1LG6A

Crystal structure analysis of hca ii mutant t199p in complex with thiocyanate
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
257
structure length
257
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLPTPPLLESVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase II
publication title Organization of an efficient carbonic anhydrase: implications for the mechanism based on structure-function studies of a T199P/C206S mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 69
structure length 257
sequence length 257
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2002-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1lg6A00
1CA3A 4RUZA 3HKUA 3ML5A 5DSRA 5DOGA 3R16A 1I8ZA 1TEQX 4CACA 3OKUA 3D92A 1CILA 1URTA 4HBAA 3TVNX 4TWMA 1BICA 3LXEA 3HKNA 3M1WA 1OKLA 2ILIA 3FFPX 1HUHA 1MOOA 1G3ZA 1KOPA 3MHMA 4MDGA 4BF6A 5IPZA 5EHVA 3OIKA 3T84A 1ZE8A 4ZWZA 5BNLA 2FOYA 1CNJA 3S77B 1YDCA 5JGTB 3M2NA 1AM6A 4HT0A 5AMLA 5SZ3A 2X7SA 1BNNA 4UOVA 5EHEA 4TWLA 3M3XA 1HCBA 4Q99A 1TH9A 2FOUA 2POUA 3SAXA 1G6VA 4KP5A 1RZDA 1I9OA 1CNKA 4YGFA 2CBDA 3F7UA 3MHLA 1TG3A 5HPJA 3TMJA 1BNWA 3S73B 2NWOA 4XIXA 9CA2A 1DMXA 2CBAA 1RJ6A 2CBEA 3D9ZA 3SBIA 3KLDB 1G4JA 4QJMA 3M1JA 5E2SA 3RZ5A 1Y7WA 3HKQA 4QJXA 1BNTA 1RZBA 4M2VA 2AW1A 3RZ1B 3Q31A 3MDZA 2WD2A 4Q9YA 4ILXA 5A6HA 2CABA 1FSRA 3BETA 3MHCA 5JG3B 3M98A 5E2NA 4WUQA 5DSLA 1TEUX 2FNMA 4PXXA 1FR7A 4R5BA 3P5AA 3M2ZA 4FL7A 2POWA 1OQ5A 4Z1EA 3V5GA 4YX4A 4M2UA 1TBTX 3C7PA 1BV3A 1CNHA 1G0EA 5DSIA 4QY3A 5EH7A 4QK1A 3V7XA 4XFWA 3MNHA 4JSSA 4MLXA 4YVYA 5EZTX 4HEWA 3S74B 3RG4A 4YGJA 1CALA 5DSQA 1CVDA 1H9QA 1CVEA 1G45A 3K34A 3NI5A 1UGGA 1I9NA 3B4FA 1CAJA 2HL4A 2OSFA 4IDRX 2NNGA 5FNIA 3RJ7A 4M2WA 5FLRA 1CVBA 1LGDA 5E5UA 1CVHA 4COQA 4Q07A 3SBHA 5G0CA 1CRMA 4HU1A 5JG5B 5E28A 4N0XB 1G4OA 4CA2A 2IT4A 5JESB 1FSQA 4YXUA 1ZGFA 12CAA 3MNKA 4BF1A 2FNKA 5FNJA 3HS4A 1TE3X 3M2YA 4K0SA 1DMYA 2HOCA 3MNUA 2WEHA 3S71B 4FRCA 1I9MA 5JEGB 5EH5A 5DSMA 1YO1A 3MHIA 5FLQA 3M04A 2HNCA 3RYYA 4MDMA 4JS6A 3M40A 5DSOA 3M5SA 4XE1A 3NB5A 5SZ1A 5BRUA 4ZX1A 3M1QA 1BNVA 1I9LA 3IBUA 1UGFA 1BZMA 3DC9A 1FQLA 4ZX0A 4ZWYA 4KAPA 3DAZA 5JEPB 3T5UA 3KNEA 5FDIA 4XZ5A 4ITOA 4QK2A 2NMXA 3OIMA 4L5UA 2EZ7A 2H4NA 3PYKA 5CJFA 5FL4A 1UGEA 2VVAX 4K1QA 4WR7A 2FW4A 4QJOA 4WW6A 3L14A 1OKMA 4WUPA 4E3HA 4RIVA 3OYQA 1THKA 1AVNA 3V2JA 4Q90A 5FLOA 3FW3A 4RIUA 2EU3A 1LZVA 1YDDA 4RUXA 4KNMA 4E5QA 3UYQA 3V3FA 4MDLA 5EKMA 2EU2A 2FOVA 3U7CA 1AZMA 4E49A 4KNIA 4PYXA 4ITPA 4YXIA 5FL6A 4Q8XA 4FVNA 1G1DA 1V9IC 3CZVA 2NNVA 2Q38A 1I9PA 3IGPA 1ZSAA 5JEHB 2F14A 5SZ2A 4N16A 1CRAA 4KV0A 3D8WA 4MLTA 4IWZA 4Q6DA 1IF4A 1G53A 1FLJA 1TB0X 5EOIA 3N4BA 1IF6A 5EKHA 5FNKA 4YGNA 4KP8A 4Z1JA 4QIZA 2WEGA 1CAHA 4ZWIA 3KONA 2W2JA 2NWPA 3IBNA 1CVFA 4JSWA 2FOSA 3GZ0A 4HEYA 3DV7A 5BYIA 1KOQA 1Z9YA 3HKTA 4KUYA 1LG6A 4CNWA 5SZ4A 1YDAA 4QK3A 1HEBA 1CAYA 1CVCA 1YDBA 1Z93A 3S97A 1LUGA 3HLJA 1CNWA 4Q06A 3P55A 7CA2A 2CBBA 2FOQA 2NXRA 3PJJA 4M2RA 5BRWA 3RYJB 1CNCA 5DRSA 5L6KA 4JSAA 3DD0A 1G54A 1FQNA 3DC3A 3F4XA 2O4ZA 3W6HA 3N2PA 3S72B 3MYQA 2GEHA 5AMGA 3CA2A 3P44A 4ZAOA 4FPTA 4Q78A 3T83A 3VBDA 1RAZA 4RFCA 4G0CA 3ZP9A 1CCTA 1UGDA 3M96A 1CINA 1FSNA 2NN1A 3KIGA 4RFDA 3MWOA 5FNMA 1XQ0A 3RZ8A 4YYTA 4R59A 4RH2A 1CAIA 1HCAA 4MTYA 1RJ5A 2POVA 1J9WA 2NNSA 3N3JA 1TG9A 4HF3A 3P58A 1BNUA 4YWPA 4K13A 1KWQA 4LP6A 5DVXA 4CQ0A 4KNJA 1Z97A 1CNBA 4PZHA 3T85A 5BRVA 3CYUA 4WW8A 3V3IB 3EFTA 3M67A 4DZ9A 1CCUA 4FVOA 5DSJA 2CA2A 1IF5A 1HVAA 3F7BA 5FNLA 1ZFKA 4Z1NA 4QJ0A 3P4VA 2HD6A 3OILA 1G48A 4GL1X 4YHAA 1G46A 4RUYA 2QP6A 4Q8YA 3V3HB 3S8XA 4Q6EA 4QSAA 1BN1A 4L5WA 4Q7WA 1FR4A 2OSMA 5DOHA 3BL1A 1ZNCA 3KS3A 2NXTA 3MNAA 5EHWA 2H15A 3S78B 2FMZA 2HFWA 1ZSBA 1KWRA 4Q08A 4Q7PA 1I90A 5FL5A 5SZ7A 1ZGEA 1BNQA 1CZMA 1FQRA 4KUVA 1V9EA 1YO2A 3DVCA 4XIWA 1ZH9A 4BCWA 1UGCA 3K7KA 1CNGA 5CACA 1H9NA 4Q8ZA 4PYYA 5J8ZA 1CA2A 3D93A 5DSKA 5C8IA 1CAMA 1CIMA 4L5VA 5JQ0A 1DCBA 3KWAA 3MZCA 1BN3A 1CAZA 1HUGA 4Q7SA 1RZEA 3FE4A 3V2MA 2NWYA 1TTMA 1LG5A 4FIKA 4PQ7A 4FU5A 3NJ9A 1OKNA 1CNXA 4Q81A 3U47A 3JXGA 5CLUA 5EH8A 3S75B 4CNXA 3QYKA 3D0NA 4KNNA 4YGKA 5A25A 4LHIA 4Z0QA 1DCAA 3RZ7A 1IF7A 3RYZA 1H4NA 3EFIA 5FLSA 1RAYA 1G52A 2NXSA 2X7UA 5E5RA 2HKKA 5EKJA 3DVDA 1CNIA 4K0TA 1JCZA 4KUWA 1UGBA 5DSNA 1T9NA 4QJWA 3IBLA 1FQMA 4Q49A 3IEOA 4E3GA 5SZ0A 3MHOA 3U3AX 4R5AA 3DCWA 3PO6A 4ZWXA 1EOUA 3V3JA 5EIJA 5FLPA 1CAOA 1IF8A 3DBUA 4QSIA 2NN7A 2Q1QA 2QO8A 3S76A 5SZ5A 5E2MA 2ZNCA 5JGSB 2WEOA 3RG3A 2AX2A 1G0FA 3B1BA 3MNJA 3P5LA 5FNGA 1HEAA 1CCSA 3BL0A 3M5TA 5E2KA 6CA2A 1CAKA 1KEQA 3RYVB 4Q83A 2FNNA 5FNHA 1JV0A 5JQTA 4Q7VA 5FDCA 5G01A 1UGAA 3V3GB 3M5EA 5DSPA 3RLDA 1BNMA 3TVOX 3R17B 4RN4A 4QIYA 2QOAA 3DVBA 3IBIA 4DZ7A 1HECA 4QSBA 3KOKA 3RGEA 4K0ZA 2NWZA 4YXOA 3HFPA 3SAPA 2CBCA 3OYSA 3IAIA 3ML2A 4Y0JA 4Q09A 3S9TA 4E3FA 5FLTA 4G7AA 3DCSA 3JXHC 3K2FA 1F2WA 4MO8A 3KKXA 2Q1BA 2ABEA 3F8EA 1ZSCA 1CNYA 1XEVA 5LMDA 3MMFA 4E9OX 5AMDA 5JDVB 2FMGA 3DD8A 1IF9A 2VVBX 1RZAA 4HEZA 1ZFQA 3OKVA 4QTLA 2X7TA 1CANA 3JXFA 1JD0A 3MNIA 2WEJA 1XEGA 3P3HA 4Q87A 4E3DA 4E4AA 3DA2A 1A42A 3OY0A 3P3JA 1CVAA 2WD3A 3N0NA 4LU3A 5G0BA 1I9QA 1I91A 3W6IA 4QEFA 3RYXB 2GD8A 4WL4A 4CNVA 8CA2A 3M2XA 1MUAA 1BN4A 4Q0LA 4X5SA 5G03A 3M14A 3CAJA 3UYNA 5E2RA 4Z1KA 4C3TA 3KOIA 3M1KA 4QSJA 1YO0A 4YGLA 3DCCA 4ETQC 4CNRA 1RZCA 4QJPA 1HEDA 3T82A 1XPZA 5L3OA 3U45X 4HT2A 3RZ0B 1BCDA 3T5ZA 5SZ6A 2NNOA 4JSZA 5CA2A 3ZNCA
chains in the Genus database with same CATH superfamily
1CA3A 4RUZA 3HKUA 3ML5A 5DSRA 5DOGA 3R16A 1I8ZA 1TEQX 4CACA 3OKUA 3D92A 1CILA 1URTA 4HBAA 3TVNX 4TWMA 1BICA 3LXEA 3HKNA 3M1WA 1OKLA 2ILIA 3FFPX 1HUHA 1MOOA 1G3ZA 1KOPA 3MHMA 4MDGA 4BF6A 5IPZA 5EHVA 3OIKA 3T84A 1ZE8A 4ZWZA 5BNLA 2FOYA 1CNJA 3S77B 1YDCA 5JGTB 3M2NA 1AM6A 4HT0A 5AMLA 5SZ3A 2X7SA 1BNNA 4UOVA 5EHEA 4TWLA 3M3XA 1HCBA 4Q99A 1TH9A 2FOUA 2POUA 3SAXA 1G6VA 4KP5A 1RZDA 1I9OA 1CNKA 4YGFA 2CBDA 3F7UA 3MHLA 1TG3A 5HPJA 3TMJA 1BNWA 3S73B 2NWOA 4XIXA 9CA2A 1DMXA 2CBAA 1RJ6A 2CBEA 3D9ZA 3SBIA 3KLDB 1G4JA 4QJMA 3M1JA 5E2SA 3RZ5A 1Y7WA 3HKQA 4QJXA 1BNTA 1RZBA 4M2VA 2AW1A 3RZ1B 3Q31A 3MDZA 2WD2A 4Q9YA 4ILXA 5A6HA 2CABA 1FSRA 3BETA 3MHCA 5JG3B 3M98A 5E2NA 4WUQA 5DSLA 1TEUX 2FNMA 4PXXA 1FR7A 4R5BA 3P5AA 3M2ZA 4FL7A 2POWA 1OQ5A 4Z1EA 3V5GA 4YX4A 4M2UA 1TBTX 3C7PA 1BV3A 1CNHA 1G0EA 5DSIA 4QY3A 5EH7A 4QK1A 3V7XA 4XFWA 3MNHA 4JSSA 4MLXA 4YVYA 5EZTX 4HEWA 3S74B 3RG4A 4YGJA 1CALA 5DSQA 1CVDA 1H9QA 1CVEA 1G45A 3K34A 3NI5A 1UGGA 1I9NA 3B4FA 1CAJA 2HL4A 2OSFA 4IDRX 2NNGA 5FNIA 3RJ7A 4M2WA 5FLRA 1CVBA 1LGDA 5E5UA 1CVHA 4COQA 4Q07A 3SBHA 5G0CA 1CRMA 4HU1A 5JG5B 5E28A 4N0XB 1G4OA 4CA2A 2IT4A 5JESB 1FSQA 4YXUA 1ZGFA 12CAA 3MNKA 4BF1A 2FNKA 5FNJA 3HS4A 1TE3X 3M2YA 4K0SA 1DMYA 2HOCA 3MNUA 2WEHA 3S71B 4FRCA 1I9MA 5JEGB 5EH5A 5DSMA 1YO1A 3MHIA 5FLQA 3M04A 2HNCA 3RYYA 4MDMA 4JS6A 3M40A 5DSOA 3M5SA 4XE1A 3NB5A 5SZ1A 5BRUA 4ZX1A 3M1QA 1BNVA 1I9LA 3IBUA 1UGFA 1BZMA 3DC9A 1FQLA 4ZX0A 4ZWYA 4KAPA 3DAZA 5JEPB 3T5UA 3KNEA 5FDIA 4XZ5A 4ITOA 4QK2A 2NMXA 3OIMA 4L5UA 2EZ7A 2H4NA 3PYKA 5CJFA 5FL4A 1UGEA 2VVAX 4K1QA 4WR7A 2FW4A 4QJOA 4WW6A 3L14A 1OKMA 4WUPA 4E3HA 4RIVA 3OYQA 1THKA 1AVNA 3V2JA 4Q90A 5FLOA 3FW3A 4RIUA 2EU3A 1LZVA 1YDDA 4RUXA 4KNMA 4E5QA 3UYQA 3V3FA 4MDLA 5EKMA 2EU2A 2FOVA 3U7CA 1AZMA 4E49A 4KNIA 4PYXA 4ITPA 4YXIA 5FL6A 4Q8XA 4FVNA 1G1DA 1V9IC 3CZVA 2NNVA 2Q38A 1I9PA 3IGPA 1ZSAA 5JEHB 2F14A 5SZ2A 4N16A 1CRAA 4KV0A 3D8WA 4MLTA 4IWZA 4Q6DA 1IF4A 1G53A 1FLJA 1TB0X 5EOIA 3N4BA 1IF6A 5EKHA 5FNKA 4YGNA 4KP8A 4Z1JA 4QIZA 2WEGA 1CAHA 4ZWIA 3KONA 2W2JA 2NWPA 3IBNA 1CVFA 4JSWA 2FOSA 3GZ0A 4HEYA 3DV7A 5BYIA 1KOQA 1Z9YA 3HKTA 4KUYA 1LG6A 4CNWA 5SZ4A 1YDAA 4QK3A 1HEBA 1CAYA 1CVCA 1YDBA 1Z93A 3S97A 1LUGA 3HLJA 1CNWA 4Q06A 3P55A 7CA2A 2CBBA 2FOQA 2NXRA 3PJJA 4M2RA 5BRWA 3RYJB 1CNCA 5DRSA 5L6KA 4JSAA 3DD0A 1G54A 1FQNA 3DC3A 3F4XA 2O4ZA 3W6HA 3N2PA 3S72B 3MYQA 2GEHA 5AMGA 3CA2A 3P44A 4ZAOA 4FPTA 4Q78A 3T83A 3VBDA 1RAZA 4RFCA 4G0CA 3ZP9A 1CCTA 1UGDA 3M96A 1CINA 1FSNA 2NN1A 3KIGA 4RFDA 3MWOA 5FNMA 1XQ0A 3RZ8A 4YYTA 4R59A 4RH2A 1CAIA 1HCAA 4MTYA 1RJ5A 2POVA 1J9WA 2NNSA 3N3JA 1TG9A 4HF3A 3P58A 1BNUA 4YWPA 4K13A 1KWQA 4LP6A 5DVXA 4CQ0A 4KNJA 1Z97A 1CNBA 4PZHA 3T85A 5BRVA 3CYUA 4WW8A 3V3IB 3EFTA 3M67A 4DZ9A 1CCUA 4FVOA 5DSJA 2CA2A 1IF5A 1HVAA 3F7BA 5FNLA 1ZFKA 4Z1NA 4QJ0A 3P4VA 2HD6A 3OILA 1G48A 4GL1X 4YHAA 1G46A 4RUYA 2QP6A 4Q8YA 3V3HB 3S8XA 4Q6EA 4QSAA 1BN1A 4L5WA 4Q7WA 1FR4A 2OSMA 5DOHA 3BL1A 1ZNCA 3KS3A 2NXTA 3MNAA 5EHWA 2H15A 3S78B 2FMZA 2HFWA 1ZSBA 1KWRA 4Q08A 4Q7PA 1I90A 5FL5A 5SZ7A 1ZGEA 1BNQA 1CZMA 1FQRA 4KUVA 1V9EA 1YO2A 3DVCA 4XIWA 1ZH9A 4BCWA 1UGCA 3K7KA 1CNGA 5CACA 1H9NA 4Q8ZA 4PYYA 5J8ZA 1CA2A 3D93A 5DSKA 5C8IA 1CAMA 1CIMA 4L5VA 5JQ0A 1DCBA 3KWAA 3MZCA 1BN3A 1CAZA 1HUGA 4Q7SA 1RZEA 3FE4A 3V2MA 2NWYA 1TTMA 1LG5A 4FIKA 4PQ7A 4FU5A 3NJ9A 1OKNA 1CNXA 4Q81A 3U47A 3JXGA 5CLUA 5EH8A 3S75B 4CNXA 3QYKA 3D0NA 4KNNA 4YGKA 5A25A 4LHIA 4Z0QA 1DCAA 3RZ7A 1IF7A 3RYZA 1H4NA 3EFIA 5FLSA 1RAYA 1G52A 2NXSA 2X7UA 5E5RA 2HKKA 5EKJA 3DVDA 1CNIA 4K0TA 1JCZA 4KUWA 1UGBA 5DSNA 1T9NA 4QJWA 3IBLA 1FQMA 4Q49A 3IEOA 4E3GA 5SZ0A 3MHOA 3U3AX 4R5AA 3DCWA 3PO6A 4ZWXA 1EOUA 3V3JA 5EIJA 5FLPA 1CAOA 1IF8A 3DBUA 4QSIA 2NN7A 2Q1QA 2QO8A 3S76A 5SZ5A 5E2MA 2ZNCA 5JGSB 2WEOA 3RG3A 2AX2A 1G0FA 3B1BA 3MNJA 3P5LA 5FNGA 1HEAA 1CCSA 3BL0A 3M5TA 5E2KA 6CA2A 1CAKA 1KEQA 3RYVB 4Q83A 2FNNA 5FNHA 1JV0A 5JQTA 4Q7VA 5FDCA 5G01A 1UGAA 3V3GB 3M5EA 5DSPA 3RLDA 1BNMA 3TVOX 3R17B 4RN4A 4QIYA 2QOAA 3DVBA 3IBIA 4DZ7A 1HECA 4QSBA 3KOKA 3RGEA 4K0ZA 2NWZA 4YXOA 3HFPA 3SAPA 2CBCA 3OYSA 3IAIA 3ML2A 4Y0JA 4Q09A 3S9TA 4E3FA 5FLTA 4G7AA 3DCSA 3JXHC 3K2FA 1F2WA 4MO8A 3KKXA 2Q1BA 2ABEA 3F8EA 1ZSCA 1CNYA 1XEVA 5LMDA 3MMFA 4E9OX 5AMDA 5JDVB 2FMGA 3DD8A 1IF9A 2VVBX 1RZAA 4HEZA 1ZFQA 3OKVA 4QTLA 2X7TA 1CANA 3JXFA 1JD0A 3MNIA 2WEJA 1XEGA 3P3HA 4Q87A 4E3DA 4E4AA 3DA2A 1A42A 3OY0A 3P3JA 1CVAA 2WD3A 3N0NA 4LU3A 5G0BA 1I9QA 1I91A 3W6IA 4QEFA 3RYXB 2GD8A 4WL4A 4CNVA 8CA2A 3M2XA 1MUAA 1BN4A 4Q0LA 4X5SA 5G03A 3M14A 3CAJA 3UYNA 5E2RA 4Z1KA 4C3TA 3KOIA 3M1KA 4QSJA 1YO0A 4YGLA 3DCCA 4ETQC 4CNRA 1RZCA 4QJPA 1HEDA 3T82A 1XPZA 5L3OA 3U45X 4HT2A 3RZ0B 1BCDA 3T5ZA 5SZ6A 2NNOA 4JSZA 5CA2A 3ZNCA
chains in the Genus database with same CATH topology
1CA3A 4RUZA 3HKUA 3ML5A 5DSRA 5DOGA 3R16A 1I8ZA 1TEQX 4CACA 3OKUA 3D92A 1CILA 1URTA 4HBAA 3TVNX 4TWMA 1BICA 3LXEA 3HKNA 3M1WA 1OKLA 2ILIA 3FFPX 1HUHA 1MOOA 1G3ZA 1KOPA 3MHMA 4MDGA 4BF6A 5IPZA 5EHVA 3OIKA 3T84A 1ZE8A 4ZWZA 5BNLA 2FOYA 1CNJA 3S77B 1YDCA 5JGTB 3M2NA 1AM6A 4HT0A 5AMLA 5SZ3A 2X7SA 1BNNA 4UOVA 5EHEA 4TWLA 3M3XA 1HCBA 4Q99A 1TH9A 2FOUA 2POUA 3SAXA 1G6VA 4KP5A 1RZDA 1I9OA 1CNKA 4YGFA 2CBDA 3F7UA 3MHLA 1TG3A 5HPJA 3TMJA 1BNWA 3S73B 2NWOA 4XIXA 9CA2A 1DMXA 2CBAA 1RJ6A 2CBEA 3D9ZA 3SBIA 3KLDB 1G4JA 4QJMA 3M1JA 5E2SA 3RZ5A 1Y7WA 3HKQA 4QJXA 1BNTA 1RZBA 4M2VA 2AW1A 3RZ1B 3Q31A 3MDZA 2WD2A 4Q9YA 4ILXA 5A6HA 2CABA 1FSRA 3BETA 3MHCA 5JG3B 3M98A 5E2NA 4WUQA 5DSLA 1TEUX 2FNMA 4PXXA 1FR7A 4R5BA 3P5AA 3M2ZA 4FL7A 2POWA 1OQ5A 4Z1EA 3V5GA 4YX4A 4M2UA 1TBTX 3C7PA 1BV3A 1CNHA 1G0EA 5DSIA 4QY3A 5EH7A 4QK1A 3V7XA 4XFWA 3MNHA 4JSSA 4MLXA 4YVYA 5EZTX 4HEWA 3S74B 3RG4A 4YGJA 1CALA 5DSQA 1CVDA 1H9QA 1CVEA 1G45A 3K34A 3NI5A 1UGGA 1I9NA 3B4FA 1CAJA 2HL4A 2OSFA 4IDRX 2NNGA 5FNIA 3RJ7A 4M2WA 5FLRA 1CVBA 1LGDA 5E5UA 1CVHA 4COQA 4Q07A 3SBHA 5G0CA 1CRMA 4HU1A 5JG5B 5E28A 4N0XB 1G4OA 4CA2A 2IT4A 5JESB 1FSQA 4YXUA 1ZGFA 12CAA 3MNKA 4BF1A 2FNKA 5FNJA 3HS4A 1TE3X 3M2YA 4K0SA 1DMYA 2HOCA 3MNUA 2WEHA 3S71B 4FRCA 1I9MA 5JEGB 5EH5A 5DSMA 1YO1A 3MHIA 5FLQA 3M04A 2HNCA 3RYYA 4MDMA 4JS6A 3M40A 5DSOA 3M5SA 4XE1A 3NB5A 5SZ1A 5BRUA 4ZX1A 3M1QA 1BNVA 1I9LA 3IBUA 1UGFA 1BZMA 3DC9A 1FQLA 4ZX0A 4ZWYA 4KAPA 3DAZA 5JEPB 3T5UA 3KNEA 5FDIA 4XZ5A 4ITOA 4QK2A 2NMXA 3OIMA 4L5UA 2EZ7A 2H4NA 3PYKA 5CJFA 5FL4A 1UGEA 2VVAX 4K1QA 4WR7A 2FW4A 4QJOA 4WW6A 3L14A 1OKMA 4WUPA 4E3HA 4RIVA 3OYQA 1THKA 1AVNA 3V2JA 4Q90A 5FLOA 3FW3A 4RIUA 2EU3A 1LZVA 1YDDA 4RUXA 4KNMA 4E5QA 3UYQA 3V3FA 4MDLA 5EKMA 2EU2A 2FOVA 3U7CA 1AZMA 4E49A 4KNIA 4PYXA 4ITPA 4YXIA 5FL6A 4Q8XA 4FVNA 1G1DA 1V9IC 3CZVA 2NNVA 2Q38A 1I9PA 3IGPA 1ZSAA 5JEHB 2F14A 5SZ2A 4N16A 1CRAA 4KV0A 3D8WA 4MLTA 4IWZA 4Q6DA 1IF4A 1G53A 1FLJA 1TB0X 5EOIA 3N4BA 1IF6A 5EKHA 5FNKA 4YGNA 4KP8A 4Z1JA 4QIZA 2WEGA 1CAHA 4ZWIA 3KONA 2W2JA 2NWPA 3IBNA 1CVFA 4JSWA 2FOSA 3GZ0A 4HEYA 3DV7A 5BYIA 1KOQA 1Z9YA 3HKTA 4KUYA 1LG6A 4CNWA 5SZ4A 1YDAA 4QK3A 1HEBA 1CAYA 1CVCA 1YDBA 1Z93A 3S97A 1LUGA 3HLJA 1CNWA 4Q06A 3P55A 7CA2A 2CBBA 2FOQA 2NXRA 3PJJA 4M2RA 5BRWA 3RYJB 1CNCA 5DRSA 5L6KA 4JSAA 3DD0A 1G54A 1FQNA 3DC3A 3F4XA 2O4ZA 3W6HA 3N2PA 3S72B 3MYQA 2GEHA 5AMGA 3CA2A 3P44A 4ZAOA 4FPTA 4Q78A 3T83A 3VBDA 1RAZA 4RFCA 4G0CA 3ZP9A 1CCTA 1UGDA 3M96A 1CINA 1FSNA 2NN1A 3KIGA 4RFDA 3MWOA 5FNMA 1XQ0A 3RZ8A 4YYTA 4R59A 4RH2A 1CAIA 1HCAA 4MTYA 1RJ5A 2POVA 1J9WA 2NNSA 3N3JA 1TG9A 4HF3A 3P58A 1BNUA 4YWPA 4K13A 1KWQA 4LP6A 5DVXA 4CQ0A 4KNJA 1Z97A 1CNBA 4PZHA 3T85A 5BRVA 3CYUA 4WW8A 3V3IB 3EFTA 3M67A 4DZ9A 1CCUA 4FVOA 5DSJA 2CA2A 1IF5A 1HVAA 3F7BA 5FNLA 1ZFKA 4Z1NA 4QJ0A 3P4VA 2HD6A 3OILA 1G48A 4GL1X 4YHAA 1G46A 4RUYA 2QP6A 4Q8YA 3V3HB 3S8XA 4Q6EA 4QSAA 1BN1A 4L5WA 4Q7WA 1FR4A 2OSMA 5DOHA 3BL1A 1ZNCA 3KS3A 2NXTA 3MNAA 5EHWA 2H15A 3S78B 2FMZA 2HFWA 1ZSBA 1KWRA 4Q08A 4Q7PA 1I90A 5FL5A 5SZ7A 1ZGEA 1BNQA 1CZMA 1FQRA 4KUVA 1V9EA 1YO2A 3DVCA 4XIWA 1ZH9A 4BCWA 1UGCA 3K7KA 1CNGA 5CACA 1H9NA 4Q8ZA 4PYYA 5J8ZA 1CA2A 3D93A 5DSKA 5C8IA 1CAMA 1CIMA 4L5VA 5JQ0A 1DCBA 3KWAA 3MZCA 1BN3A 1CAZA 1HUGA 4Q7SA 1RZEA 3FE4A 3V2MA 2NWYA 1TTMA 1LG5A 4FIKA 4PQ7A 4FU5A 3NJ9A 1OKNA 1CNXA 4Q81A 3U47A 3JXGA 5CLUA 5EH8A 3S75B 4CNXA 3QYKA 3D0NA 4KNNA 4YGKA 5A25A 4LHIA 4Z0QA 1DCAA 3RZ7A 1IF7A 3RYZA 1H4NA 3EFIA 5FLSA 1RAYA 1G52A 2NXSA 2X7UA 5E5RA 2HKKA 5EKJA 3DVDA 1CNIA 4K0TA 1JCZA 4KUWA 1UGBA 5DSNA 1T9NA 4QJWA 3IBLA 1FQMA 4Q49A 3IEOA 4E3GA 5SZ0A 3MHOA 3U3AX 4R5AA 3DCWA 3PO6A 4ZWXA 1EOUA 3V3JA 5EIJA 5FLPA 1CAOA 1IF8A 3DBUA 4QSIA 2NN7A 2Q1QA 2QO8A 3S76A 5SZ5A 5E2MA 2ZNCA 5JGSB 2WEOA 3RG3A 2AX2A 1G0FA 3B1BA 3MNJA 3P5LA 5FNGA 1HEAA 1CCSA 3BL0A 3M5TA 5E2KA 6CA2A 1CAKA 1KEQA 3RYVB 4Q83A 2FNNA 5FNHA 1JV0A 5JQTA 4Q7VA 5FDCA 5G01A 1UGAA 3V3GB 3M5EA 5DSPA 3RLDA 1BNMA 3TVOX 3R17B 4RN4A 4QIYA 2QOAA 3DVBA 3IBIA 4DZ7A 1HECA 4QSBA 3KOKA 3RGEA 4K0ZA 2NWZA 4YXOA 3HFPA 3SAPA 2CBCA 3OYSA 3IAIA 3ML2A 4Y0JA 4Q09A 3S9TA 4E3FA 5FLTA 4G7AA 3DCSA 3JXHC 3K2FA 1F2WA 4MO8A 3KKXA 2Q1BA 2ABEA 3F8EA 1ZSCA 1CNYA 1XEVA 5LMDA 3MMFA 4E9OX 5AMDA 5JDVB 2FMGA 3DD8A 1IF9A 2VVBX 1RZAA 4HEZA 1ZFQA 3OKVA 4QTLA 2X7TA 1CANA 3JXFA 1JD0A 3MNIA 2WEJA 1XEGA 3P3HA 4Q87A 4E3DA 4E4AA 3DA2A 1A42A 3OY0A 3P3JA 1CVAA 2WD3A 3N0NA 4LU3A 5G0BA 1I9QA 1I91A 3W6IA 4QEFA 3RYXB 2GD8A 4WL4A 4CNVA 8CA2A 3M2XA 1MUAA 1BN4A 4Q0LA 4X5SA 5G03A 3M14A 3CAJA 3UYNA 5E2RA 4Z1KA 4C3TA 3KOIA 3M1KA 4QSJA 1YO0A 4YGLA 3DCCA 4ETQC 4CNRA 1RZCA 4QJPA 1HEDA 3T82A 1XPZA 5L3OA 3U45X 4HT2A 3RZ0B 1BCDA 3T5ZA 5SZ6A 2NNOA 4JSZA 5CA2A 3ZNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CA3 A;  4RUZ A;  3HKU A;  3ML5 A;  5DSR A;  5DOG A;  3R16 A;  1I8Z A;  1TEQ X;  4CAC A;  3OKU A;  3D92 A;  1CIL A;  1URT A;  4HBA A;  3TVN X;  4TWM A;  1BIC A;  3LXE A;  3HKN A;  3M1W A;  1OKL A;  2ILI A;  3FFP X;  1HUH A;  1MOO A;  1G3Z A;  1KOP A;  3MHM A;  4MDG A;  4BF6 A;  5IPZ A;  5EHV A;  3OIK A;  3T84 A;  1ZE8 A;  4ZWZ A;  5BNL A;  2FOY A;  1CNJ A;  3S77 B;  1YDC A;  5JGT B;  3M2N A;  1AM6 A;  4HT0 A;  5AML A;  5SZ3 A;  2X7S A;  1BNN A;  4UOV A;  5EHE A;  4TWL A;  3M3X A;  1HCB A;  4Q99 A;  1TH9 A;  2FOU A;  2POU A;  3SAX A;  1G6V A;  4KP5 A;  1RZD A;  1I9O A;  1CNK A;  4YGF A;  2CBD A;  3F7U A;  3MHL A;  1TG3 A;  5HPJ A;  3TMJ A;  1BNW A;  3S73 B;  2NWO A;  4XIX A;  9CA2 A;  1DMX A;  2CBA A;  1RJ6 A;  2CBE A;  3D9Z A;  3SBI A;  3KLD B;  1G4J A;  4QJM A;  3M1J A;  5E2S A;  3RZ5 A;  1Y7W A;  3HKQ A;  4QJX A;  1BNT A;  1RZB A;  4M2V A;  2AW1 A;  3RZ1 B;  3Q31 A;  3MDZ A;  2WD2 A;  4Q9Y A;  4ILX A;  5A6H A;  2CAB A;  1FSR A;  3BET A;  3MHC A;  5JG3 B;  3M98 A;  5E2N A;  4WUQ A;  5DSL A;  1TEU X;  2FNM A;  4PXX A;  1FR7 A;  4R5B A;  3P5A A;  3M2Z A;  4FL7 A;  2POW A;  1OQ5 A;  4Z1E A;  3V5G A;  4YX4 A;  4M2U A;  1TBT X;  3C7P A;  1BV3 A;  1CNH A;  1G0E A;  5DSI A;  4QY3 A;  5EH7 A;  4QK1 A;  3V7X A;  4XFW A;  3MNH A;  4JSS A;  4MLX A;  4YVY A;  5EZT X;  4HEW A;  3S74 B;  3RG4 A;  4YGJ A;  1CAL A;  5DSQ A;  1CVD A;  1H9Q A;  1CVE A;  1G45 A;  3K34 A;  3NI5 A;  1UGG A;  1I9N A;  3B4F A;  1CAJ A;  2HL4 A;  2OSF A;  4IDR X;  2NNG A;  5FNI A;  3RJ7 A;  4M2W A;  5FLR A;  1CVB A;  1LGD A;  5E5U A;  1CVH A;  4COQ A;  4Q07 A;  3SBH A;  5G0C A;  1CRM A;  4HU1 A;  5JG5 B;  5E28 A;  4N0X B;  1G4O A;  4CA2 A;  2IT4 A;  5JES B;  1FSQ A;  4YXU A;  1ZGF A;  12CA A;  3MNK A;  4BF1 A;  2FNK A;  5FNJ A;  3HS4 A;  1TE3 X;  3M2Y A;  4K0S A;  1DMY A;  2HOC A;  3MNU A;  2WEH A;  3S71 B;  4FRC A;  1I9M A;  5JEG B;  5EH5 A;  5DSM A;  1YO1 A;  3MHI A;  5FLQ A;  3M04 A;  2HNC A;  3RYY A;  4MDM A;  4JS6 A;  3M40 A;  5DSO A;  3M5S A;  4XE1 A;  3NB5 A;  5SZ1 A;  5BRU A;  4ZX1 A;  3M1Q A;  1BNV A;  1I9L A;  3IBU A;  1UGF A;  1BZM A;  3DC9 A;  1FQL A;  4ZX0 A;  4ZWY A;  4KAP A;  3DAZ A;  5JEP B;  3T5U A;  3KNE A;  5FDI A;  4XZ5 A;  4ITO A;  4QK2 A;  2NMX A;  3OIM A;  4L5U A;  2EZ7 A;  2H4N A;  3PYK A;  5CJF A;  5FL4 A;  1UGE A;  2VVA X;  4K1Q A;  4WR7 A;  2FW4 A;  4QJO A;  4WW6 A;  3L14 A;  1OKM A;  4WUP A;  4E3H A;  4RIV A;  3OYQ A;  1THK A;  1AVN A;  3V2J A;  4Q90 A;  5FLO A;  3FW3 A;  4RIU A;  2EU3 A;  1LZV A;  1YDD A;  4RUX A;  4KNM A;  4E5Q A;  3UYQ A;  3V3F A;  4MDL A;  5EKM A;  2EU2 A;  2FOV A;  3U7C A;  1AZM A;  4E49 A;  4KNI A;  4PYX A;  4ITP A;  4YXI A;  5FL6 A;  4Q8X A;  4FVN A;  1G1D A;  1V9I C;  3CZV A;  2NNV A;  2Q38 A;  1I9P A;  3IGP A;  1ZSA A;  5JEH B;  2F14 A;  5SZ2 A;  4N16 A;  1CRA A;  4KV0 A;  3D8W A;  4MLT A;  4IWZ A;  4Q6D A;  1IF4 A;  1G53 A;  1FLJ A;  1TB0 X;  5EOI A;  3N4B A;  1IF6 A;  5EKH A;  5FNK A;  4YGN A;  4KP8 A;  4Z1J A;  4QIZ A;  2WEG A;  1CAH A;  4ZWI A;  3KON A;  2W2J A;  2NWP A;  3IBN A;  1CVF A;  4JSW A;  2FOS A;  3GZ0 A;  4HEY A;  3DV7 A;  5BYI A;  1KOQ A;  1Z9Y A;  3HKT A;  4KUY A;  1LG6 A;  4CNW A;  5SZ4 A;  1YDA A;  4QK3 A;  1HEB A;  1CAY A;  1CVC A;  1YDB A;  1Z93 A;  3S97 A;  1LUG A;  3HLJ A;  1CNW A;  4Q06 A;  3P55 A;  7CA2 A;  2CBB A;  2FOQ A;  2NXR A;  3PJJ A;  4M2R A;  5BRW A;  3RYJ B;  1CNC A;  5DRS A;  5L6K A;  4JSA A;  3DD0 A;  1G54 A;  1FQN A;  3DC3 A;  3F4X A;  2O4Z A;  3W6H A;  3N2P A;  3S72 B;  3MYQ A;  2GEH A;  5AMG A;  3CA2 A;  3P44 A;  4ZAO A;  4FPT A;  4Q78 A;  3T83 A;  3VBD A;  1RAZ A;  4RFC A;  4G0C A;  3ZP9 A;  1CCT A;  1UGD A;  3M96 A;  1CIN A;  1FSN A;  2NN1 A;  3KIG A;  4RFD A;  3MWO A;  5FNM A;  1XQ0 A;  3RZ8 A;  4YYT A;  4R59 A;  4RH2 A;  1CAI A;  1HCA A;  4MTY A;  1RJ5 A;  2POV A;  1J9W A;  2NNS A;  3N3J A;  1TG9 A;  4HF3 A;  3P58 A;  1BNU A;  4YWP A;  4K13 A;  1KWQ A;  4LP6 A;  5DVX A;  4CQ0 A;  4KNJ A;  1Z97 A;  1CNB A;  4PZH A;  3T85 A;  5BRV A;  3CYU A;  4WW8 A;  3V3I B;  3EFT A;  3M67 A;  4DZ9 A;  1CCU A;  4FVO A;  5DSJ A;  2CA2 A;  1IF5 A;  1HVA A;  3F7B A;  5FNL A;  1ZFK A;  4Z1N A;  4QJ0 A;  3P4V A;  2HD6 A;  3OIL A;  1G48 A;  4GL1 X;  4YHA A;  1G46 A;  4RUY A;  2QP6 A;  4Q8Y A;  3V3H B;  3S8X A;  4Q6E A;  4QSA A;  1BN1 A;  4L5W A;  4Q7W A;  1FR4 A;  2OSM A;  5DOH A;  3BL1 A;  1ZNC A;  3KS3 A;  2NXT A;  3MNA A;  5EHW A;  2H15 A;  3S78 B;  2FMZ A;  2HFW A;  1ZSB A;  1KWR A;  4Q08 A;  4Q7P A;  1I90 A;  5FL5 A;  5SZ7 A;  1ZGE A;  1BNQ A;  1CZM A;  1FQR A;  4KUV A;  1V9E A;  1YO2 A;  3DVC A;  4XIW A;  1ZH9 A;  4BCW A;  1UGC A;  3K7K A;  1CNG A;  5CAC A;  1H9N A;  4Q8Z A;  4PYY A;  5J8Z A;  1CA2 A;  3D93 A;  5DSK A;  5C8I A;  1CAM A;  1CIM A;  4L5V A;  5JQ0 A;  1DCB A;  3KWA A;  3MZC A;  1BN3 A;  1CAZ A;  1HUG A;  4Q7S A;  1RZE A;  3FE4 A;  3V2M A;  2NWY A;  1TTM A;  1LG5 A;  4FIK A;  4PQ7 A;  4FU5 A;  3NJ9 A;  1OKN A;  1CNX A;  4Q81 A;  3U47 A;  3JXG A;  5CLU A;  5EH8 A;  3S75 B;  4CNX A;  3QYK A;  3D0N A;  4KNN A;  4YGK A;  5A25 A;  4LHI A;  4Z0Q A;  1DCA A;  3RZ7 A;  1IF7 A;  3RYZ A;  1H4N A;  3EFI A;  5FLS A;  1RAY A;  1G52 A;  2NXS A;  2X7U A;  5E5R A;  2HKK A;  5EKJ A;  3DVD A;  1CNI A;  4K0T A;  1JCZ A;  4KUW A;  1UGB A;  5DSN A;  1T9N A;  4QJW A;  3IBL A;  1FQM A;  4Q49 A;  3IEO A;  4E3G A;  5SZ0 A;  3MHO A;  3U3A X;  4R5A A;  3DCW A;  3PO6 A;  4ZWX A;  1EOU A;  3V3J A;  5EIJ A;  5FLP A;  1CAO A;  1IF8 A;  3DBU A;  4QSI A;  2NN7 A;  2Q1Q A;  2QO8 A;  3S76 A;  5SZ5 A;  5E2M A;  2ZNC A;  5JGS B;  2WEO A;  3RG3 A;  2AX2 A;  1G0F A;  3B1B A;  3MNJ A;  3P5L A;  5FNG A;  1HEA A;  1CCS A;  3BL0 A;  3M5T A;  5E2K A;  6CA2 A;  1CAK A;  1KEQ A;  3RYV B;  4Q83 A;  2FNN A;  5FNH A;  1JV0 A;  5JQT A;  4Q7V A;  5FDC A;  5G01 A;  1UGA A;  3V3G B;  3M5E A;  5DSP A;  3RLD A;  1BNM A;  3TVO X;  3R17 B;  4RN4 A;  4QIY A;  2QOA A;  3DVB A;  3IBI A;  4DZ7 A;  1HEC A;  4QSB A;  3KOK A;  3RGE A;  4K0Z A;  2NWZ A;  4YXO A;  3HFP A;  3SAP A;  2CBC A;  3OYS A;  3IAI A;  3ML2 A;  4Y0J A;  4Q09 A;  3S9T A;  4E3F A;  5FLT A;  4G7A A;  3DCS A;  3JXH C;  3K2F A;  1F2W A;  4MO8 A;  3KKX A;  2Q1B A;  2ABE A;  3F8E A;  1ZSC A;  1CNY A;  1XEV A;  5LMD A;  3MMF A;  4E9O X;  5AMD A;  5JDV B;  2FMG A;  3DD8 A;  1IF9 A;  2VVB X;  1RZA A;  4HEZ A;  1ZFQ A;  3OKV A;  4QTL A;  2X7T A;  1CAN A;  3JXF A;  1JD0 A;  3MNI A;  2WEJ A;  1XEG A;  3P3H A;  4Q87 A;  4E3D A;  4E4A A;  3DA2 A;  1A42 A;  3OY0 A;  3P3J A;  1CVA A;  2WD3 A;  3N0N A;  4LU3 A;  5G0B A;  1I9Q A;  1I91 A;  3W6I A;  4QEF A;  3RYX B;  2GD8 A;  4WL4 A;  4CNV A;  8CA2 A;  3M2X A;  1MUA A;  1BN4 A;  4Q0L A;  4X5S A;  5G03 A;  3M14 A;  3CAJ A;  3UYN A;  5E2R A;  4Z1K A;  4C3T A;  3KOI A;  3M1K A;  4QSJ A;  1YO0 A;  4YGL A;  3DCC A;  4ETQ C;  4CNR A;  1RZC A;  4QJP A;  1HED A;  3T82 A;  1XPZ A;  5L3O A;  3U45 X;  4HT2 A;  3RZ0 B;  1BCD A;  3T5Z A;  5SZ6 A;  2NNO A;  4JSZ A;  5CA2 A;  3ZNC A; 
#chains in the Genus database with same CATH topology
 1CA3 A;  4RUZ A;  3HKU A;  3ML5 A;  5DSR A;  5DOG A;  3R16 A;  1I8Z A;  1TEQ X;  4CAC A;  3OKU A;  3D92 A;  1CIL A;  1URT A;  4HBA A;  3TVN X;  4TWM A;  1BIC A;  3LXE A;  3HKN A;  3M1W A;  1OKL A;  2ILI A;  3FFP X;  1HUH A;  1MOO A;  1G3Z A;  1KOP A;  3MHM A;  4MDG A;  4BF6 A;  5IPZ A;  5EHV A;  3OIK A;  3T84 A;  1ZE8 A;  4ZWZ A;  5BNL A;  2FOY A;  1CNJ A;  3S77 B;  1YDC A;  5JGT B;  3M2N A;  1AM6 A;  4HT0 A;  5AML A;  5SZ3 A;  2X7S A;  1BNN A;  4UOV A;  5EHE A;  4TWL A;  3M3X A;  1HCB A;  4Q99 A;  1TH9 A;  2FOU A;  2POU A;  3SAX A;  1G6V A;  4KP5 A;  1RZD A;  1I9O A;  1CNK A;  4YGF A;  2CBD A;  3F7U A;  3MHL A;  1TG3 A;  5HPJ A;  3TMJ A;  1BNW A;  3S73 B;  2NWO A;  4XIX A;  9CA2 A;  1DMX A;  2CBA A;  1RJ6 A;  2CBE A;  3D9Z A;  3SBI A;  3KLD B;  1G4J A;  4QJM A;  3M1J A;  5E2S A;  3RZ5 A;  1Y7W A;  3HKQ A;  4QJX A;  1BNT A;  1RZB A;  4M2V A;  2AW1 A;  3RZ1 B;  3Q31 A;  3MDZ A;  2WD2 A;  4Q9Y A;  4ILX A;  5A6H A;  2CAB A;  1FSR A;  3BET A;  3MHC A;  5JG3 B;  3M98 A;  5E2N A;  4WUQ A;  5DSL A;  1TEU X;  2FNM A;  4PXX A;  1FR7 A;  4R5B A;  3P5A A;  3M2Z A;  4FL7 A;  2POW A;  1OQ5 A;  4Z1E A;  3V5G A;  4YX4 A;  4M2U A;  1TBT X;  3C7P A;  1BV3 A;  1CNH A;  1G0E A;  5DSI A;  4QY3 A;  5EH7 A;  4QK1 A;  3V7X A;  4XFW A;  3MNH A;  4JSS A;  4MLX A;  4YVY A;  5EZT X;  4HEW A;  3S74 B;  3RG4 A;  4YGJ A;  1CAL A;  5DSQ A;  1CVD A;  1H9Q A;  1CVE A;  1G45 A;  3K34 A;  3NI5 A;  1UGG A;  1I9N A;  3B4F A;  1CAJ A;  2HL4 A;  2OSF A;  4IDR X;  2NNG A;  5FNI A;  3RJ7 A;  4M2W A;  5FLR A;  1CVB A;  1LGD A;  5E5U A;  1CVH A;  4COQ A;  4Q07 A;  3SBH A;  5G0C A;  1CRM A;  4HU1 A;  5JG5 B;  5E28 A;  4N0X B;  1G4O A;  4CA2 A;  2IT4 A;  5JES B;  1FSQ A;  4YXU A;  1ZGF A;  12CA A;  3MNK A;  4BF1 A;  2FNK A;  5FNJ A;  3HS4 A;  1TE3 X;  3M2Y A;  4K0S A;  1DMY A;  2HOC A;  3MNU A;  2WEH A;  3S71 B;  4FRC A;  1I9M A;  5JEG B;  5EH5 A;  5DSM A;  1YO1 A;  3MHI A;  5FLQ A;  3M04 A;  2HNC A;  3RYY A;  4MDM A;  4JS6 A;  3M40 A;  5DSO A;  3M5S A;  4XE1 A;  3NB5 A;  5SZ1 A;  5BRU A;  4ZX1 A;  3M1Q A;  1BNV A;  1I9L A;  3IBU A;  1UGF A;  1BZM A;  3DC9 A;  1FQL A;  4ZX0 A;  4ZWY A;  4KAP A;  3DAZ A;  5JEP B;  3T5U A;  3KNE A;  5FDI A;  4XZ5 A;  4ITO A;  4QK2 A;  2NMX A;  3OIM A;  4L5U A;  2EZ7 A;  2H4N A;  3PYK A;  5CJF A;  5FL4 A;  1UGE A;  2VVA X;  4K1Q A;  4WR7 A;  2FW4 A;  4QJO A;  4WW6 A;  3L14 A;  1OKM A;  4WUP A;  4E3H A;  4RIV A;  3OYQ A;  1THK A;  1AVN A;  3V2J A;  4Q90 A;  5FLO A;  3FW3 A;  4RIU A;  2EU3 A;  1LZV A;  1YDD A;  4RUX A;  4KNM A;  4E5Q A;  3UYQ A;  3V3F A;  4MDL A;  5EKM A;  2EU2 A;  2FOV A;  3U7C A;  1AZM A;  4E49 A;  4KNI A;  4PYX A;  4ITP A;  4YXI A;  5FL6 A;  4Q8X A;  4FVN A;  1G1D A;  1V9I C;  3CZV A;  2NNV A;  2Q38 A;  1I9P A;  3IGP A;  1ZSA A;  5JEH B;  2F14 A;  5SZ2 A;  4N16 A;  1CRA A;  4KV0 A;  3D8W A;  4MLT A;  4IWZ A;  4Q6D A;  1IF4 A;  1G53 A;  1FLJ A;  1TB0 X;  5EOI A;  3N4B A;  1IF6 A;  5EKH A;  5FNK A;  4YGN A;  4KP8 A;  4Z1J A;  4QIZ A;  2WEG A;  1CAH A;  4ZWI A;  3KON A;  2W2J A;  2NWP A;  3IBN A;  1CVF A;  4JSW A;  2FOS A;  3GZ0 A;  4HEY A;  3DV7 A;  5BYI A;  1KOQ A;  1Z9Y A;  3HKT A;  4KUY A;  1LG6 A;  4CNW A;  5SZ4 A;  1YDA A;  4QK3 A;  1HEB A;  1CAY A;  1CVC A;  1YDB A;  1Z93 A;  3S97 A;  1LUG A;  3HLJ A;  1CNW A;  4Q06 A;  3P55 A;  7CA2 A;  2CBB A;  2FOQ A;  2NXR A;  3PJJ A;  4M2R A;  5BRW A;  3RYJ B;  1CNC A;  5DRS A;  5L6K A;  4JSA A;  3DD0 A;  1G54 A;  1FQN A;  3DC3 A;  3F4X A;  2O4Z A;  3W6H A;  3N2P A;  3S72 B;  3MYQ A;  2GEH A;  5AMG A;  3CA2 A;  3P44 A;  4ZAO A;  4FPT A;  4Q78 A;  3T83 A;  3VBD A;  1RAZ A;  4RFC A;  4G0C A;  3ZP9 A;  1CCT A;  1UGD A;  3M96 A;  1CIN A;  1FSN A;  2NN1 A;  3KIG A;  4RFD A;  3MWO A;  5FNM A;  1XQ0 A;  3RZ8 A;  4YYT A;  4R59 A;  4RH2 A;  1CAI A;  1HCA A;  4MTY A;  1RJ5 A;  2POV A;  1J9W A;  2NNS A;  3N3J A;  1TG9 A;  4HF3 A;  3P58 A;  1BNU A;  4YWP A;  4K13 A;  1KWQ A;  4LP6 A;  5DVX A;  4CQ0 A;  4KNJ A;  1Z97 A;  1CNB A;  4PZH A;  3T85 A;  5BRV A;  3CYU A;  4WW8 A;  3V3I B;  3EFT A;  3M67 A;  4DZ9 A;  1CCU A;  4FVO A;  5DSJ A;  2CA2 A;  1IF5 A;  1HVA A;  3F7B A;  5FNL A;  1ZFK A;  4Z1N A;  4QJ0 A;  3P4V A;  2HD6 A;  3OIL A;  1G48 A;  4GL1 X;  4YHA A;  1G46 A;  4RUY A;  2QP6 A;  4Q8Y A;  3V3H B;  3S8X A;  4Q6E A;  4QSA A;  1BN1 A;  4L5W A;  4Q7W A;  1FR4 A;  2OSM A;  5DOH A;  3BL1 A;  1ZNC A;  3KS3 A;  2NXT A;  3MNA A;  5EHW A;  2H15 A;  3S78 B;  2FMZ A;  2HFW A;  1ZSB A;  1KWR A;  4Q08 A;  4Q7P A;  1I90 A;  5FL5 A;  5SZ7 A;  1ZGE A;  1BNQ A;  1CZM A;  1FQR A;  4KUV A;  1V9E A;  1YO2 A;  3DVC A;  4XIW A;  1ZH9 A;  4BCW A;  1UGC A;  3K7K A;  1CNG A;  5CAC A;  1H9N A;  4Q8Z A;  4PYY A;  5J8Z A;  1CA2 A;  3D93 A;  5DSK A;  5C8I A;  1CAM A;  1CIM A;  4L5V A;  5JQ0 A;  1DCB A;  3KWA A;  3MZC A;  1BN3 A;  1CAZ A;  1HUG A;  4Q7S A;  1RZE A;  3FE4 A;  3V2M A;  2NWY A;  1TTM A;  1LG5 A;  4FIK A;  4PQ7 A;  4FU5 A;  3NJ9 A;  1OKN A;  1CNX A;  4Q81 A;  3U47 A;  3JXG A;  5CLU A;  5EH8 A;  3S75 B;  4CNX A;  3QYK A;  3D0N A;  4KNN A;  4YGK A;  5A25 A;  4LHI A;  4Z0Q A;  1DCA A;  3RZ7 A;  1IF7 A;  3RYZ A;  1H4N A;  3EFI A;  5FLS A;  1RAY A;  1G52 A;  2NXS A;  2X7U A;  5E5R A;  2HKK A;  5EKJ A;  3DVD A;  1CNI A;  4K0T A;  1JCZ A;  4KUW A;  1UGB A;  5DSN A;  1T9N A;  4QJW A;  3IBL A;  1FQM A;  4Q49 A;  3IEO A;  4E3G A;  5SZ0 A;  3MHO A;  3U3A X;  4R5A A;  3DCW A;  3PO6 A;  4ZWX A;  1EOU A;  3V3J A;  5EIJ A;  5FLP A;  1CAO A;  1IF8 A;  3DBU A;  4QSI A;  2NN7 A;  2Q1Q A;  2QO8 A;  3S76 A;  5SZ5 A;  5E2M A;  2ZNC A;  5JGS B;  2WEO A;  3RG3 A;  2AX2 A;  1G0F A;  3B1B A;  3MNJ A;  3P5L A;  5FNG A;  1HEA A;  1CCS A;  3BL0 A;  3M5T A;  5E2K A;  6CA2 A;  1CAK A;  1KEQ A;  3RYV B;  4Q83 A;  2FNN A;  5FNH A;  1JV0 A;  5JQT A;  4Q7V A;  5FDC A;  5G01 A;  1UGA A;  3V3G B;  3M5E A;  5DSP A;  3RLD A;  1BNM A;  3TVO X;  3R17 B;  4RN4 A;  4QIY A;  2QOA A;  3DVB A;  3IBI A;  4DZ7 A;  1HEC A;  4QSB A;  3KOK A;  3RGE A;  4K0Z A;  2NWZ A;  4YXO A;  3HFP A;  3SAP A;  2CBC A;  3OYS A;  3IAI A;  3ML2 A;  4Y0J A;  4Q09 A;  3S9T A;  4E3F A;  5FLT A;  4G7A A;  3DCS A;  3JXH C;  3K2F A;  1F2W A;  4MO8 A;  3KKX A;  2Q1B A;  2ABE A;  3F8E A;  1ZSC A;  1CNY A;  1XEV A;  5LMD A;  3MMF A;  4E9O X;  5AMD A;  5JDV B;  2FMG A;  3DD8 A;  1IF9 A;  2VVB X;  1RZA A;  4HEZ A;  1ZFQ A;  3OKV A;  4QTL A;  2X7T A;  1CAN A;  3JXF A;  1JD0 A;  3MNI A;  2WEJ A;  1XEG A;  3P3H A;  4Q87 A;  4E3D A;  4E4A A;  3DA2 A;  1A42 A;  3OY0 A;  3P3J A;  1CVA A;  2WD3 A;  3N0N A;  4LU3 A;  5G0B A;  1I9Q A;  1I91 A;  3W6I A;  4QEF A;  3RYX B;  2GD8 A;  4WL4 A;  4CNV A;  8CA2 A;  3M2X A;  1MUA A;  1BN4 A;  4Q0L A;  4X5S A;  5G03 A;  3M14 A;  3CAJ A;  3UYN A;  5E2R A;  4Z1K A;  4C3T A;  3KOI A;  3M1K A;  4QSJ A;  1YO0 A;  4YGL A;  3DCC A;  4ETQ C;  4CNR A;  1RZC A;  4QJP A;  1HED A;  3T82 A;  1XPZ A;  5L3O A;  3U45 X;  4HT2 A;  3RZ0 B;  1BCD A;  3T5Z A;  5SZ6 A;  2NNO A;  4JSZ A;  5CA2 A;  3ZNC A; 
#chains in the Genus database with same CATH homology
 1CA3 A;  4RUZ A;  3HKU A;  3ML5 A;  5DSR A;  5DOG A;  3R16 A;  1I8Z A;  1TEQ X;  4CAC A;  3OKU A;  3D92 A;  1CIL A;  1URT A;  4HBA A;  3TVN X;  4TWM A;  1BIC A;  3LXE A;  3HKN A;  3M1W A;  1OKL A;  2ILI A;  3FFP X;  1HUH A;  1MOO A;  1G3Z A;  1KOP A;  3MHM A;  4MDG A;  4BF6 A;  5IPZ A;  5EHV A;  3OIK A;  3T84 A;  1ZE8 A;  4ZWZ A;  5BNL A;  2FOY A;  1CNJ A;  3S77 B;  1YDC A;  5JGT B;  3M2N A;  1AM6 A;  4HT0 A;  5AML A;  5SZ3 A;  2X7S A;  1BNN A;  4UOV A;  5EHE A;  4TWL A;  3M3X A;  1HCB A;  4Q99 A;  1TH9 A;  2FOU A;  2POU A;  3SAX A;  1G6V A;  4KP5 A;  1RZD A;  1I9O A;  1CNK A;  4YGF A;  2CBD A;  3F7U A;  3MHL A;  1TG3 A;  5HPJ A;  3TMJ A;  1BNW A;  3S73 B;  2NWO A;  4XIX A;  9CA2 A;  1DMX A;  2CBA A;  1RJ6 A;  2CBE A;  3D9Z A;  3SBI A;  3KLD B;  1G4J A;  4QJM A;  3M1J A;  5E2S A;  3RZ5 A;  1Y7W A;  3HKQ A;  4QJX A;  1BNT A;  1RZB A;  4M2V A;  2AW1 A;  3RZ1 B;  3Q31 A;  3MDZ A;  2WD2 A;  4Q9Y A;  4ILX A;  5A6H A;  2CAB A;  1FSR A;  3BET A;  3MHC A;  5JG3 B;  3M98 A;  5E2N A;  4WUQ A;  5DSL A;  1TEU X;  2FNM A;  4PXX A;  1FR7 A;  4R5B A;  3P5A A;  3M2Z A;  4FL7 A;  2POW A;  1OQ5 A;  4Z1E A;  3V5G A;  4YX4 A;  4M2U A;  1TBT X;  3C7P A;  1BV3 A;  1CNH A;  1G0E A;  5DSI A;  4QY3 A;  5EH7 A;  4QK1 A;  3V7X A;  4XFW A;  3MNH A;  4JSS A;  4MLX A;  4YVY A;  5EZT X;  4HEW A;  3S74 B;  3RG4 A;  4YGJ A;  1CAL A;  5DSQ A;  1CVD A;  1H9Q A;  1CVE A;  1G45 A;  3K34 A;  3NI5 A;  1UGG A;  1I9N A;  3B4F A;  1CAJ A;  2HL4 A;  2OSF A;  4IDR X;  2NNG A;  5FNI A;  3RJ7 A;  4M2W A;  5FLR A;  1CVB A;  1LGD A;  5E5U A;  1CVH A;  4COQ A;  4Q07 A;  3SBH A;  5G0C A;  1CRM A;  4HU1 A;  5JG5 B;  5E28 A;  4N0X B;  1G4O A;  4CA2 A;  2IT4 A;  5JES B;  1FSQ A;  4YXU A;  1ZGF A;  12CA A;  3MNK A;  4BF1 A;  2FNK A;  5FNJ A;  3HS4 A;  1TE3 X;  3M2Y A;  4K0S A;  1DMY A;  2HOC A;  3MNU A;  2WEH A;  3S71 B;  4FRC A;  1I9M A;  5JEG B;  5EH5 A;  5DSM A;  1YO1 A;  3MHI A;  5FLQ A;  3M04 A;  2HNC A;  3RYY A;  4MDM A;  4JS6 A;  3M40 A;  5DSO A;  3M5S A;  4XE1 A;  3NB5 A;  5SZ1 A;  5BRU A;  4ZX1 A;  3M1Q A;  1BNV A;  1I9L A;  3IBU A;  1UGF A;  1BZM A;  3DC9 A;  1FQL A;  4ZX0 A;  4ZWY A;  4KAP A;  3DAZ A;  5JEP B;  3T5U A;  3KNE A;  5FDI A;  4XZ5 A;  4ITO A;  4QK2 A;  2NMX A;  3OIM A;  4L5U A;  2EZ7 A;  2H4N A;  3PYK A;  5CJF A;  5FL4 A;  1UGE A;  2VVA X;  4K1Q A;  4WR7 A;  2FW4 A;  4QJO A;  4WW6 A;  3L14 A;  1OKM A;  4WUP A;  4E3H A;  4RIV A;  3OYQ A;  1THK A;  1AVN A;  3V2J A;  4Q90 A;  5FLO A;  3FW3 A;  4RIU A;  2EU3 A;  1LZV A;  1YDD A;  4RUX A;  4KNM A;  4E5Q A;  3UYQ A;  3V3F A;  4MDL A;  5EKM A;  2EU2 A;  2FOV A;  3U7C A;  1AZM A;  4E49 A;  4KNI A;  4PYX A;  4ITP A;  4YXI A;  5FL6 A;  4Q8X A;  4FVN A;  1G1D A;  1V9I C;  3CZV A;  2NNV A;  2Q38 A;  1I9P A;  3IGP A;  1ZSA A;  5JEH B;  2F14 A;  5SZ2 A;  4N16 A;  1CRA A;  4KV0 A;  3D8W A;  4MLT A;  4IWZ A;  4Q6D A;  1IF4 A;  1G53 A;  1FLJ A;  1TB0 X;  5EOI A;  3N4B A;  1IF6 A;  5EKH A;  5FNK A;  4YGN A;  4KP8 A;  4Z1J A;  4QIZ A;  2WEG A;  1CAH A;  4ZWI A;  3KON A;  2W2J A;  2NWP A;  3IBN A;  1CVF A;  4JSW A;  2FOS A;  3GZ0 A;  4HEY A;  3DV7 A;  5BYI A;  1KOQ A;  1Z9Y A;  3HKT A;  4KUY A;  1LG6 A;  4CNW A;  5SZ4 A;  1YDA A;  4QK3 A;  1HEB A;  1CAY A;  1CVC A;  1YDB A;  1Z93 A;  3S97 A;  1LUG A;  3HLJ A;  1CNW A;  4Q06 A;  3P55 A;  7CA2 A;  2CBB A;  2FOQ A;  2NXR A;  3PJJ A;  4M2R A;  5BRW A;  3RYJ B;  1CNC A;  5DRS A;  5L6K A;  4JSA A;  3DD0 A;  1G54 A;  1FQN A;  3DC3 A;  3F4X A;  2O4Z A;  3W6H A;  3N2P A;  3S72 B;  3MYQ A;  2GEH A;  5AMG A;  3CA2 A;  3P44 A;  4ZAO A;  4FPT A;  4Q78 A;  3T83 A;  3VBD A;  1RAZ A;  4RFC A;  4G0C A;  3ZP9 A;  1CCT A;  1UGD A;  3M96 A;  1CIN A;  1FSN A;  2NN1 A;  3KIG A;  4RFD A;  3MWO A;  5FNM A;  1XQ0 A;  3RZ8 A;  4YYT A;  4R59 A;  4RH2 A;  1CAI A;  1HCA A;  4MTY A;  1RJ5 A;  2POV A;  1J9W A;  2NNS A;  3N3J A;  1TG9 A;  4HF3 A;  3P58 A;  1BNU A;  4YWP A;  4K13 A;  1KWQ A;  4LP6 A;  5DVX A;  4CQ0 A;  4KNJ A;  1Z97 A;  1CNB A;  4PZH A;  3T85 A;  5BRV A;  3CYU A;  4WW8 A;  3V3I B;  3EFT A;  3M67 A;  4DZ9 A;  1CCU A;  4FVO A;  5DSJ A;  2CA2 A;  1IF5 A;  1HVA A;  3F7B A;  5FNL A;  1ZFK A;  4Z1N A;  4QJ0 A;  3P4V A;  2HD6 A;  3OIL A;  1G48 A;  4GL1 X;  4YHA A;  1G46 A;  4RUY A;  2QP6 A;  4Q8Y A;  3V3H B;  3S8X A;  4Q6E A;  4QSA A;  1BN1 A;  4L5W A;  4Q7W A;  1FR4 A;  2OSM A;  5DOH A;  3BL1 A;  1ZNC A;  3KS3 A;  2NXT A;  3MNA A;  5EHW A;  2H15 A;  3S78 B;  2FMZ A;  2HFW A;  1ZSB A;  1KWR A;  4Q08 A;  4Q7P A;  1I90 A;  5FL5 A;  5SZ7 A;  1ZGE A;  1BNQ A;  1CZM A;  1FQR A;  4KUV A;  1V9E A;  1YO2 A;  3DVC A;  4XIW A;  1ZH9 A;  4BCW A;  1UGC A;  3K7K A;  1CNG A;  5CAC A;  1H9N A;  4Q8Z A;  4PYY A;  5J8Z A;  1CA2 A;  3D93 A;  5DSK A;  5C8I A;  1CAM A;  1CIM A;  4L5V A;  5JQ0 A;  1DCB A;  3KWA A;  3MZC A;  1BN3 A;  1CAZ A;  1HUG A;  4Q7S A;  1RZE A;  3FE4 A;  3V2M A;  2NWY A;  1TTM A;  1LG5 A;  4FIK A;  4PQ7 A;  4FU5 A;  3NJ9 A;  1OKN A;  1CNX A;  4Q81 A;  3U47 A;  3JXG A;  5CLU A;  5EH8 A;  3S75 B;  4CNX A;  3QYK A;  3D0N A;  4KNN A;  4YGK A;  5A25 A;  4LHI A;  4Z0Q A;  1DCA A;  3RZ7 A;  1IF7 A;  3RYZ A;  1H4N A;  3EFI A;  5FLS A;  1RAY A;  1G52 A;  2NXS A;  2X7U A;  5E5R A;  2HKK A;  5EKJ A;  3DVD A;  1CNI A;  4K0T A;  1JCZ A;  4KUW A;  1UGB A;  5DSN A;  1T9N A;  4QJW A;  3IBL A;  1FQM A;  4Q49 A;  3IEO A;  4E3G A;  5SZ0 A;  3MHO A;  3U3A X;  4R5A A;  3DCW A;  3PO6 A;  4ZWX A;  1EOU A;  3V3J A;  5EIJ A;  5FLP A;  1CAO A;  1IF8 A;  3DBU A;  4QSI A;  2NN7 A;  2Q1Q A;  2QO8 A;  3S76 A;  5SZ5 A;  5E2M A;  2ZNC A;  5JGS B;  2WEO A;  3RG3 A;  2AX2 A;  1G0F A;  3B1B A;  3MNJ A;  3P5L A;  5FNG A;  1HEA A;  1CCS A;  3BL0 A;  3M5T A;  5E2K A;  6CA2 A;  1CAK A;  1KEQ A;  3RYV B;  4Q83 A;  2FNN A;  5FNH A;  1JV0 A;  5JQT A;  4Q7V A;  5FDC A;  5G01 A;  1UGA A;  3V3G B;  3M5E A;  5DSP A;  3RLD A;  1BNM A;  3TVO X;  3R17 B;  4RN4 A;  4QIY A;  2QOA A;  3DVB A;  3IBI A;  4DZ7 A;  1HEC A;  4QSB A;  3KOK A;  3RGE A;  4K0Z A;  2NWZ A;  4YXO A;  3HFP A;  3SAP A;  2CBC A;  3OYS A;  3IAI A;  3ML2 A;  4Y0J A;  4Q09 A;  3S9T A;  4E3F A;  5FLT A;  4G7A A;  3DCS A;  3JXH C;  3K2F A;  1F2W A;  4MO8 A;  3KKX A;  2Q1B A;  2ABE A;  3F8E A;  1ZSC A;  1CNY A;  1XEV A;  5LMD A;  3MMF A;  4E9O X;  5AMD A;  5JDV B;  2FMG A;  3DD8 A;  1IF9 A;  2VVB X;  1RZA A;  4HEZ A;  1ZFQ A;  3OKV A;  4QTL A;  2X7T A;  1CAN A;  3JXF A;  1JD0 A;  3MNI A;  2WEJ A;  1XEG A;  3P3H A;  4Q87 A;  4E3D A;  4E4A A;  3DA2 A;  1A42 A;  3OY0 A;  3P3J A;  1CVA A;  2WD3 A;  3N0N A;  4LU3 A;  5G0B A;  1I9Q A;  1I91 A;  3W6I A;  4QEF A;  3RYX B;  2GD8 A;  4WL4 A;  4CNV A;  8CA2 A;  3M2X A;  1MUA A;  1BN4 A;  4Q0L A;  4X5S A;  5G03 A;  3M14 A;  3CAJ A;  3UYN A;  5E2R A;  4Z1K A;  4C3T A;  3KOI A;  3M1K A;  4QSJ A;  1YO0 A;  4YGL A;  3DCC A;  4ETQ C;  4CNR A;  1RZC A;  4QJP A;  1HED A;  3T82 A;  1XPZ A;  5L3O A;  3U45 X;  4HT2 A;  3RZ0 B;  1BCD A;  3T5Z A;  5SZ6 A;  2NNO A;  4JSZ A;  5CA2 A;  3ZNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...