A;  1HEC A;  2NWP A;  4MO8 A;  4N0X B;  1I9O A;  3MHC A;  4WW6 A;  1CAY A;  1HCB A;  3MYQ A;  2NXT A;  3P3H A;  1CRA A;  1I91 A;  3S71 B;  1YDA A;  3MHI A;  5DVX A;  3IBN A;  5DSN A;  3DCS A;  1MUA A;  1Z93 A;  3MNI A;  3M2N A;  3ML2 A;  5DRS A;  1CNG A;  4YXU A;  5EKM A;  4KUV A;  1IF5 A;  2X7T A;  4Z1E A;  1BNQ A;  1CZM A;  4QK2 A;  2CBB A;  4Q78 A;  3RYX B;  1KOQ A;  4KUY A;  4MTY A;  5DSM A;  4ZWI A;  1G53 A;  4PZH A;  1CNJ A;  1F2W A;  1RZB A;  2AX2 A;  1YDD A;  4DZ7 A;  4KP5 A;  2FNN A;  1BZM A;  2F14 A;  3DV7 A;  2WEO A;  2FOV A;  2FOY A;  3RZ1 B;  1IF8 A;  1CVE A;  3V3G B;  4BCW A;  3L14 A;  4FVO A;  5BRV A;  3RZ8 A;  1I9P A;  5SZ6 A;  5FLR A;  2WEH A;  3IBL A;  3IAI A;  3KIG A;  5EH5 A;  5DSO A;  1FQR A;  5SZ2 A;  1CNI A;  1G6V A;  2HKK A;  4HT0 A;  5G03 A;  1CAJ A;  3P44 A;  4YHA A;  5FDI A;  2NNV A;  4QJX A;  3N0N A;  5SZ4 A;  3IBI A;  3M2X A;  4Q8X A;  3SBI A;  4Q9Y A;  1CVA A;  1FLJ A;  3S72 B;  3RYJ B;  1FSN A;  4Q09 A;  4CNR A;  4YGK A;  1CAM A;  4GL1 X;  6CA2 A;  3S74 B;  1CVF A;  4MLX A;  1CCT A;  1RZE A;  2FOU A;  3FE4 A;  2Q1Q A;  1CIM A;  5FLS A;  2ABE A;  4Q49 A;  1XEV A;  1JCZ A;  1UGE A;  3F4X A;  3MNH A;  3UYN A;  3RYV B;  4QK1 A;  4Q90 A;  3RZ0 B;  1H9Q A;  3KKX A;  1XQ0 A;  4K13 A;  1IF9 A;  1FQN A;  1XPZ A;  4M2R A;  5AMG A;  5E2S A;  1G4O A;  1IF7 A;  4KNI A;  4WR7 A;  3OIM A;  5CLU A;  3KNE A;  4E3D A;  4E5Q A;  5FL4 A;  3N3J A;  3IBU A;  2WD2 A;  1YDC A;  1Z97 A;  3DA2 A;  4RN4 A;  2NNS A;  1V9E A;  2NMX A;  2NWY A;  4G7A A;  4L5U A;  4Q99 A;  3JXF A;  1BNV A;  3M98 A;  3S97 A;  3S73 B;  1DMY A;  4YWP A;  5JDV B;  1OKL A;  2H15 A;  4Z1K A;  4K1Q A;  4Q81 A;  5JGT B;  5J8Z A;  1RZD A;  3R16 A;  4QJM A;  4L5W A;  1FSR A;  3F8E A;  5SZ7 A;  4QTL A;  4QIZ A;  5CAC A;  3VBD A;  4ZAO A;  4E4A A;  3MNJ A;  5EHW A;  7CA2 A;  4Q6E A;  4ZWY A;  3S77 B;  4YX4 A;  1BNW A;  1BV3 A;  2NN7 A;  1CNB A;  5JGS B;  5FNK A;  1ZSB A;  3P3J A;  1I8Z A;  4RH2 A;  5JEG B;  1CAI A;  2H4N A;  3KLD B;  1UGA A;  4N16 A;  1UGD A;  5LMD A;  5FNJ A;  3RYZ A;  5FNH A;  3MHM A;  5JEH B;  3TMJ A;  3CA2 A;  4HEZ A;  3RGE A;  5A6H A;  4ITP A;  3M5T A;  1TBT X;  1CAK A;  4Q7W A;  1G0E A;  4L5V A;  2NNG A;  1ZGE A;  1CIL A;  3U3A X;  1A42 A;  4ETQ C;  4CNX A;  4PYX A;  3KON A;  4Z0Q A;  12CA A;  3KOK A;  1BN1 A;  3ZNC A;  1CA3 A;  5G01 A;  3HKQ A;  1HEB A;  3M5E A;  1OKM A;  1G54 A;  4MDL A;  1CNH A;  4TWM A;  2POW A;  4XIW A;  4YGJ A;  1CIN A;  5EHV A;  1HUG A;  4M2U A;  4LHI A;  3MDZ A;  1BCD A;  4HBA A;  5JG5 B;  4XIX A;  4Q87 A;  2POU A;  3OYS A;  4QJW A;  1FQM A;  4MDM A;  2EU2 A;  3MHL A;  4Y0J A;  3MHO A;  2QO8 A;  1IF6 A;  5EHE A;  4QJ0 A;  1LZV A;  5FNM A;  3P5A A;  4PXX A;  3HLJ A;  1LGD A;  3IEO A;  4LU3 A;  1I90 A;  4KNN A;  4KUW A;  4RFC A;  4C3T A;  1KOP A;  2ZNC A;  5FL6 A;  4YGN A;  2VVA X;  1G4J A;  3QYK A;  3P55 A;  4QSJ A;  1HEA A;  3C7P A;  2HOC A;  3IGP A;  3V3J A;  1UGB A;  3MMF A;  2QP6 A;  2WD3 A;  3OYQ A;  3GZ0 A;  5SZ0 A;  2HNC A;  1CNY A;  5EH7 A;  5SZ3 A;  4XE1 A;  1JD0 A;  1TG3 A;  4E3H A;  1BN4 A;  3UYQ A;  3MZC A;  5C8I A;  3B4F A;  3DAZ A;  3F7B A;  3HFP A;  4JS6 A;  4M2V A;  4YGL A;  1TEU X;  3ML5 A;  3M40 A;  5FLO A;  1CVD A;  3D0N A;  4QSA A;  4QJO A;  5E2M A;  2NNO A;  3F7U A;  3D92 A;  4HEW A;  3U45 X;  1RZC A;  1HUH A;  2EZ7 A;  3TVO X;  4E3G A;  2O4Z A;  1CAN A;  3S9T A;  1H4N A;  1G1D A;  3JXG A;  3KWA A;  5E5R A;  3JXH C;  3RLD A;  3M96 A;  3OKV A;  1CNX A;  3V3I B;  4CQ0 A;  5EKJ A;  1CNK A;  1URT A;  3M1J A;  2X7U A;  5JG3 B;  3D93 A;  1OQ5 A;  2HD6 A;  1TE3 X;  3N4B A;  5DSJ A;  3NI5 A;  1G45 A;  1T9N A;  2X7S A;  2Q38 A;  4XZ5 A;  5FL5 A;  3T84 A;  2FNK A;  1BIC A;  3M2Z A;  5EKH A;  1THK A;  4JSW A;  4E9O X;  1HCA A;  3DC9 A;  5JQ0 A;  4JSA A;  4BF6 A;  3MNK A;  4YVY A;  3ZP9 A;  3P4V A;  3SBH A;  1UGG A;  2FNM A;  3LXE A;  4RUX A;  4Q7P A;  4K0S A;  4ZX1 A;  3EFI A;  3V3H B;  3KS3 A;  1FR7 A;  2NXS A;  4MLT A;  4X5S A;  1BNN A;  4RFD A;  4E49 A;  5BNL A;  4QSB A;  3CAJ A;  3DCW A;  1TG9 A;  1FR4 A;  3T85 A;  5SZ1 A;  1DCA A;  1G48 A;  3BL1 A;  3M67 A;  5E2K A;  2QOA A;  5FDC A;  3B1B A;  3RYY A;  3K2F A;  5DSR A;  4ZWZ A;  3K7K A;  1CNW A;  1TTM A;  5FLQ A;  1CRM A;  1RJ5 A;  1LUG A;  3MWO A;  1RJ6 A;  1Y7W A;  4HT2 A;  5DSQ A;  4Q06 A;  5FLP A;  5A25 A;  3DVC A;  4KNM A;  1YO2 A;  2FW4 A;  2HL4 A;  1CCS A;  1G46 A;  4QJP A;  4MDG A;  3V3F A;  1DCB A;  4COQ A;  1AVN A;  3RZ7 A;  4FIK A;  2WEJ A;  4WUP A;  3M1K A;  2AW1 A;  4RIV A;  3EFT A;  2NXR A;  3D8W A;  1ZE8 A;  4G0C A;  3RG3 A;  3OIL A;  5E2R A;  3T5Z A;  4TWL A;  4Q83 A;  1BNM A;  4QY3 A;  5BRW A;  1H9N A;  4CNW A;  3DCC A;  1FSQ A;  3K34 A;  1I9M A;  4HF3 A;  5E2N A;  4Q6D A;  3SAP A;  1KWR A;  3DC3 A;  3DD8 A;  2CBD A;  3MNU A;  2EU3 A;  1CAH A;  3KOI A;  1OKN A;  4K0T A;  3OY0 A;  5CJF A;  3S8X A;  5L6K A;  4YXI A;  3S76 A;  4KAP A;  3RG4 A;  3FFP X;  2WEG A;  1TH9 A;  3M5S A;  3U7C A;  3PJJ A;  1BN3 A;  5AML A;  1LG6 A;  2GD8 A;  1UGF A;  3MNA A;  2POV A;  4Q8Y A;  4QEF A;  1BNT A;  1CVC A;  4ILX A;  1I9N A;  3HKN A;  2CBA A;  2NWZ A;  5DSL A;  1TEQ X;  4RIU A;  1RZA A;  4WUQ A;  3U47 A;  4QSI A;  4KNJ A;  4QK3 A;  3NB5 A;  1I9L A;  1RAZ A;  2FOQ A;  4IDR X;  4UOV A;  1G52 A;  3NJ9 A;  3D9Z A;  3CZV A;  1CNC A;  1XEG A;  1ZNC A;  4WW8 A;  2OSF A;  4FU5 A;  4BF1 A;  3S75 B;  1HED A;  5DSP A;  5DOH A;  5CA2 A;  1ZH9 A;  1V9I C;  5JES B;  4E3F A;  5EZT X;  3RJ7 A;  1HVA A;  5FNI A;  5E5U A;  4R59 A;  3T82 A;  3M1W A;  1I9Q A;  2FMG A;  4FRC A;  4YXO A;  3HKU A;  3W6H A;  5G0B A;  2IT4 A;  4JSS A;  2FOS A;  1CCU A;  4FPT A;  4LP6 A;  4R5A A;  4QIY A;  2OSM A;  3DD0 A;  3M2Y A;  3S78 B;  1YDB A;  3R17 B;  3V2M A;  4FVN A;  3P58 A;  4CNV A;  1YO0 A;  3CYU A;  3P5L A;  1CAL A;  1CVH A;  4Q7V A;  1YO1 A;  3N2P A;  2CAB A;  5HPJ A;  3FW3 A;  1JV0 A;  4KV0 A;  2NN1 A;  4PQ7 A;  5IPZ A;  9CA2 A;  4YGF A;  5G0C A;  3M1Q A;  4HEY A;  1G3Z A;  5L3O A;  3V5G A;  1EOU A;  2Q1B A;  2CBC A;  5DSI A;  1CAZ A;  1CA2 A;  5SZ5 A;  3T5U A;  3DBU A;  3HS4 A;  4JSZ A;  1CAO A;  3PYK A;  4RUY A;  3PO6 A;  1TB0 X;  5DOG A;  1FQL A;  3OKU A;  1Z9Y A;  2CA2 A;  1ZSA A;  5FLT A;  5BYI A;  1ZFQ A;  4M2W A;  5EH8 A;  4Q07 A;  8CA2 A;  5DSK A;  2ILI A;  2VVB X;  4FL7 A;  4HU1 A;  4ITO A;  4Q0L A;  5EOI A;  3M04 A;  3DVD A;  5JQT A;  1KWQ A;  4XFW A;  5EIJ A;  4ZX0 A;  3OIK A;  3TVN X;  1ZFK A;  4Q8Z A;  3BL0 A;  1KEQ A;  5BRU A;  3T83 A;  3HKT A;  4Z1J A;  5JEP B;  2FMZ A;  4RUZ A;  4CAC A;  4YYT A;  1CVB A;  4Q08 A;  1LG5 A;  1ZSC A;  2W2J A;  4IWZ A;  4K0Z A;  3DVB A;  1AM6 A;  1AZM A;  1J9W A;  1G0F A;  4ZWX A;  1MOO A;  3M14 A;  4Z1N A;  5FNG A;  3BET A;  3SAX A;  1BNU A; 
#chains in the Genus database with same CATH topology
 3RZ5 A;  2CBE A;  3V2J A;  1ZGF A;  3Q31 A;  2GEH A;  5E28 A;  4PYY A;  4R5B A;  1IF4 A;  2NWO A;  5AMD A;  5FNL A;  3M3X A;  4DZ9 A;  4CA2 A;  4Q7S A;  3V7X A;  1UGC A;  2HFW A;  4KP8 A;  4WL4 A;  1DMX A;  1RAY A;  3W6I A;  1HEC A;  2NWP A;  4MO8 A;  4N0X B;  1I9O A;  3MHC A;  4WW6 A;  1CAY A;  1HCB A;  3MYQ A;  2NXT A;  3P3H A;  1CRA A;  1I91 A;  3S71 B;  1YDA A;  3MHI A;  5DVX A;  3IBN A;  5DSN A;  3DCS A;  1MUA A;  1Z93 A;  3MNI A;  3M2N A;  3ML2 A;  5DRS A;  1CNG A;  4YXU A;  5EKM A;  4KUV A;  1IF5 A;  2X7T A;  4Z1E A;  1BNQ A;  1CZM A;  4QK2 A;  2CBB A;  4Q78 A;  3RYX B;  1KOQ A;  4KUY A;  4MTY A;  5DSM A;  4ZWI A;  1G53 A;  4PZH A;  1CNJ A;  1F2W A;  1RZB A;  2AX2 A;  1YDD A;  4DZ7 A;  4KP5 A;  2FNN A;  1BZM A;  2F14 A;  3DV7 A;  2WEO A;  2FOV A;  2FOY A;  3RZ1 B;  1IF8 A;  1CVE A;  3V3G B;  4BCW A;  3L14 A;  4FVO A;  5BRV A;  3RZ8 A;  1I9P A;  5SZ6 A;  5FLR A;  2WEH A;  3IBL A;  3IAI A;  3KIG A;  5EH5 A;  5DSO A;  1FQR A;  5SZ2 A;  1CNI A;  1G6V A;  2HKK A;  4HT0 A;  5G03 A;  1CAJ A;  3P44 A;  4YHA A;  5FDI A;  2NNV A;  4QJX A;  3N0N A;  5SZ4 A;  3IBI A;  3M2X A;  4Q8X A;  3SBI A;  4Q9Y A;  1CVA A;  1FLJ A;  3S72 B;  3RYJ B;  1FSN A;  4Q09 A;  4CNR A;  4YGK A;  1CAM A;  4GL1 X;  6CA2 A;  3S74 B;  1CVF A;  4MLX A;  1CCT A;  1RZE A;  2FOU A;  3FE4 A;  2Q1Q A;  1CIM A;  5FLS A;  2ABE A;  4Q49 A;  1XEV A;  1JCZ A;  1UGE A;  3F4X A;  3MNH A;  3UYN A;  3RYV B;  4QK1 A;  4Q90 A;  3RZ0 B;  1H9Q A;  3KKX A;  1XQ0 A;  4K13 A;  1IF9 A;  1FQN A;  1XPZ A;  4M2R A;  5AMG A;  5E2S A;  1G4O A;  1IF7 A;  4KNI A;  4WR7 A;  3OIM A;  5CLU A;  3KNE A;  4E3D A;  4E5Q A;  5FL4 A;  3N3J A;  3IBU A;  2WD2 A;  1YDC A;  1Z97 A;  3DA2 A;  4RN4 A;  2NNS A;  1V9E A;  2NMX A;  2NWY A;  4G7A A;  4L5U A;  4Q99 A;  3JXF A;  1BNV A;  3M98 A;  3S97 A;  3S73 B;  1DMY A;  4YWP A;  5JDV B;  1OKL A;  2H15 A;  4Z1K A;  4K1Q A;  4Q81 A;  5JGT B;  5J8Z A;  1RZD A;  3R16 A;  4QJM A;  4L5W A;  1FSR A;  3F8E A;  5SZ7 A;  4QTL A;  4QIZ A;  5CAC A;  3VBD A;  4ZAO A;  4E4A A;  3MNJ A;  5EHW A;  7CA2 A;  4Q6E A;  4ZWY A;  3S77 B;  4YX4 A;  1BNW A;  1BV3 A;  2NN7 A;  1CNB A;  5JGS B;  5FNK A;  1ZSB A;  3P3J A;  1I8Z A;  4RH2 A;  5JEG B;  1CAI A;  2H4N A;  3KLD B;  1UGA A;  4N16 A;  1UGD A;  5LMD A;  5FNJ A;  3RYZ A;  5FNH A;  3MHM A;  5JEH B;  3TMJ A;  3CA2 A;  4HEZ A;  3RGE A;  5A6H A;  4ITP A;  3M5T A;  1TBT X;  1CAK A;  4Q7W A;  1G0E A;  4L5V A;  2NNG A;  1ZGE A;  1CIL A;  3U3A X;  1A42 A;  4ETQ C;  4CNX A;  4PYX A;  3KON A;  4Z0Q A;  12CA A;  3KOK A;  1BN1 A;  3ZNC A;  1CA3 A;  5G01 A;  3HKQ A;  1HEB A;  3M5E A;  1OKM A;  1G54 A;  4MDL A;  1CNH A;  4TWM A;  2POW A;  4XIW A;  4YGJ A;  1CIN A;  5EHV A;  1HUG A;  4M2U A;  4LHI A;  3MDZ A;  1BCD A;  4HBA A;  5JG5 B;  4XIX A;  4Q87 A;  2POU A;  3OYS A;  4QJW A;  1FQM A;  4MDM A;  2EU2 A;  3MHL A;  4Y0J A;  3MHO A;  2QO8 A;  1IF6 A;  5EHE A;  4QJ0 A;  1LZV A;  5FNM A;  3P5A A;  4PXX A;  3HLJ A;  1LGD A;  3IEO A;  4LU3 A;  1I90 A;  4KNN A;  4KUW A;  4RFC A;  4C3T A;  1KOP A;  2ZNC A;  5FL6 A;  4YGN A;  2VVA X;  1G4J A;  3QYK A;  3P55 A;  4QSJ A;  1HEA A;  3C7P A;  2HOC A;  3IGP A;  3V3J A;  1UGB A;  3MMF A;  2QP6 A;  2WD3 A;  3OYQ A;  3GZ0 A;  5SZ0 A;  2HNC A;  1CNY A;  5EH7 A;  5SZ3 A;  4XE1 A;  1JD0 A;  1TG3 A;  4E3H A;  1BN4 A;  3UYQ A;  3MZC A;  5C8I A;  3B4F A;  3DAZ A;  3F7B A;  3HFP A;  4JS6 A;  4M2V A;  4YGL A;  1TEU X;  3ML5 A;  3M40 A;  5FLO A;  1CVD A;  3D0N A;  4QSA A;  4QJO A;  5E2M A;  2NNO A;  3F7U A;  3D92 A;  4HEW A;  3U45 X;  1RZC A;  1HUH A;  2EZ7 A;  3TVO X;  4E3G A;  2O4Z A;  1CAN A;  3S9T A;  1H4N A;  1G1D A;  3JXG A;  3KWA A;  5E5R A;  3JXH C;  3RLD A;  3M96 A;  3OKV A;  1CNX A;  3V3I B;  4CQ0 A;  5EKJ A;  1CNK A;  1URT A;  3M1J A;  2X7U A;  5JG3 B;  3D93 A;  1OQ5 A;  2HD6 A;  1TE3 X;  3N4B A;  5DSJ A;  3NI5 A;  1G45 A;  1T9N A;  2X7S A;  2Q38 A;  4XZ5 A;  5FL5 A;  3T84 A;  2FNK A;  1BIC A;  3M2Z A;  5EKH A;  1THK A;  4JSW A;  4E9O X;  1HCA A;  3DC9 A;  5JQ0 A;  4JSA A;  4BF6 A;  3MNK A;  4YVY A;  3ZP9 A;  3P4V A;  3SBH A;  1UGG A;  2FNM A;  3LXE A;  4RUX A;  4Q7P A;  4K0S A;  4ZX1 A;  3EFI A;  3V3H B;  3KS3 A;  1FR7 A;  2NXS A;  4MLT A;  4X5S A;  1BNN A;  4RFD A;  4E49 A;  5BNL A;  4QSB A;  3CAJ A;  3DCW A;  1TG9 A;  1FR4 A;  3T85 A;  5SZ1 A;  1DCA A;  1G48 A;  3BL1 A;  3M67 A;  5E2K A;  2QOA A;  5FDC A;  3B1B A;  3RYY A;  3K2F A;  5DSR A;  4ZWZ A;  3K7K A;  1CNW A;  1TTM A;  5FLQ A;  1CRM A;  1RJ5 A;  1LUG A;  3MWO A;  1RJ6 A;  1Y7W A;  4HT2 A;  5DSQ A;  4Q06 A;  5FLP A;  5A25 A;  3DVC A;  4KNM A;  1YO2 A;  2FW4 A;  2HL4 A;  1CCS A;  1G46 A;  4QJP A;  4MDG A;  3V3F A;  1DCB A;  4COQ A;  1AVN A;  3RZ7 A;  4FIK A;  2WEJ A;  4WUP A;  3M1K A;  2AW1 A;  4RIV A;  3EFT A;  2NXR A;  3D8W A;  1ZE8 A;  4G0C A;  3RG3 A;  3OIL A;  5E2R A;  3T5Z A;  4TWL A;  4Q83 A;  1BNM A;  4QY3 A;  5BRW A;  1H9N A;  4CNW A;  3DCC A;  1FSQ A;  3K34 A;  1I9M A;  4HF3 A;  5E2N A;  4Q6D A;  3SAP A;  1KWR A;  3DC3 A;  3DD8 A;  2CBD A;  3MNU A;  2EU3 A;  1CAH A;  3KOI A;  1OKN A;  4K0T A;  3OY0 A;  5CJF A;  3S8X A;  5L6K A;  4YXI A;  3S76 A;  4KAP A;  3RG4 A;  3FFP X;  2WEG A;  1TH9 A;  3M5S A;  3U7C A;  3PJJ A;  1BN3 A;  5AML A;  1LG6 A;  2GD8 A;  1UGF A;  3MNA A;  2POV A;  4Q8Y A;  4QEF A;  1BNT A;  1CVC A;  4ILX A;  1I9N A;  3HKN A;  2CBA A;  2NWZ A;  5DSL A;  1TEQ X;  4RIU A;  1RZA A;  4WUQ A;  3U47 A;  4QSI A;  4KNJ A;  4QK3 A;  3NB5 A;  1I9L A;  1RAZ A;  2FOQ A;  4IDR X;  4UOV A;  1G52 A;  3NJ9 A;  3D9Z A;  3CZV A;  1CNC A;  1XEG A;  1ZNC A;  4WW8 A;  2OSF A;  4FU5 A;  4BF1 A;  3S75 B;  1HED A;  5DSP A;  5DOH A;  5CA2 A;  1ZH9 A;  1V9I C;  5JES B;  4E3F A;  5EZT X;  3RJ7 A;  1HVA A;  5FNI A;  5E5U A;  4R59 A;  3T82 A;  3M1W A;  1I9Q A;  2FMG A;  4FRC A;  4YXO A;  3HKU A;  3W6H A;  5G0B A;  2IT4 A;  4JSS A;  2FOS A;  1CCU A;  4FPT A;  4LP6 A;  4R5A A;  4QIY A;  2OSM A;  3DD0 A;  3M2Y A;  3S78 B;  1YDB A;  3R17 B;  3V2M A;  4FVN A;  3P58 A;  4CNV A;  1YO0 A;  3CYU A;  3P5L A;  1CAL A;  1CVH A;  4Q7V A;  1YO1 A;  3N2P A;  2CAB A;  5HPJ A;  3FW3 A;  1JV0 A;  4KV0 A;  2NN1 A;  4PQ7 A;  5IPZ A;  9CA2 A;  4YGF A;  5G0C A;  3M1Q A;  4HEY A;  1G3Z A;  5L3O A;  3V5G A;  1EOU A;  2Q1B A;  2CBC A;  5DSI A;  1CAZ A;  1CA2 A;  5SZ5 A;  3T5U A;  3DBU A;  3HS4 A;  4JSZ A;  1CAO A;  3PYK A;  4RUY A;  3PO6 A;  1TB0 X;  5DOG A;  1FQL A;  3OKU A;  1Z9Y A;  2CA2 A;  1ZSA A;  5FLT A;  5BYI A;  1ZFQ A;  4M2W A;  5EH8 A;  4Q07 A;  8CA2 A;  5DSK A;  2ILI A;  2VVB X;  4FL7 A;  4HU1 A;  4ITO A;  4Q0L A;  5EOI A;  3M04 A;  3DVD A;  5JQT A;  1KWQ A;  4XFW A;  5EIJ A;  4ZX0 A;  3OIK A;  3TVN X;  1ZFK A;  4Q8Z A;  3BL0 A;  1KEQ A;  5BRU A;  3T83 A;  3HKT A;  4Z1J A;  5JEP B;  2FMZ A;  4RUZ A;  4CAC A;  4YYT A;  1CVB A;  4Q08 A;  1LG5 A;  1ZSC A;  2W2J A;  4IWZ A;  4K0Z A;  3DVB A;  1AM6 A;  1AZM A;  1J9W A;  1G0F A;  4ZWX A;  1MOO A;  3M14 A;  4Z1N A;  5FNG A;  3BET A;  3SAX A;  1BNU A; 
#chains in the Genus database with same CATH homology
 3RZ5 A;  2CBE A;  3V2J A;  1ZGF A;  3Q31 A;  2GEH A;  5E28 A;  4PYY A;  4R5B A;  1IF4 A;  2NWO A;  5AMD A;  5FNL A;  3M3X A;  4DZ9 A;  4CA2 A;  4Q7S A;  3V7X A;  1UGC A;  2HFW A;  4KP8 A;  4WL4 A;  1DMX A;  1RAY A;  3W6I A;  1HEC A;  2NWP A;  4MO8 A;  4N0X B;  1I9O A;  3MHC A;  4WW6 A;  1CAY A;  1HCB A;  3MYQ A;  2NXT A;  3P3H A;  1CRA A;  1I91 A;  3S71 B;  1YDA A;  3MHI A;  5DVX A;  3IBN A;  5DSN A;  3DCS A;  1MUA A;  1Z93 A;  3MNI A;  3M2N A;  3ML2 A;  5DRS A;  1CNG A;  4YXU A;  5EKM A;  4KUV A;  1IF5 A;  2X7T A;  4Z1E A;  1BNQ A;  1CZM A;  4QK2 A;  2CBB A;  4Q78 A;  3RYX B;  1KOQ A;  4KUY A;  4MTY A;  5DSM A;  4ZWI A;  1G53 A;  4PZH A;  1CNJ A;  1F2W A;  1RZB A;  2AX2 A;  1YDD A;  4DZ7 A;  4KP5 A;  2FNN A;  1BZM A;  2F14 A;  3DV7 A;  2WEO A;  2FOV A;  2FOY A;  3RZ1 B;  1IF8 A;  1CVE A;  3V3G B;  4BCW A;  3L14 A;  4FVO A;  5BRV A;  3RZ8 A;  1I9P A;  5SZ6 A;  5FLR A;  2WEH A;  3IBL A;  3IAI A;  3KIG A;  5EH5 A;  5DSO A;  1FQR A;  5SZ2 A;  1CNI A;  1G6V A;  2HKK A;  4HT0 A;  5G03 A;  1CAJ A;  3P44 A;  4YHA A;  5FDI A;  2NNV A;  4QJX A;  3N0N A;  5SZ4 A;  3IBI A;  3M2X A;  4Q8X A;  3SBI A;  4Q9Y A;  1CVA A;  1FLJ A;  3S72 B;  3RYJ B;  1FSN A;  4Q09 A;  4CNR A;  4YGK A;  1CAM A;  4GL1 X;  6CA2 A;  3S74 B;  1CVF A;  4MLX A;  1CCT A;  1RZE A;  2FOU A;  3FE4 A;  2Q1Q A;  1CIM A;  5FLS A;  2ABE A;  4Q49 A;  1XEV A;  1JCZ A;  1UGE A;  3F4X A;  3MNH A;  3UYN A;  3RYV B;  4QK1 A;  4Q90 A;  3RZ0 B;  1H9Q A;  3KKX A;  1XQ0 A;  4K13 A;  1IF9 A;  1FQN A;  1XPZ A;  4M2R A;  5AMG A;  5E2S A;  1G4O A;  1IF7 A;  4KNI A;  4WR7 A;  3OIM A;  5CLU A;  3KNE A;  4E3D A;  4E5Q A;  5FL4 A;  3N3J A;  3IBU A;  2WD2 A;  1YDC A;  1Z97 A;  3DA2 A;  4RN4 A;  2NNS A;  1V9E A;  2NMX A;  2NWY A;  4G7A A;  4L5U A;  4Q99 A;  3JXF A;  1BNV A;  3M98 A;  3S97 A;  3S73 B;  1DMY A;  4YWP A;  5JDV B;  1OKL A;  2H15 A;  4Z1K A;  4K1Q A;  4Q81 A;  5JGT B;  5J8Z A;  1RZD A;  3R16 A;  4QJM A;  4L5W A;  1FSR A;  3F8E A;  5SZ7 A;  4QTL A;  4QIZ A;  5CAC A;  3VBD A;  4ZAO A;  4E4A A;  3MNJ A;  5EHW A;  7CA2 A;  4Q6E A;  4ZWY A;  3S77 B;  4YX4 A;  1BNW A;  1BV3 A;  2NN7 A;  1CNB A;  5JGS B;  5FNK A;  1ZSB A;  3P3J A;  1I8Z A;  4RH2 A;  5JEG B;  1CAI A;  2H4N A;  3KLD B;  1UGA A;  4N16 A;  1UGD A;  5LMD A;  5FNJ A;  3RYZ A;  5FNH A;  3MHM A;  5JEH B;  3TMJ A;  3CA2 A;  4HEZ A;  3RGE A;  5A6H A;  4ITP A;  3M5T A;  1TBT X;  1CAK A;  4Q7W A;  1G0E A;  4L5V A;  2NNG A;  1ZGE A;  1CIL A;  3U3A X;  1A42 A;  4ETQ C;  4CNX A;  4PYX A;  3KON A;  4Z0Q A;  12CA A;  3KOK A;  1BN1 A;  3ZNC A;  1CA3 A;  5G01 A;  3HKQ A;  1HEB A;  3M5E A;  1OKM A;  1G54 A;  4MDL A;  1CNH A;  4TWM A;  2POW A;  4XIW A;  4YGJ A;  1CIN A;  5EHV A;  1HUG A;  4M2U A;  4LHI A;  3MDZ A;  1BCD A;  4HBA A;  5JG5 B;  4XIX A;  4Q87 A;  2POU A;  3OYS A;  4QJW A;  1FQM A;  4MDM A;  2EU2 A;  3MHL A;  4Y0J A;  3MHO A;  2QO8 A;  1IF6 A;  5EHE A;  4QJ0 A;  1LZV A;  5FNM A;  3P5A A;  4PXX A;  3HLJ A;  1LGD A;  3IEO A;  4LU3 A;  1I90 A;  4KNN A;  4KUW A;  4RFC A;  4C3T A;  1KOP A;  2ZNC A;  5FL6 A;  4YGN A;  2VVA X;  1G4J A;  3QYK A;  3P55 A;  4QSJ A;  1HEA A;  3C7P A;  2HOC A;  3IGP A;  3V3J A;  1UGB A;  3MMF A;  2QP6 A;  2WD3 A;  3OYQ A;  3GZ0 A;  5SZ0 A;  2HNC A;  1CNY A;  5EH7 A;  5SZ3 A;  4XE1 A;  1JD0 A;  1TG3 A;  4E3H A;  1BN4 A;  3UYQ A;  3MZC A;  5C8I A;  3B4F A;  3DAZ A;  3F7B A;  3HFP A;  4JS6 A;  4M2V A;  4YGL A;  1TEU X;  3ML5 A;  3M40 A;  5FLO A;  1CVD A;  3D0N A;  4QSA A;  4QJO A;  5E2M A;  2NNO A;  3F7U A;  3D92 A;  4HEW A;  3U45 X;  1RZC A;  1HUH A;  2EZ7 A;  3TVO X;  4E3G A;  2O4Z A;  1CAN A;  3S9T A;  1H4N A;  1G1D A;  3JXG A;  3KWA A;  5E5R A;  3JXH C;  3RLD A;  3M96 A;  3OKV A;  1CNX A;  3V3I B;  4CQ0 A;  5EKJ A;  1CNK A;  1URT A;  3M1J A;  2X7U A;  5JG3 B;  3D93 A;  1OQ5 A;  2HD6 A;  1TE3 X;  3N4B A;  5DSJ A;  3NI5 A;  1G45 A;  1T9N A;  2X7S A;  2Q38 A;  4XZ5 A;  5FL5 A;  3T84 A;  2FNK A;  1BIC A;  3M2Z A;  5EKH A;  1THK A;  4JSW A;  4E9O X;  1HCA A;  3DC9 A;  5JQ0 A;  4JSA A;  4BF6 A;  3MNK A;  4YVY A;  3ZP9 A;  3P4V A;  3SBH A;  1UGG A;  2FNM A;  3LXE A;  4RUX A;  4Q7P A;  4K0S A;  4ZX1 A;  3EFI A;  3V3H B;  3KS3 A;  1FR7 A;  2NXS A;  4MLT A;  4X5S A;  1BNN A;  4RFD A;  4E49 A;  5BNL A;  4QSB A;  3CAJ A;  3DCW A;  1TG9 A;  1FR4 A;  3T85 A;  5SZ1 A;  1DCA A;  1G48 A;  3BL1 A;  3M67 A;  5E2K A;  2QOA A;  5FDC A;  3B1B A;  3RYY A;  3K2F A;  5DSR A;  4ZWZ A;  3K7K A;  1CNW A;  1TTM A;  5FLQ A;  1CRM A;  1RJ5 A;  1LUG A;  3MWO A;  1RJ6 A;  1Y7W A;  4HT2 A;  5DSQ A;  4Q06 A;  5FLP A;  5A25 A;  3DVC A;  4KNM A;  1YO2 A;  2FW4 A;  2HL4 A;  1CCS A;  1G46 A;  4QJP A;  4MDG A;  3V3F A;  1DCB A;  4COQ A;  1AVN A;  3RZ7 A;  4FIK A;  2WEJ A;  4WUP A;  3M1K A;  2AW1 A;  4RIV A;  3EFT A;  2NXR A;  3D8W A;  1ZE8 A;  4G0C A;  3RG3 A;  3OIL A;  5E2R A;  3T5Z A;  4TWL A;  4Q83 A;  1BNM A;  4QY3 A;  5BRW A;  1H9N A;  4CNW A;  3DCC A;  1FSQ A;  3K34 A;  1I9M A;  4HF3 A;  5E2N A;  4Q6D A;  3SAP A;  1KWR A;  3DC3 A;  3DD8 A;  2CBD A;  3MNU A;  2EU3 A;  1CAH A;  3KOI A;  1OKN A;  4K0T A;  3OY0 A;  5CJF A;  3S8X A;  5L6K A;  4YXI A;  3S76 A;  4KAP A;  3RG4 A;  3FFP X;  2WEG A;  1TH9 A;  3M5S A;  3U7C A;  3PJJ A;  1BN3 A;  5AML A;  1LG6 A;  2GD8 A;  1UGF A;  3MNA A;  2POV A;  4Q8Y A;  4QEF A;  1BNT A;  1CVC A;  4ILX A;  1I9N A;  3HKN A;  2CBA A;  2NWZ A;  5DSL A;  1TEQ X;  4RIU A;  1RZA A;  4WUQ A;  3U47 A;  4QSI A;  4KNJ A;  4QK3 A;  3NB5 A;  1I9L A;  1RAZ A;  2FOQ A;  4IDR X;  4UOV A;  1G52 A;  3NJ9 A;  3D9Z A;  3CZV A;  1CNC A;  1XEG A;  1ZNC A;  4WW8 A;  2OSF A;  4FU5 A;  4BF1 A;  3S75 B;  1HED A;  5DSP A;  5DOH A;  5CA2 A;  1ZH9 A;  1V9I C;  5JES B;  4E3F A;  5EZT X;  3RJ7 A;  1HVA A;  5FNI A;  5E5U A;  4R59 A;  3T82 A;  3M1W A;  1I9Q A;  2FMG A;  4FRC A;  4YXO A;  3HKU A;  3W6H A;  5G0B A;  2IT4 A;  4JSS A;  2FOS A;  1CCU A;  4FPT A;  4LP6 A;  4R5A A;  4QIY A;  2OSM A;  3DD0 A;  3M2Y A;  3S78 B;  1YDB A;  3R17 B;  3V2M A;  4FVN A;  3P58 A;  4CNV A;  1YO0 A;  3CYU A;  3P5L A;  1CAL A;  1CVH A;  4Q7V A;  1YO1 A;  3N2P A;  2CAB A;  5HPJ A;  3FW3 A;  1JV0 A;  4KV0 A;  2NN1 A;  4PQ7 A;  5IPZ A;  9CA2 A;  4YGF A;  5G0C A;  3M1Q A;  4HEY A;  1G3Z A;  5L3O A;  3V5G A;  1EOU A;  2Q1B A;  2CBC A;  5DSI A;  1CAZ A;  1CA2 A;  5SZ5 A;  3T5U A;  3DBU A;  3HS4 A;  4JSZ A;  1CAO A;  3PYK A;  4RUY A;  3PO6 A;  1TB0 X;  5DOG A;  1FQL A;  3OKU A;  1Z9Y A;  2CA2 A;  1ZSA A;  5FLT A;  5BYI A;  1ZFQ A;  4M2W A;  5EH8 A;  4Q07 A;  8CA2 A;  5DSK A;  2ILI A;  2VVB X;  4FL7 A;  4HU1 A;  4ITO A;  4Q0L A;  5EOI A;  3M04 A;  3DVD A;  5JQT A;  1KWQ A;  4XFW A;  5EIJ A;  4ZX0 A;  3OIK A;  3TVN X;  1ZFK A;  4Q8Z A;  3BL0 A;  1KEQ A;  5BRU A;  3T83 A;  3HKT A;  4Z1J A;  5JEP B;  2FMZ A;  4RUZ A;  4CAC A;  4YYT A;  1CVB A;  4Q08 A;  1LG5 A;  1ZSC A;  2W2J A;  4IWZ A;  4K0Z A;  3DVB A;  1AM6 A;  1AZM A;  1J9W A;  1G0F A;  4ZWX A;  1MOO A;  3M14 A;  4Z1N A;  5FNG A;  3BET A;  3SAX A;  1BNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...