1V9EA

Crystal structure analysis of bovine carbonic anhydrase ii
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
Knots found
sequence length
259
structure length
259
Chain Sequence
SHHWGYGKHNGPEHWHKDFPIANGERQSPVDIDTKAVVQDPALKPLALVYGEATSRRMVNNGHSFNVEYDDSQDKAVLKDGPLTGTYRLVQFHFHWGSSDDQGSEHTVDRKKYAAELHLVHWNTKYGDFGTAAQQPDGLAVVGVFLKVGDANPALQKVLDALDSIKTKGKSTDFPNFDPGSLLPNVLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSQQMLKFRTLNFNAEGEPELLMLANWRPAQPLKNRQVRGFPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase II
publication title Structure of bovine carbonic anhydrase II at 1.95 A resolution.
pubmed doi rcsb
molecule tags Lyase
total genus 75
structure length 259
sequence length 259
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2004-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1v9eA00
4JSAA 3MHOA 4Q8YA 3S73B 1CIMA 3R16A 5DSLA 3IBLA 1THKA 3M2NA 3DVDA 4E9OX 5JESB 3OY0A 3V2JA 5SZ7A 4HEZA 5SZ6A 4CA2A 1ZNCA 1LG5A 5SZ0A 4E3HA 4N16A 4XIWA 3M3XA 4CNVA 3D92A 1RAZA 3S75B 4G7AA 1G0FA 1HCBA 1BNMA 4M2UA 3F7UA 2QP6A 3D9ZA 1IF7A 5FNGA 3JXFA 3MNIA 2X7SA 3HKTA 3DVCA 1CNIA 3R17B 4ITOA 4YVYA 3BL1A 4Q09A 1V9EA 4K13A 1BNNA 3KOIA 3NI5A 3P3HA 3PO6A 3SAPA 2POWA 1G48A 3V2MA 1DMYA 1BICA 12CAA 2WD2A 4HBAA 4FU5A 4FL7A 3N0NA 4R5BA 2NWYA 4YGJA 5FNMA 1BCDA 5EHVA 5EKJA 5JEPB 1LGDA 2FOSA 3S76A 5JEHB 1BNWA 2CBEA 2ZNCA 4K0ZA 3N3JA 3M1QA 4YYTA 2FOUA 4KUWA 3DC9A 3PYKA 3U47A 3OIMA 4Q7WA 3W6IA 3MNKA 4ZWIA 5E2SA 1I9PA 3JXGA 5FNLA 1CZMA 5G0BA 5BRWA 1FQLA 3T85A 4WUPA 3KWAA 5JEGB 5EHWA 4Q6DA 4MDMA 5CJFA 2EU2A 1J9WA 3DD8A 1CAMA 5EHEA 2NNOA 1YO1A 2WEHA 3RLDA 5FLSA 3SAXA 1CAZA 3LXEA 4ZX1A 3RYZA 4YHAA 3M2ZA 3M1WA 4L5VA 1I8ZA 3T5UA 2NWZA 3HLJA 1XPZA 1G46A 3D8WA 4HU1A 3MHLA 4ITPA 1V9IC 4Q78A 4PYXA 3RG4A 4YGKA 3MZCA 5EKMA 1TBTX 4CNXA 2FMZA 2QO8A 4Z1NA 2Q38A 9CA2A 5JG5B 3RZ5A 2NNVA 3TVNX 4E3GA 3FW3A 1FSNA 4QK1A 3ML2A 4Q9YA 4Q0LA 4ZWYA 4Y0JA 3S78B 3T84A 4Q81A 6CA2A 1ZSBA 1CNGA 1F2WA 1CVEA 2HL4A 1FQNA 3T83A 4DZ9A 4XZ5A 1G6VA 3RGEA 1IF5A 2HOCA 5L6KA 3MDZA 4Q8XA 5E2KA 1OKLA 4ZWXA 1YDDA 1BNVA 4DZ7A 5G0CA 4IDRX 2HKKA 4QJ0A 3TMJA 1CA3A 1TE3X 3S8XA 3RYVB 3GZ0A 4HEYA 3S72B 2CBAA 4Z1JA 1CRAA 5E5RA 5FLQA 5E2MA 3RG3A 3KIGA 4CNWA 1TTMA 3MMFA 4WUQA 5G03A 4JSSA 1KOPA 5DOHA 4KNIA 3RZ7A 4E5QA 3M40A 4JSWA 4CNRA 1CVBA 4Q49A 4MO8A 4LU3A 1IF6A 5A6HA 3P3JA 4QSIA 1H9NA 5BYIA 5FLOA 1ZSCA 3SBHA 3P5LA 5SZ1A 3KLDB 4M2VA 1CNBA 4FPTA 1TH9A 5JQTA 4QJOA 1CVFA 4ETQC 1G54A 3ZNCA 1CALA 1CNKA 4RH2A 1JD0A 2AW1A 2CBDA 1CANA 4YXUA 5AMLA 2AX2A 4FVNA 1CNXA 5E28A 5SZ5A 3M96A 4YXOA 5EOIA 1ZE8A 4N0XB 5FLRA 2EU3A 3DV7A 4FRCA 2VVBX 4KP8A 1EOUA 3HFPA 1RZCA 3DC3A 5FLPA 4HT0A 4ILXA 3V7XA 1I9LA 2GD8A 5EIJA 4BF6A 5CACA 1YDAA 4CACA 1G0EA 4K0TA 1HEDA 5DSOA 3DD0A 4R59A 2CBBA 4E4AA 2FNKA 1HEBA 1I91A 2NWPA 2HFWA 4WL4A 3M5TA 4YXIA 2NNSA 2WEOA 5DOGA 3MHCA 1RJ5A 1YO0A 5JDVB 4YWPA 5EZTX 3MNAA 4HT2A 1HUHA 4QK2A 1UGAA 1Z93A 3KKXA 4KUVA 3FE4A 3RZ0B 1LG6A 1RAYA 3HKNA 5IPZA 4Q7VA 1YO2A 5JGSB 1I90A 5FDIA 4QJWA 1H4NA 2F14A 4MDLA 4ZAOA 3DVBA 1ZH9A 1G53A 1UGDA 3NB5A 1BN4A 4BCWA 1BN1A 4Q7SA 5FDCA 5C8IA 4QIYA 1DCAA 4WW6A 1KWQA 2NWOA 3MNUA 4Q83A 1FSQA 5LMDA 3M1JA 5E5UA 1CRMA 3QYKA 4RUZA 2Q1BA 2FOVA 5FL6A 1G1DA 3B4FA 1I9MA 1AM6A 3M67A 5L3OA 4LP6A 1CNWA 4XE1A 1UGCA 7CA2A 4E3DA 3BL0A 2H4NA 3OKVA 1RJ6A 4R5AA 3CA2A 4Z0QA 1MOOA 3W6HA 3M2XA 4Q90A 2QOAA 3M04A 1KEQA 4YGLA 3L14A 3P55A 3MNJA 2POVA 1IF8A 3B1BA 4MTYA 3P58A 4K0SA 5JQ0A 4Q8ZA 3OYQA 5FL4A 4Z1EA 3OILA 3ZP9A 1I9QA 1TG9A 2HD6A 3U45X 1H9QA 3C7PA 3KONA 1CCTA 3EFIA 3IBUA 3DCSA 5AMDA 1CA2A 4ZX0A 4QJPA 4KAPA 3V3GB 1YDCA 2CBCA 2X7TA 1UGEA 2O4ZA 3VBDA 3MHIA 3ML5A 1I9OA 4YGNA 3DAZA 4HF3A 1JCZA 1XEVA 2ILIA 3M1KA 3DBUA 4RFCA 1CAHA 2WD3A 1CNJA 3V3JA 3BETA 5DSPA 4QEFA 1ZFQA 1BNQA 1CNYA 4WW8A 5E2RA 1OKNA 3UYNA 4Q99A 4PZHA 4X5SA 5E2NA 5EH8A 1UGFA 3M2YA 4JS6A 4E49A 4QY3A 2CABA 2OSMA 2POUA 5A25A 1DCBA 1KOQA 5AMGA 1URTA 3PJJA 3HKQA 1ZSAA 1KWRA 1CNHA 3OIKA 5SZ2A 1HCAA 1IF9A 4PQ7A 3S97A 3MWOA 1RZAA 3N2PA 3KS3A 3P4VA 4PYYA 3U3AX 3UYQA 3M5EA 4LHIA 2FNNA 4QJMA 3M98A 1FR7A 1CAKA 2NNGA 3N4BA 4QIZA 5DSNA 4QSAA 3S71B 5SZ3A 1BZMA 2FW4A 2NN1A 4XFWA 3K34A 1FQRA 5DSMA 1HUGA 5FL5A 4QJXA 4KNNA 1BN3A 3DCCA 4Q87A 4QSJA 4L5UA 1FQMA 4YX4A 5JGTB 4M2RA 1TEUX 2HNCA 2WEJA 1YDBA 3V3IB 3OKUA 1FLJA 1I9NA 1Y7WA 4KUYA 3V3HB 1CCUA 4KV0A 2CA2A 3S9TA 1A42A 2NN7A 5JG3B 2NXSA 3M5SA 1MUAA 1BNTA 2FOQA 1CAJA 1CVAA 3F7BA 3MHMA 5FNHA 5G01A 4Z1KA 5DSIA 1LZVA 3HS4A 3HKUA 3S77B 4MLXA 3P5AA 1CINA 3T82A 3P44A 5DSRA 3IAIA 1OQ5A 4WR7A 3MNHA 2NMXA 5CA2A 4Q07A 4Q7PA 3JXHC 2FOYA 3U7CA 1CILA 5FNKA 4PXXA 2VVAX 4YGFA 5BNLA 4TWMA 1AZMA 3CZVA 3D93A 1UGGA 4MLTA 3F8EA 4RUXA 3S74B 3IBNA 4FVOA 3SBIA 3RYXB 1HVAA 1CVHA 5FNIA 4FIKA 4RIUA 3CYUA 1G4JA 1IF4A 4MDGA 5HPJA 4L5WA 5FNJA 3RZ1B 3Q31A 4RN4A 3FFPX 3M14A 4QK3A 1G4OA 1HECA 3KOKA 2IT4A 5SZ4A 4CQ0A 3DCWA 3V3FA 3MYQA 1OKMA 5CLUA 1G45A 2FNMA 1XQ0A 2EZ7A 4RFDA 3RYJB 4COQA 2NXTA 4E3FA 1CAYA 8CA2A 2ABEA 5FLTA 1DMXA 3OYSA 1LUGA 3KNEA 1G3ZA 4UOVA 1BV3A 4IWZA 4M2WA 2NXRA 1JV0A 5BRUA 5DVXA 1UGBA 1CAOA 3TVOX 4BF1A 1RZDA 1ZFKA 4KNMA 1AVNA 3EFTA 5EH5A 4JSZA 4TWLA 3DA2A 5EKHA 3T5ZA 4KP5A 3D0NA 1ZGFA 1RZEA 4KNJA 3RZ8A 1CVDA 2OSFA 2Q1QA 1TG3A 2GEHA 4ZWZA 2WEGA 1XEGA 2W2JA 4RIVA 3NJ9A 4GL1X 3CAJA 2H15A 5DSKA 3RJ7A 5DSQA 3IBIA 2X7UA 1TEQX 3IEOA 2FMGA 3K2FA 1CVCA 3IGPA 3RYYA 5DRSA 4QSBA 1FSRA 1CCSA 4HEWA 1G52A 5BRVA 1Z97A 4Q6EA 4C3TA 4XIXA 1CAIA 1BNUA 1FR4A 1Z9YA 1ZGEA 4QTLA 5J8ZA 4Q06A 1CNCA 1TB0X 4RUYA 3K7KA 1T9NA 4K1QA 4Q08A 1RZBA 3V5GA 5DSJA 1HEAA 5EH7A 4G0CA 3F4XA
chains in the Genus database with same CATH superfamily
4JSAA 3MHOA 4Q8YA 3S73B 1CIMA 3R16A 5DSLA 3IBLA 1THKA 3M2NA 3DVDA 4E9OX 5JESB 3OY0A 3V2JA 5SZ7A 4HEZA 5SZ6A 4CA2A 1ZNCA 1LG5A 5SZ0A 4E3HA 4N16A 4XIWA 3M3XA 4CNVA 3D92A 1RAZA 3S75B 4G7AA 1G0FA 1HCBA 1BNMA 4M2UA 3F7UA 2QP6A 3D9ZA 1IF7A 5FNGA 3JXFA 3MNIA 2X7SA 3HKTA 3DVCA 1CNIA 3R17B 4ITOA 4YVYA 3BL1A 4Q09A 1V9EA 4K13A 1BNNA 3KOIA 3NI5A 3P3HA 3PO6A 3SAPA 2POWA 1G48A 3V2MA 1DMYA 1BICA 12CAA 2WD2A 4HBAA 4FU5A 4FL7A 3N0NA 4R5BA 2NWYA 4YGJA 5FNMA 1BCDA 5EHVA 5EKJA 5JEPB 1LGDA 2FOSA 3S76A 5JEHB 1BNWA 2CBEA 2ZNCA 4K0ZA 3N3JA 3M1QA 4YYTA 2FOUA 4KUWA 3DC9A 3PYKA 3U47A 3OIMA 4Q7WA 3W6IA 3MNKA 4ZWIA 5E2SA 1I9PA 3JXGA 5FNLA 1CZMA 5G0BA 5BRWA 1FQLA 3T85A 4WUPA 3KWAA 5JEGB 5EHWA 4Q6DA 4MDMA 5CJFA 2EU2A 1J9WA 3DD8A 1CAMA 5EHEA 2NNOA 1YO1A 2WEHA 3RLDA 5FLSA 3SAXA 1CAZA 3LXEA 4ZX1A 3RYZA 4YHAA 3M2ZA 3M1WA 4L5VA 1I8ZA 3T5UA 2NWZA 3HLJA 1XPZA 1G46A 3D8WA 4HU1A 3MHLA 4ITPA 1V9IC 4Q78A 4PYXA 3RG4A 4YGKA 3MZCA 5EKMA 1TBTX 4CNXA 2FMZA 2QO8A 4Z1NA 2Q38A 9CA2A 5JG5B 3RZ5A 2NNVA 3TVNX 4E3GA 3FW3A 1FSNA 4QK1A 3ML2A 4Q9YA 4Q0LA 4ZWYA 4Y0JA 3S78B 3T84A 4Q81A 6CA2A 1ZSBA 1CNGA 1F2WA 1CVEA 2HL4A 1FQNA 3T83A 4DZ9A 4XZ5A 1G6VA 3RGEA 1IF5A 2HOCA 5L6KA 3MDZA 4Q8XA 5E2KA 1OKLA 4ZWXA 1YDDA 1BNVA 4DZ7A 5G0CA 4IDRX 2HKKA 4QJ0A 3TMJA 1CA3A 1TE3X 3S8XA 3RYVB 3GZ0A 4HEYA 3S72B 2CBAA 4Z1JA 1CRAA 5E5RA 5FLQA 5E2MA 3RG3A 3KIGA 4CNWA 1TTMA 3MMFA 4WUQA 5G03A 4JSSA 1KOPA 5DOHA 4KNIA 3RZ7A 4E5QA 3M40A 4JSWA 4CNRA 1CVBA 4Q49A 4MO8A 4LU3A 1IF6A 5A6HA 3P3JA 4QSIA 1H9NA 5BYIA 5FLOA 1ZSCA 3SBHA 3P5LA 5SZ1A 3KLDB 4M2VA 1CNBA 4FPTA 1TH9A 5JQTA 4QJOA 1CVFA 4ETQC 1G54A 3ZNCA 1CALA 1CNKA 4RH2A 1JD0A 2AW1A 2CBDA 1CANA 4YXUA 5AMLA 2AX2A 4FVNA 1CNXA 5E28A 5SZ5A 3M96A 4YXOA 5EOIA 1ZE8A 4N0XB 5FLRA 2EU3A 3DV7A 4FRCA 2VVBX 4KP8A 1EOUA 3HFPA 1RZCA 3DC3A 5FLPA 4HT0A 4ILXA 3V7XA 1I9LA 2GD8A 5EIJA 4BF6A 5CACA 1YDAA 4CACA 1G0EA 4K0TA 1HEDA 5DSOA 3DD0A 4R59A 2CBBA 4E4AA 2FNKA 1HEBA 1I91A 2NWPA 2HFWA 4WL4A 3M5TA 4YXIA 2NNSA 2WEOA 5DOGA 3MHCA 1RJ5A 1YO0A 5JDVB 4YWPA 5EZTX 3MNAA 4HT2A 1HUHA 4QK2A 1UGAA 1Z93A 3KKXA 4KUVA 3FE4A 3RZ0B 1LG6A 1RAYA 3HKNA 5IPZA 4Q7VA 1YO2A 5JGSB 1I90A 5FDIA 4QJWA 1H4NA 2F14A 4MDLA 4ZAOA 3DVBA 1ZH9A 1G53A 1UGDA 3NB5A 1BN4A 4BCWA 1BN1A 4Q7SA 5FDCA 5C8IA 4QIYA 1DCAA 4WW6A 1KWQA 2NWOA 3MNUA 4Q83A 1FSQA 5LMDA 3M1JA 5E5UA 1CRMA 3QYKA 4RUZA 2Q1BA 2FOVA 5FL6A 1G1DA 3B4FA 1I9MA 1AM6A 3M67A 5L3OA 4LP6A 1CNWA 4XE1A 1UGCA 7CA2A 4E3DA 3BL0A 2H4NA 3OKVA 1RJ6A 4R5AA 3CA2A 4Z0QA 1MOOA 3W6HA 3M2XA 4Q90A 2QOAA 3M04A 1KEQA 4YGLA 3L14A 3P55A 3MNJA 2POVA 1IF8A 3B1BA 4MTYA 3P58A 4K0SA 5JQ0A 4Q8ZA 3OYQA 5FL4A 4Z1EA 3OILA 3ZP9A 1I9QA 1TG9A 2HD6A 3U45X 1H9QA 3C7PA 3KONA 1CCTA 3EFIA 3IBUA 3DCSA 5AMDA 1CA2A 4ZX0A 4QJPA 4KAPA 3V3GB 1YDCA 2CBCA 2X7TA 1UGEA 2O4ZA 3VBDA 3MHIA 3ML5A 1I9OA 4YGNA 3DAZA 4HF3A 1JCZA 1XEVA 2ILIA 3M1KA 3DBUA 4RFCA 1CAHA 2WD3A 1CNJA 3V3JA 3BETA 5DSPA 4QEFA 1ZFQA 1BNQA 1CNYA 4WW8A 5E2RA 1OKNA 3UYNA 4Q99A 4PZHA 4X5SA 5E2NA 5EH8A 1UGFA 3M2YA 4JS6A 4E49A 4QY3A 2CABA 2OSMA 2POUA 5A25A 1DCBA 1KOQA 5AMGA 1URTA 3PJJA 3HKQA 1ZSAA 1KWRA 1CNHA 3OIKA 5SZ2A 1HCAA 1IF9A 4PQ7A 3S97A 3MWOA 1RZAA 3N2PA 3KS3A 3P4VA 4PYYA 3U3AX 3UYQA 3M5EA 4LHIA 2FNNA 4QJMA 3M98A 1FR7A 1CAKA 2NNGA 3N4BA 4QIZA 5DSNA 4QSAA 3S71B 5SZ3A 1BZMA 2FW4A 2NN1A 4XFWA 3K34A 1FQRA 5DSMA 1HUGA 5FL5A 4QJXA 4KNNA 1BN3A 3DCCA 4Q87A 4QSJA 4L5UA 1FQMA 4YX4A 5JGTB 4M2RA 1TEUX 2HNCA 2WEJA 1YDBA 3V3IB 3OKUA 1FLJA 1I9NA 1Y7WA 4KUYA 3V3HB 1CCUA 4KV0A 2CA2A 3S9TA 1A42A 2NN7A 5JG3B 2NXSA 3M5SA 1MUAA 1BNTA 2FOQA 1CAJA 1CVAA 3F7BA 3MHMA 5FNHA 5G01A 4Z1KA 5DSIA 1LZVA 3HS4A 3HKUA 3S77B 4MLXA 3P5AA 1CINA 3T82A 3P44A 5DSRA 3IAIA 1OQ5A 4WR7A 3MNHA 2NMXA 5CA2A 4Q07A 4Q7PA 3JXHC 2FOYA 3U7CA 1CILA 5FNKA 4PXXA 2VVAX 4YGFA 5BNLA 4TWMA 1AZMA 3CZVA 3D93A 1UGGA 4MLTA 3F8EA 4RUXA 3S74B 3IBNA 4FVOA 3SBIA 3RYXB 1HVAA 1CVHA 5FNIA 4FIKA 4RIUA 3CYUA 1G4JA 1IF4A 4MDGA 5HPJA 4L5WA 5FNJA 3RZ1B 3Q31A 4RN4A 3FFPX 3M14A 4QK3A 1G4OA 1HECA 3KOKA 2IT4A 5SZ4A 4CQ0A 3DCWA 3V3FA 3MYQA 1OKMA 5CLUA 1G45A 2FNMA 1XQ0A 2EZ7A 4RFDA 3RYJB 4COQA 2NXTA 4E3FA 1CAYA 8CA2A 2ABEA 5FLTA 1DMXA 3OYSA 1LUGA 3KNEA 1G3ZA 4UOVA 1BV3A 4IWZA 4M2WA 2NXRA 1JV0A 5BRUA 5DVXA 1UGBA 1CAOA 3TVOX 4BF1A 1RZDA 1ZFKA 4KNMA 1AVNA 3EFTA 5EH5A 4JSZA 4TWLA 3DA2A 5EKHA 3T5ZA 4KP5A 3D0NA 1ZGFA 1RZEA 4KNJA 3RZ8A 1CVDA 2OSFA 2Q1QA 1TG3A 2GEHA 4ZWZA 2WEGA 1XEGA 2W2JA 4RIVA 3NJ9A 4GL1X 3CAJA 2H15A 5DSKA 3RJ7A 5DSQA 3IBIA 2X7UA 1TEQX 3IEOA 2FMGA 3K2FA 1CVCA 3IGPA 3RYYA 5DRSA 4QSBA 1FSRA 1CCSA 4HEWA 1G52A 5BRVA 1Z97A 4Q6EA 4C3TA 4XIXA 1CAIA 1BNUA 1FR4A 1Z9YA 1ZGEA 4QTLA 5J8ZA 4Q06A 1CNCA 1TB0X 4RUYA 3K7KA 1T9NA 4K1QA 4Q08A 1RZBA 3V5GA 5DSJA 1HEAA 5EH7A 4G0CA 3F4XA
chains in the Genus database with same CATH topology
4JSAA 3MHOA 4Q8YA 3S73B 1CIMA 3R16A 5DSLA 3IBLA 1THKA 3M2NA 3DVDA 4E9OX 5JESB 3OY0A 3V2JA 5SZ7A 4HEZA 5SZ6A 4CA2A 1ZNCA 1LG5A 5SZ0A 4E3HA 4N16A 4XIWA 3M3XA 4CNVA 3D92A 1RAZA 3S75B 4G7AA 1G0FA 1HCBA 1BNMA 4M2UA 3F7UA 2QP6A 3D9ZA 1IF7A 5FNGA 3JXFA 3MNIA 2X7SA 3HKTA 3DVCA 1CNIA 3R17B 4ITOA 4YVYA 3BL1A 4Q09A 1V9EA 4K13A 1BNNA 3KOIA 3NI5A 3P3HA 3PO6A 3SAPA 2POWA 1G48A 3V2MA 1DMYA 1BICA 12CAA 2WD2A 4HBAA 4FU5A 4FL7A 3N0NA 4R5BA 2NWYA 4YGJA 5FNMA 1BCDA 5EHVA 5EKJA 5JEPB 1LGDA 2FOSA 3S76A 5JEHB 1BNWA 2CBEA 2ZNCA 4K0ZA 3N3JA 3M1QA 4YYTA 2FOUA 4KUWA 3DC9A 3PYKA 3U47A 3OIMA 4Q7WA 3W6IA 3MNKA 4ZWIA 5E2SA 1I9PA 3JXGA 5FNLA 1CZMA 5G0BA 5BRWA 1FQLA 3T85A 4WUPA 3KWAA 5JEGB 5EHWA 4Q6DA 4MDMA 5CJFA 2EU2A 1J9WA 3DD8A 1CAMA 5EHEA 2NNOA 1YO1A 2WEHA 3RLDA 5FLSA 3SAXA 1CAZA 3LXEA 4ZX1A 3RYZA 4YHAA 3M2ZA 3M1WA 4L5VA 1I8ZA 3T5UA 2NWZA 3HLJA 1XPZA 1G46A 3D8WA 4HU1A 3MHLA 4ITPA 1V9IC 4Q78A 4PYXA 3RG4A 4YGKA 3MZCA 5EKMA 1TBTX 4CNXA 2FMZA 2QO8A 4Z1NA 2Q38A 9CA2A 5JG5B 3RZ5A 2NNVA 3TVNX 4E3GA 3FW3A 1FSNA 4QK1A 3ML2A 4Q9YA 4Q0LA 4ZWYA 4Y0JA 3S78B 3T84A 4Q81A 6CA2A 1ZSBA 1CNGA 1F2WA 1CVEA 2HL4A 1FQNA 3T83A 4DZ9A 4XZ5A 1G6VA 3RGEA 1IF5A 2HOCA 5L6KA 3MDZA 4Q8XA 5E2KA 1OKLA 4ZWXA 1YDDA 1BNVA 4DZ7A 5G0CA 4IDRX 2HKKA 4QJ0A 3TMJA 1CA3A 1TE3X 3S8XA 3RYVB 3GZ0A 4HEYA 3S72B 2CBAA 4Z1JA 1CRAA 5E5RA 5FLQA 5E2MA 3RG3A 3KIGA 4CNWA 1TTMA 3MMFA 4WUQA 5G03A 4JSSA 1KOPA 5DOHA 4KNIA 3RZ7A 4E5QA 3M40A 4JSWA 4CNRA 1CVBA 4Q49A 4MO8A 4LU3A 1IF6A 5A6HA 3P3JA 4QSIA 1H9NA 5BYIA 5FLOA 1ZSCA 3SBHA 3P5LA 5SZ1A 3KLDB 4M2VA 1CNBA 4FPTA 1TH9A 5JQTA 4QJOA 1CVFA 4ETQC 1G54A 3ZNCA 1CALA 1CNKA 4RH2A 1JD0A 2AW1A 2CBDA 1CANA 4YXUA 5AMLA 2AX2A 4FVNA 1CNXA 5E28A 5SZ5A 3M96A 4YXOA 5EOIA 1ZE8A 4N0XB 5FLRA 2EU3A 3DV7A 4FRCA 2VVBX 4KP8A 1EOUA 3HFPA 1RZCA 3DC3A 5FLPA 4HT0A 4ILXA 3V7XA 1I9LA 2GD8A 5EIJA 4BF6A 5CACA 1YDAA 4CACA 1G0EA 4K0TA 1HEDA 5DSOA 3DD0A 4R59A 2CBBA 4E4AA 2FNKA 1HEBA 1I91A 2NWPA 2HFWA 4WL4A 3M5TA 4YXIA 2NNSA 2WEOA 5DOGA 3MHCA 1RJ5A 1YO0A 5JDVB 4YWPA 5EZTX 3MNAA 4HT2A 1HUHA 4QK2A 1UGAA 1Z93A 3KKXA 4KUVA 3FE4A 3RZ0B 1LG6A 1RAYA 3HKNA 5IPZA 4Q7VA 1YO2A 5JGSB 1I90A 5FDIA 4QJWA 1H4NA 2F14A 4MDLA 4ZAOA 3DVBA 1ZH9A 1G53A 1UGDA 3NB5A 1BN4A 4BCWA 1BN1A 4Q7SA 5FDCA 5C8IA 4QIYA 1DCAA 4WW6A 1KWQA 2NWOA 3MNUA 4Q83A 1FSQA 5LMDA 3M1JA 5E5UA 1CRMA 3QYKA 4RUZA 2Q1BA 2FOVA 5FL6A 1G1DA 3B4FA 1I9MA 1AM6A 3M67A 5L3OA 4LP6A 1CNWA 4XE1A 1UGCA 7CA2A 4E3DA 3BL0A 2H4NA 3OKVA 1RJ6A 4R5AA 3CA2A 4Z0QA 1MOOA 3W6HA 3M2XA 4Q90A 2QOAA 3M04A 1KEQA 4YGLA 3L14A 3P55A 3MNJA 2POVA 1IF8A 3B1BA 4MTYA 3P58A 4K0SA 5JQ0A 4Q8ZA 3OYQA 5FL4A 4Z1EA 3OILA 3ZP9A 1I9QA 1TG9A 2HD6A 3U45X 1H9QA 3C7PA 3KONA 1CCTA 3EFIA 3IBUA 3DCSA 5AMDA 1CA2A 4ZX0A 4QJPA 4KAPA 3V3GB 1YDCA 2CBCA 2X7TA 1UGEA 2O4ZA 3VBDA 3MHIA 3ML5A 1I9OA 4YGNA 3DAZA 4HF3A 1JCZA 1XEVA 2ILIA 3M1KA 3DBUA 4RFCA 1CAHA 2WD3A 1CNJA 3V3JA 3BETA 5DSPA 4QEFA 1ZFQA 1BNQA 1CNYA 4WW8A 5E2RA 1OKNA 3UYNA 4Q99A 4PZHA 4X5SA 5E2NA 5EH8A 1UGFA 3M2YA 4JS6A 4E49A 4QY3A 2CABA 2OSMA 2POUA 5A25A 1DCBA 1KOQA 5AMGA 1URTA 3PJJA 3HKQA 1ZSAA 1KWRA 1CNHA 3OIKA 5SZ2A 1HCAA 1IF9A 4PQ7A 3S97A 3MWOA 1RZAA 3N2PA 3KS3A 3P4VA 4PYYA 3U3AX 3UYQA 3M5EA 4LHIA 2FNNA 4QJMA 3M98A 1FR7A 1CAKA 2NNGA 3N4BA 4QIZA 5DSNA 4QSAA 3S71B 5SZ3A 1BZMA 2FW4A 2NN1A 4XFWA 3K34A 1FQRA 5DSMA 1HUGA 5FL5A 4QJXA 4KNNA 1BN3A 3DCCA 4Q87A 4QSJA 4L5UA 1FQMA 4YX4A 5JGTB 4M2RA 1TEUX 2HNCA 2WEJA 1YDBA 3V3IB 3OKUA 1FLJA 1I9NA 1Y7WA 4KUYA 3V3HB 1CCUA 4KV0A 2CA2A 3S9TA 1A42A 2NN7A 5JG3B 2NXSA 3M5SA 1MUAA 1BNTA 2FOQA 1CAJA 1CVAA 3F7BA 3MHMA 5FNHA 5G01A 4Z1KA 5DSIA 1LZVA 3HS4A 3HKUA 3S77B 4MLXA 3P5AA 1CINA 3T82A 3P44A 5DSRA 3IAIA 1OQ5A 4WR7A 3MNHA 2NMXA 5CA2A 4Q07A 4Q7PA 3JXHC 2FOYA 3U7CA 1CILA 5FNKA 4PXXA 2VVAX 4YGFA 5BNLA 4TWMA 1AZMA 3CZVA 3D93A 1UGGA 4MLTA 3F8EA 4RUXA 3S74B 3IBNA 4FVOA 3SBIA 3RYXB 1HVAA 1CVHA 5FNIA 4FIKA 4RIUA 3CYUA 1G4JA 1IF4A 4MDGA 5HPJA 4L5WA 5FNJA 3RZ1B 3Q31A 4RN4A 3FFPX 3M14A 4QK3A 1G4OA 1HECA 3KOKA 2IT4A 5SZ4A 4CQ0A 3DCWA 3V3FA 3MYQA 1OKMA 5CLUA 1G45A 2FNMA 1XQ0A 2EZ7A 4RFDA 3RYJB 4COQA 2NXTA 4E3FA 1CAYA 8CA2A 2ABEA 5FLTA 1DMXA 3OYSA 1LUGA 3KNEA 1G3ZA 4UOVA 1BV3A 4IWZA 4M2WA 2NXRA 1JV0A 5BRUA 5DVXA 1UGBA 1CAOA 3TVOX 4BF1A 1RZDA 1ZFKA 4KNMA 1AVNA 3EFTA 5EH5A 4JSZA 4TWLA 3DA2A 5EKHA 3T5ZA 4KP5A 3D0NA 1ZGFA 1RZEA 4KNJA 3RZ8A 1CVDA 2OSFA 2Q1QA 1TG3A 2GEHA 4ZWZA 2WEGA 1XEGA 2W2JA 4RIVA 3NJ9A 4GL1X 3CAJA 2H15A 5DSKA 3RJ7A 5DSQA 3IBIA 2X7UA 1TEQX 3IEOA 2FMGA 3K2FA 1CVCA 3IGPA 3RYYA 5DRSA 4QSBA 1FSRA 1CCSA 4HEWA 1G52A 5BRVA 1Z97A 4Q6EA 4C3TA 4XIXA 1CAIA 1BNUA 1FR4A 1Z9YA 1ZGEA 4QTLA 5J8ZA 4Q06A 1CNCA 1TB0X 4RUYA 3K7KA 1T9NA 4K1QA 4Q08A 1RZBA 3V5GA 5DSJA 1HEAA 5EH7A 4G0CA 3F4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JSA A;  3MHO A;  4Q8Y A;  3S73 B;  1CIM A;  3R16 A;  5DSL A;  3IBL A;  1THK A;  3M2N A;  3DVD A;  4E9O X;  5JES B;  3OY0 A;  3V2J A;  5SZ7 A;  4HEZ A;  5SZ6 A;  4CA2 A;  1ZNC A;  1LG5 A;  5SZ0 A;  4E3H A;  4N16 A;  4XIW A;  3M3X A;  4CNV A;  3D92 A;  1RAZ A;  3S75 B;  4G7A A;  1G0F A;  1HCB A;  1BNM A;  4M2U A;  3F7U A;  2QP6 A;  3D9Z A;  1IF7 A;  5FNG A;  3JXF A;  3MNI A;  2X7S A;  3HKT A;  3DVC A;  1CNI A;  3R17 B;  4ITO A;  4YVY A;  3BL1 A;  4Q09 A;  1V9E A;  4K13 A;  1BNN A;  3KOI A;  3NI5 A;  3P3H A;  3PO6 A;  3SAP A;  2POW A;  1G48 A;  3V2M A;  1DMY A;  1BIC A;  12CA A;  2WD2 A;  4HBA A;  4FU5 A;  4FL7 A;  3N0N A;  4R5B A;  2NWY A;  4YGJ A;  5FNM A;  1BCD A;  5EHV A;  5EKJ A;  5JEP B;  1LGD A;  2FOS A;  3S76 A;  5JEH B;  1BNW A;  2CBE A;  2ZNC A;  4K0Z A;  3N3J A;  3M1Q A;  4YYT A;  2FOU A;  4KUW A;  3DC9 A;  3PYK A;  3U47 A;  3OIM A;  4Q7W A;  3W6I A;  3MNK A;  4ZWI A;  5E2S A;  1I9P A;  3JXG A;  5FNL A;  1CZM A;  5G0B A;  5BRW A;  1FQL A;  3T85 A;  4WUP A;  3KWA A;  5JEG B;  5EHW A;  4Q6D A;  4MDM A;  5CJF A;  2EU2 A;  1J9W A;  3DD8 A;  1CAM A;  5EHE A;  2NNO A;  1YO1 A;  2WEH A;  3RLD A;  5FLS A;  3SAX A;  1CAZ A;  3LXE A;  4ZX1 A;  3RYZ A;  4YHA A;  3M2Z A;  3M1W A;  4L5V A;  1I8Z A;  3T5U A;  2NWZ A;  3HLJ A;  1XPZ A;  1G46 A;  3D8W A;  4HU1 A;  3MHL A;  4ITP A;  1V9I C;  4Q78 A;  4PYX A;  3RG4 A;  4YGK A;  3MZC A;  5EKM A;  1TBT X;  4CNX A;  2FMZ A;  2QO8 A;  4Z1N A;  2Q38 A;  9CA2 A;  5JG5 B;  3RZ5 A;  2NNV A;  3TVN X;  4E3G A;  3FW3 A;  1FSN A;  4QK1 A;  3ML2 A;  4Q9Y A;  4Q0L A;  4ZWY A;  4Y0J A;  3S78 B;  3T84 A;  4Q81 A;  6CA2 A;  1ZSB A;  1CNG A;  1F2W A;  1CVE A;  2HL4 A;  1FQN A;  3T83 A;  4DZ9 A;  4XZ5 A;  1G6V A;  3RGE A;  1IF5 A;  2HOC A;  5L6K A;  3MDZ A;  4Q8X A;  5E2K A;  1OKL A;  4ZWX A;  1YDD A;  1BNV A;  4DZ7 A;  5G0C A;  4IDR X;  2HKK A;  4QJ0 A;  3TMJ A;  1CA3 A;  1TE3 X;  3S8X A;  3RYV B;  3GZ0 A;  4HEY A;  3S72 B;  2CBA A;  4Z1J A;  1CRA A;  5E5R A;  5FLQ A;  5E2M A;  3RG3 A;  3KIG A;  4CNW A;  1TTM A;  3MMF A;  4WUQ A;  5G03 A;  4JSS A;  1KOP A;  5DOH A;  4KNI A;  3RZ7 A;  4E5Q A;  3M40 A;  4JSW A;  4CNR A;  1CVB A;  4Q49 A;  4MO8 A;  4LU3 A;  1IF6 A;  5A6H A;  3P3J A;  4QSI A;  1H9N A;  5BYI A;  5FLO A;  1ZSC A;  3SBH A;  3P5L A;  5SZ1 A;  3KLD B;  4M2V A;  1CNB A;  4FPT A;  1TH9 A;  5JQT A;  4QJO A;  1CVF A;  4ETQ C;  1G54 A;  3ZNC A;  1CAL A;  1CNK A;  4RH2 A;  1JD0 A;  2AW1 A;  2CBD A;  1CAN A;  4YXU A;  5AML A;  2AX2 A;  4FVN A;  1CNX A;  5E28 A;  5SZ5 A;  3M96 A;  4YXO A;  5EOI A;  1ZE8 A;  4N0X B;  5FLR A;  2EU3 A;  3DV7 A;  4FRC A;  2VVB X;  4KP8 A;  1EOU A;  3HFP A;  1RZC A;  3DC3 A;  5FLP A;  4HT0 A;  4ILX A;  3V7X A;  1I9L A;  2GD8 A;  5EIJ A;  4BF6 A;  5CAC A;  1YDA A;  4CAC A;  1G0E A;  4K0T A;  1HED A;  5DSO A;  3DD0 A;  4R59 A;  2CBB A;  4E4A A;  2FNK A;  1HEB A;  1I91 A;  2NWP A;  2HFW A;  4WL4 A;  3M5T A;  4YXI A;  2NNS A;  2WEO A;  5DOG A;  3MHC A;  1RJ5 A;  1YO0 A;  5JDV B;  4YWP A;  5EZT X;  3MNA A;  4HT2 A;  1HUH A;  4QK2 A;  1UGA A;  1Z93 A;  3KKX A;  4KUV A;  3FE4 A;  3RZ0 B;  1LG6 A;  1RAY A;  3HKN A;  5IPZ A;  4Q7V A;  1YO2 A;  5JGS B;  1I90 A;  5FDI A;  4QJW A;  1H4N A;  2F14 A;  4MDL A;  4ZAO A;  3DVB A;  1ZH9 A;  1G53 A;  1UGD A;  3NB5 A;  1BN4 A;  4BCW A;  1BN1 A;  4Q7S A;  5FDC A;  5C8I A;  4QIY A;  1DCA A;  4WW6 A;  1KWQ A;  2NWO A;  3MNU A;  4Q83 A;  1FSQ A;  5LMD A;  3M1J A;  5E5U A;  1CRM A;  3QYK A;  4RUZ A;  2Q1B A;  2FOV A;  5FL6 A;  1G1D A;  3B4F A;  1I9M A;  1AM6 A;  3M67 A;  5L3O A;  4LP6 A;  1CNW A;  4XE1 A;  1UGC A;  7CA2 A;  4E3D A;  3BL0 A;  2H4N A;  3OKV A;  1RJ6 A;  4R5A A;  3CA2 A;  4Z0Q A;  1MOO A;  3W6H A;  3M2X A;  4Q90 A;  2QOA A;  3M04 A;  1KEQ A;  4YGL A;  3L14 A;  3P55 A;  3MNJ A;  2POV A;  1IF8 A;  3B1B A;  4MTY A;  3P58 A;  4K0S A;  5JQ0 A;  4Q8Z A;  3OYQ A;  5FL4 A;  4Z1E A;  3OIL A;  3ZP9 A;  1I9Q A;  1TG9 A;  2HD6 A;  3U45 X;  1H9Q A;  3C7P A;  3KON A;  1CCT A;  3EFI A;  3IBU A;  3DCS A;  5AMD A;  1CA2 A;  4ZX0 A;  4QJP A;  4KAP A;  3V3G B;  1YDC A;  2CBC A;  2X7T A;  1UGE A;  2O4Z A;  3VBD A;  3MHI A;  3ML5 A;  1I9O A;  4YGN A;  3DAZ A;  4HF3 A;  1JCZ A;  1XEV A;  2ILI A;  3M1K A;  3DBU A;  4RFC A;  1CAH A;  2WD3 A;  1CNJ A;  3V3J A;  3BET A;  5DSP A;  4QEF A;  1ZFQ A;  1BNQ A;  1CNY A;  4WW8 A;  5E2R A;  1OKN A;  3UYN A;  4Q99 A;  4PZH A;  4X5S A;  5E2N A;  5EH8 A;  1UGF A;  3M2Y A;  4JS6 A;  4E49 A;  4QY3 A;  2CAB A;  2OSM A;  2POU A;  5A25 A;  1DCB A;  1KOQ A;  5AMG A;  1URT A;  3PJJ A;  3HKQ A;  1ZSA A;  1KWR A;  1CNH A;  3OIK A;  5SZ2 A;  1HCA A;  1IF9 A;  4PQ7 A;  3S97 A;  3MWO A;  1RZA A;  3N2P A;  3KS3 A;  3P4V A;  4PYY A;  3U3A X;  3UYQ A;  3M5E A;  4LHI A;  2FNN A;  4QJM A;  3M98 A;  1FR7 A;  1CAK A;  2NNG A;  3N4B A;  4QIZ A;  5DSN A;  4QSA A;  3S71 B;  5SZ3 A;  1BZM A;  2FW4 A;  2NN1 A;  4XFW A;  3K34 A;  1FQR A;  5DSM A;  1HUG A;  5FL5 A;  4QJX A;  4KNN A;  1BN3 A;  3DCC A;  4Q87 A;  4QSJ A;  4L5U A;  1FQM A;  4YX4 A;  5JGT B;  4M2R A;  1TEU X;  2HNC A;  2WEJ A;  1YDB A;  3V3I B;  3OKU A;  1FLJ A;  1I9N A;  1Y7W A;  4KUY A;  3V3H B;  1CCU A;  4KV0 A;  2CA2 A;  3S9T A;  1A42 A;  2NN7 A;  5JG3 B;  2NXS A;  3M5S A;  1MUA A;  1BNT A;  2FOQ A;  1CAJ A;  1CVA A;  3F7B A;  3MHM A;  5FNH A;  5G01 A;  4Z1K A;  5DSI A;  1LZV A;  3HS4 A;  3HKU A;  3S77 B;  4MLX A;  3P5A A;  1CIN A;  3T82 A;  3P44 A;  5DSR A;  3IAI A;  1OQ5 A;  4WR7 A;  3MNH A;  2NMX A;  5CA2 A;  4Q07 A;  4Q7P A;  3JXH C;  2FOY A;  3U7C A;  1CIL A;  5FNK A;  4PXX A;  2VVA X;  4YGF A;  5BNL A;  4TWM A;  1AZM A;  3CZV A;  3D93 A;  1UGG A;  4MLT A;  3F8E A;  4RUX A;  3S74 B;  3IBN A;  4FVO A;  3SBI A;  3RYX B;  1HVA A;  1CVH A;  5FNI A;  4FIK A;  4RIU A;  3CYU A;  1G4J A;  1IF4 A;  4MDG A;  5HPJ A;  4L5W A;  5FNJ A;  3RZ1 B;  3Q31 A;  4RN4 A;  3FFP X;  3M14 A;  4QK3 A;  1G4O A;  1HEC A;  3KOK A;  2IT4 A;  5SZ4 A;  4CQ0 A;  3DCW A;  3V3F A;  3MYQ A;  1OKM A;  5CLU A;  1G45 A;  2FNM A;  1XQ0 A;  2EZ7 A;  4RFD A;  3RYJ B;  4COQ A;  2NXT A;  4E3F A;  1CAY A;  8CA2 A;  2ABE A;  5FLT A;  1DMX A;  3OYS A;  1LUG A;  3KNE A;  1G3Z A;  4UOV A;  1BV3 A;  4IWZ A;  4M2W A;  2NXR A;  1JV0 A;  5BRU A;  5DVX A;  1UGB A;  1CAO A;  3TVO X;  4BF1 A;  1RZD A;  1ZFK A;  4KNM A;  1AVN A;  3EFT A;  5EH5 A;  4JSZ A;  4TWL A;  3DA2 A;  5EKH A;  3T5Z A;  4KP5 A;  3D0N A;  1ZGF A;  1RZE A;  4KNJ A;  3RZ8 A;  1CVD A;  2OSF A;  2Q1Q A;  1TG3 A;  2GEH A;  4ZWZ A;  2WEG A;  1XEG A;  2W2J A;  4RIV A;  3NJ9 A;  4GL1 X;  3CAJ A;  2H15 A;  5DSK A;  3RJ7 A;  5DSQ A;  3IBI A;  2X7U A;  1TEQ X;  3IEO A;  2FMG A;  3K2F A;  1CVC A;  3IGP A;  3RYY A;  5DRS A;  4QSB A;  1FSR A;  1CCS A;  4HEW A;  1G52 A;  5BRV A;  1Z97 A;  4Q6E A;  4C3T A;  4XIX A;  1CAI A;  1BNU A;  1FR4 A;  1Z9Y A;  1ZGE A;  4QTL A;  5J8Z A;  4Q06 A;  1CNC A;  1TB0 X;  4RUY A;  3K7K A;  1T9N A;  4K1Q A;  4Q08 A;  1RZB A;  3V5G A;  5DSJ A;  1HEA A;  5EH7 A;  4G0C A;  3F4X A; 
#chains in the Genus database with same CATH topology
 4JSA A;  3MHO A;  4Q8Y A;  3S73 B;  1CIM A;  3R16 A;  5DSL A;  3IBL A;  1THK A;  3M2N A;  3DVD A;  4E9O X;  5JES B;  3OY0 A;  3V2J A;  5SZ7 A;  4HEZ A;  5SZ6 A;  4CA2 A;  1ZNC A;  1LG5 A;  5SZ0 A;  4E3H A;  4N16 A;  4XIW A;  3M3X A;  4CNV A;  3D92 A;  1RAZ A;  3S75 B;  4G7A A;  1G0F A;  1HCB A;  1BNM A;  4M2U A;  3F7U A;  2QP6 A;  3D9Z A;  1IF7 A;  5FNG A;  3JXF A;  3MNI A;  2X7S A;  3HKT A;  3DVC A;  1CNI A;  3R17 B;  4ITO A;  4YVY A;  3BL1 A;  4Q09 A;  1V9E A;  4K13 A;  1BNN A;  3KOI A;  3NI5 A;  3P3H A;  3PO6 A;  3SAP A;  2POW A;  1G48 A;  3V2M A;  1DMY A;  1BIC A;  12CA A;  2WD2 A;  4HBA A;  4FU5 A;  4FL7 A;  3N0N A;  4R5B A;  2NWY A;  4YGJ A;  5FNM A;  1BCD A;  5EHV A;  5EKJ A;  5JEP B;  1LGD A;  2FOS A;  3S76 A;  5JEH B;  1BNW A;  2CBE A;  2ZNC A;  4K0Z A;  3N3J A;  3M1Q A;  4YYT A;  2FOU A;  4KUW A;  3DC9 A;  3PYK A;  3U47 A;  3OIM A;  4Q7W A;  3W6I A;  3MNK A;  4ZWI A;  5E2S A;  1I9P A;  3JXG A;  5FNL A;  1CZM A;  5G0B A;  5BRW A;  1FQL A;  3T85 A;  4WUP A;  3KWA A;  5JEG B;  5EHW A;  4Q6D A;  4MDM A;  5CJF A;  2EU2 A;  1J9W A;  3DD8 A;  1CAM A;  5EHE A;  2NNO A;  1YO1 A;  2WEH A;  3RLD A;  5FLS A;  3SAX A;  1CAZ A;  3LXE A;  4ZX1 A;  3RYZ A;  4YHA A;  3M2Z A;  3M1W A;  4L5V A;  1I8Z A;  3T5U A;  2NWZ A;  3HLJ A;  1XPZ A;  1G46 A;  3D8W A;  4HU1 A;  3MHL A;  4ITP A;  1V9I C;  4Q78 A;  4PYX A;  3RG4 A;  4YGK A;  3MZC A;  5EKM A;  1TBT X;  4CNX A;  2FMZ A;  2QO8 A;  4Z1N A;  2Q38 A;  9CA2 A;  5JG5 B;  3RZ5 A;  2NNV A;  3TVN X;  4E3G A;  3FW3 A;  1FSN A;  4QK1 A;  3ML2 A;  4Q9Y A;  4Q0L A;  4ZWY A;  4Y0J A;  3S78 B;  3T84 A;  4Q81 A;  6CA2 A;  1ZSB A;  1CNG A;  1F2W A;  1CVE A;  2HL4 A;  1FQN A;  3T83 A;  4DZ9 A;  4XZ5 A;  1G6V A;  3RGE A;  1IF5 A;  2HOC A;  5L6K A;  3MDZ A;  4Q8X A;  5E2K A;  1OKL A;  4ZWX A;  1YDD A;  1BNV A;  4DZ7 A;  5G0C A;  4IDR X;  2HKK A;  4QJ0 A;  3TMJ A;  1CA3 A;  1TE3 X;  3S8X A;  3RYV B;  3GZ0 A;  4HEY A;  3S72 B;  2CBA A;  4Z1J A;  1CRA A;  5E5R A;  5FLQ A;  5E2M A;  3RG3 A;  3KIG A;  4CNW A;  1TTM A;  3MMF A;  4WUQ A;  5G03 A;  4JSS A;  1KOP A;  5DOH A;  4KNI A;  3RZ7 A;  4E5Q A;  3M40 A;  4JSW A;  4CNR A;  1CVB A;  4Q49 A;  4MO8 A;  4LU3 A;  1IF6 A;  5A6H A;  3P3J A;  4QSI A;  1H9N A;  5BYI A;  5FLO A;  1ZSC A;  3SBH A;  3P5L A;  5SZ1 A;  3KLD B;  4M2V A;  1CNB A;  4FPT A;  1TH9 A;  5JQT A;  4QJO A;  1CVF A;  4ETQ C;  1G54 A;  3ZNC A;  1CAL A;  1CNK A;  4RH2 A;  1JD0 A;  2AW1 A;  2CBD A;  1CAN A;  4YXU A;  5AML A;  2AX2 A;  4FVN A;  1CNX A;  5E28 A;  5SZ5 A;  3M96 A;  4YXO A;  5EOI A;  1ZE8 A;  4N0X B;  5FLR A;  2EU3 A;  3DV7 A;  4FRC A;  2VVB X;  4KP8 A;  1EOU A;  3HFP A;  1RZC A;  3DC3 A;  5FLP A;  4HT0 A;  4ILX A;  3V7X A;  1I9L A;  2GD8 A;  5EIJ A;  4BF6 A;  5CAC A;  1YDA A;  4CAC A;  1G0E A;  4K0T A;  1HED A;  5DSO A;  3DD0 A;  4R59 A;  2CBB A;  4E4A A;  2FNK A;  1HEB A;  1I91 A;  2NWP A;  2HFW A;  4WL4 A;  3M5T A;  4YXI A;  2NNS A;  2WEO A;  5DOG A;  3MHC A;  1RJ5 A;  1YO0 A;  5JDV B;  4YWP A;  5EZT X;  3MNA A;  4HT2 A;  1HUH A;  4QK2 A;  1UGA A;  1Z93 A;  3KKX A;  4KUV A;  3FE4 A;  3RZ0 B;  1LG6 A;  1RAY A;  3HKN A;  5IPZ A;  4Q7V A;  1YO2 A;  5JGS B;  1I90 A;  5FDI A;  4QJW A;  1H4N A;  2F14 A;  4MDL A;  4ZAO A;  3DVB A;  1ZH9 A;  1G53 A;  1UGD A;  3NB5 A;  1BN4 A;  4BCW A;  1BN1 A;  4Q7S A;  5FDC A;  5C8I A;  4QIY A;  1DCA A;  4WW6 A;  1KWQ A;  2NWO A;  3MNU A;  4Q83 A;  1FSQ A;  5LMD A;  3M1J A;  5E5U A;  1CRM A;  3QYK A;  4RUZ A;  2Q1B A;  2FOV A;  5FL6 A;  1G1D A;  3B4F A;  1I9M A;  1AM6 A;  3M67 A;  5L3O A;  4LP6 A;  1CNW A;  4XE1 A;  1UGC A;  7CA2 A;  4E3D A;  3BL0 A;  2H4N A;  3OKV A;  1RJ6 A;  4R5A A;  3CA2 A;  4Z0Q A;  1MOO A;  3W6H A;  3M2X A;  4Q90 A;  2QOA A;  3M04 A;  1KEQ A;  4YGL A;  3L14 A;  3P55 A;  3MNJ A;  2POV A;  1IF8 A;  3B1B A;  4MTY A;  3P58 A;  4K0S A;  5JQ0 A;  4Q8Z A;  3OYQ A;  5FL4 A;  4Z1E A;  3OIL A;  3ZP9 A;  1I9Q A;  1TG9 A;  2HD6 A;  3U45 X;  1H9Q A;  3C7P A;  3KON A;  1CCT A;  3EFI A;  3IBU A;  3DCS A;  5AMD A;  1CA2 A;  4ZX0 A;  4QJP A;  4KAP A;  3V3G B;  1YDC A;  2CBC A;  2X7T A;  1UGE A;  2O4Z A;  3VBD A;  3MHI A;  3ML5 A;  1I9O A;  4YGN A;  3DAZ A;  4HF3 A;  1JCZ A;  1XEV A;  2ILI A;  3M1K A;  3DBU A;  4RFC A;  1CAH A;  2WD3 A;  1CNJ A;  3V3J A;  3BET A;  5DSP A;  4QEF A;  1ZFQ A;  1BNQ A;  1CNY A;  4WW8 A;  5E2R A;  1OKN A;  3UYN A;  4Q99 A;  4PZH A;  4X5S A;  5E2N A;  5EH8 A;  1UGF A;  3M2Y A;  4JS6 A;  4E49 A;  4QY3 A;  2CAB A;  2OSM A;  2POU A;  5A25 A;  1DCB A;  1KOQ A;  5AMG A;  1URT A;  3PJJ A;  3HKQ A;  1ZSA A;  1KWR A;  1CNH A;  3OIK A;  5SZ2 A;  1HCA A;  1IF9 A;  4PQ7 A;  3S97 A;  3MWO A;  1RZA A;  3N2P A;  3KS3 A;  3P4V A;  4PYY A;  3U3A X;  3UYQ A;  3M5E A;  4LHI A;  2FNN A;  4QJM A;  3M98 A;  1FR7 A;  1CAK A;  2NNG A;  3N4B A;  4QIZ A;  5DSN A;  4QSA A;  3S71 B;  5SZ3 A;  1BZM A;  2FW4 A;  2NN1 A;  4XFW A;  3K34 A;  1FQR A;  5DSM A;  1HUG A;  5FL5 A;  4QJX A;  4KNN A;  1BN3 A;  3DCC A;  4Q87 A;  4QSJ A;  4L5U A;  1FQM A;  4YX4 A;  5JGT B;  4M2R A;  1TEU X;  2HNC A;  2WEJ A;  1YDB A;  3V3I B;  3OKU A;  1FLJ A;  1I9N A;  1Y7W A;  4KUY A;  3V3H B;  1CCU A;  4KV0 A;  2CA2 A;  3S9T A;  1A42 A;  2NN7 A;  5JG3 B;  2NXS A;  3M5S A;  1MUA A;  1BNT A;  2FOQ A;  1CAJ A;  1CVA A;  3F7B A;  3MHM A;  5FNH A;  5G01 A;  4Z1K A;  5DSI A;  1LZV A;  3HS4 A;  3HKU A;  3S77 B;  4MLX A;  3P5A A;  1CIN A;  3T82 A;  3P44 A;  5DSR A;  3IAI A;  1OQ5 A;  4WR7 A;  3MNH A;  2NMX A;  5CA2 A;  4Q07 A;  4Q7P A;  3JXH C;  2FOY A;  3U7C A;  1CIL A;  5FNK A;  4PXX A;  2VVA X;  4YGF A;  5BNL A;  4TWM A;  1AZM A;  3CZV A;  3D93 A;  1UGG A;  4MLT A;  3F8E A;  4RUX A;  3S74 B;  3IBN A;  4FVO A;  3SBI A;  3RYX B;  1HVA A;  1CVH A;  5FNI A;  4FIK A;  4RIU A;  3CYU A;  1G4J A;  1IF4 A;  4MDG A;  5HPJ A;  4L5W A;  5FNJ A;  3RZ1 B;  3Q31 A;  4RN4 A;  3FFP X;  3M14 A;  4QK3 A;  1G4O A;  1HEC A;  3KOK A;  2IT4 A;  5SZ4 A;  4CQ0 A;  3DCW A;  3V3F A;  3MYQ A;  1OKM A;  5CLU A;  1G45 A;  2FNM A;  1XQ0 A;  2EZ7 A;  4RFD A;  3RYJ B;  4COQ A;  2NXT A;  4E3F A;  1CAY A;  8CA2 A;  2ABE A;  5FLT A;  1DMX A;  3OYS A;  1LUG A;  3KNE A;  1G3Z A;  4UOV A;  1BV3 A;  4IWZ A;  4M2W A;  2NXR A;  1JV0 A;  5BRU A;  5DVX A;  1UGB A;  1CAO A;  3TVO X;  4BF1 A;  1RZD A;  1ZFK A;  4KNM A;  1AVN A;  3EFT A;  5EH5 A;  4JSZ A;  4TWL A;  3DA2 A;  5EKH A;  3T5Z A;  4KP5 A;  3D0N A;  1ZGF A;  1RZE A;  4KNJ A;  3RZ8 A;  1CVD A;  2OSF A;  2Q1Q A;  1TG3 A;  2GEH A;  4ZWZ A;  2WEG A;  1XEG A;  2W2J A;  4RIV A;  3NJ9 A;  4GL1 X;  3CAJ A;  2H15 A;  5DSK A;  3RJ7 A;  5DSQ A;  3IBI A;  2X7U A;  1TEQ X;  3IEO A;  2FMG A;  3K2F A;  1CVC A;  3IGP A;  3RYY A;  5DRS A;  4QSB A;  1FSR A;  1CCS A;  4HEW A;  1G52 A;  5BRV A;  1Z97 A;  4Q6E A;  4C3T A;  4XIX A;  1CAI A;  1BNU A;  1FR4 A;  1Z9Y A;  1ZGE A;  4QTL A;  5J8Z A;  4Q06 A;  1CNC A;  1TB0 X;  4RUY A;  3K7K A;  1T9N A;  4K1Q A;  4Q08 A;  1RZB A;  3V5G A;  5DSJ A;  1HEA A;  5EH7 A;  4G0C A;  3F4X A; 
#chains in the Genus database with same CATH homology
 4JSA A;  3MHO A;  4Q8Y A;  3S73 B;  1CIM A;  3R16 A;  5DSL A;  3IBL A;  1THK A;  3M2N A;  3DVD A;  4E9O X;  5JES B;  3OY0 A;  3V2J A;  5SZ7 A;  4HEZ A;  5SZ6 A;  4CA2 A;  1ZNC A;  1LG5 A;  5SZ0 A;  4E3H A;  4N16 A;  4XIW A;  3M3X A;  4CNV A;  3D92 A;  1RAZ A;  3S75 B;  4G7A A;  1G0F A;  1HCB A;  1BNM A;  4M2U A;  3F7U A;  2QP6 A;  3D9Z A;  1IF7 A;  5FNG A;  3JXF A;  3MNI A;  2X7S A;  3HKT A;  3DVC A;  1CNI A;  3R17 B;  4ITO A;  4YVY A;  3BL1 A;  4Q09 A;  1V9E A;  4K13 A;  1BNN A;  3KOI A;  3NI5 A;  3P3H A;  3PO6 A;  3SAP A;  2POW A;  1G48 A;  3V2M A;  1DMY A;  1BIC A;  12CA A;  2WD2 A;  4HBA A;  4FU5 A;  4FL7 A;  3N0N A;  4R5B A;  2NWY A;  4YGJ A;  5FNM A;  1BCD A;  5EHV A;  5EKJ A;  5JEP B;  1LGD A;  2FOS A;  3S76 A;  5JEH B;  1BNW A;  2CBE A;  2ZNC A;  4K0Z A;  3N3J A;  3M1Q A;  4YYT A;  2FOU A;  4KUW A;  3DC9 A;  3PYK A;  3U47 A;  3OIM A;  4Q7W A;  3W6I A;  3MNK A;  4ZWI A;  5E2S A;  1I9P A;  3JXG A;  5FNL A;  1CZM A;  5G0B A;  5BRW A;  1FQL A;  3T85 A;  4WUP A;  3KWA A;  5JEG B;  5EHW A;  4Q6D A;  4MDM A;  5CJF A;  2EU2 A;  1J9W A;  3DD8 A;  1CAM A;  5EHE A;  2NNO A;  1YO1 A;  2WEH A;  3RLD A;  5FLS A;  3SAX A;  1CAZ A;  3LXE A;  4ZX1 A;  3RYZ A;  4YHA A;  3M2Z A;  3M1W A;  4L5V A;  1I8Z A;  3T5U A;  2NWZ A;  3HLJ A;  1XPZ A;  1G46 A;  3D8W A;  4HU1 A;  3MHL A;  4ITP A;  1V9I C;  4Q78 A;  4PYX A;  3RG4 A;  4YGK A;  3MZC A;  5EKM A;  1TBT X;  4CNX A;  2FMZ A;  2QO8 A;  4Z1N A;  2Q38 A;  9CA2 A;  5JG5 B;  3RZ5 A;  2NNV A;  3TVN X;  4E3G A;  3FW3 A;  1FSN A;  4QK1 A;  3ML2 A;  4Q9Y A;  4Q0L A;  4ZWY A;  4Y0J A;  3S78 B;  3T84 A;  4Q81 A;  6CA2 A;  1ZSB A;  1CNG A;  1F2W A;  1CVE A;  2HL4 A;  1FQN A;  3T83 A;  4DZ9 A;  4XZ5 A;  1G6V A;  3RGE A;  1IF5 A;  2HOC A;  5L6K A;  3MDZ A;  4Q8X A;  5E2K A;  1OKL A;  4ZWX A;  1YDD A;  1BNV A;  4DZ7 A;  5G0C A;  4IDR X;  2HKK A;  4QJ0 A;  3TMJ A;  1CA3 A;  1TE3 X;  3S8X A;  3RYV B;  3GZ0 A;  4HEY A;  3S72 B;  2CBA A;  4Z1J A;  1CRA A;  5E5R A;  5FLQ A;  5E2M A;  3RG3 A;  3KIG A;  4CNW A;  1TTM A;  3MMF A;  4WUQ A;  5G03 A;  4JSS A;  1KOP A;  5DOH A;  4KNI A;  3RZ7 A;  4E5Q A;  3M40 A;  4JSW A;  4CNR A;  1CVB A;  4Q49 A;  4MO8 A;  4LU3 A;  1IF6 A;  5A6H A;  3P3J A;  4QSI A;  1H9N A;  5BYI A;  5FLO A;  1ZSC A;  3SBH A;  3P5L A;  5SZ1 A;  3KLD B;  4M2V A;  1CNB A;  4FPT A;  1TH9 A;  5JQT A;  4QJO A;  1CVF A;  4ETQ C;  1G54 A;  3ZNC A;  1CAL A;  1CNK A;  4RH2 A;  1JD0 A;  2AW1 A;  2CBD A;  1CAN A;  4YXU A;  5AML A;  2AX2 A;  4FVN A;  1CNX A;  5E28 A;  5SZ5 A;  3M96 A;  4YXO A;  5EOI A;  1ZE8 A;  4N0X B;  5FLR A;  2EU3 A;  3DV7 A;  4FRC A;  2VVB X;  4KP8 A;  1EOU A;  3HFP A;  1RZC A;  3DC3 A;  5FLP A;  4HT0 A;  4ILX A;  3V7X A;  1I9L A;  2GD8 A;  5EIJ A;  4BF6 A;  5CAC A;  1YDA A;  4CAC A;  1G0E A;  4K0T A;  1HED A;  5DSO A;  3DD0 A;  4R59 A;  2CBB A;  4E4A A;  2FNK A;  1HEB A;  1I91 A;  2NWP A;  2HFW A;  4WL4 A;  3M5T A;  4YXI A;  2NNS A;  2WEO A;  5DOG A;  3MHC A;  1RJ5 A;  1YO0 A;  5JDV B;  4YWP A;  5EZT X;  3MNA A;  4HT2 A;  1HUH A;  4QK2 A;  1UGA A;  1Z93 A;  3KKX A;  4KUV A;  3FE4 A;  3RZ0 B;  1LG6 A;  1RAY A;  3HKN A;  5IPZ A;  4Q7V A;  1YO2 A;  5JGS B;  1I90 A;  5FDI A;  4QJW A;  1H4N A;  2F14 A;  4MDL A;  4ZAO A;  3DVB A;  1ZH9 A;  1G53 A;  1UGD A;  3NB5 A;  1BN4 A;  4BCW A;  1BN1 A;  4Q7S A;  5FDC A;  5C8I A;  4QIY A;  1DCA A;  4WW6 A;  1KWQ A;  2NWO A;  3MNU A;  4Q83 A;  1FSQ A;  5LMD A;  3M1J A;  5E5U A;  1CRM A;  3QYK A;  4RUZ A;  2Q1B A;  2FOV A;  5FL6 A;  1G1D A;  3B4F A;  1I9M A;  1AM6 A;  3M67 A;  5L3O A;  4LP6 A;  1CNW A;  4XE1 A;  1UGC A;  7CA2 A;  4E3D A;  3BL0 A;  2H4N A;  3OKV A;  1RJ6 A;  4R5A A;  3CA2 A;  4Z0Q A;  1MOO A;  3W6H A;  3M2X A;  4Q90 A;  2QOA A;  3M04 A;  1KEQ A;  4YGL A;  3L14 A;  3P55 A;  3MNJ A;  2POV A;  1IF8 A;  3B1B A;  4MTY A;  3P58 A;  4K0S A;  5JQ0 A;  4Q8Z A;  3OYQ A;  5FL4 A;  4Z1E A;  3OIL A;  3ZP9 A;  1I9Q A;  1TG9 A;  2HD6 A;  3U45 X;  1H9Q A;  3C7P A;  3KON A;  1CCT A;  3EFI A;  3IBU A;  3DCS A;  5AMD A;  1CA2 A;  4ZX0 A;  4QJP A;  4KAP A;  3V3G B;  1YDC A;  2CBC A;  2X7T A;  1UGE A;  2O4Z A;  3VBD A;  3MHI A;  3ML5 A;  1I9O A;  4YGN A;  3DAZ A;  4HF3 A;  1JCZ A;  1XEV A;  2ILI A;  3M1K A;  3DBU A;  4RFC A;  1CAH A;  2WD3 A;  1CNJ A;  3V3J A;  3BET A;  5DSP A;  4QEF A;  1ZFQ A;  1BNQ A;  1CNY A;  4WW8 A;  5E2R A;  1OKN A;  3UYN A;  4Q99 A;  4PZH A;  4X5S A;  5E2N A;  5EH8 A;  1UGF A;  3M2Y A;  4JS6 A;  4E49 A;  4QY3 A;  2CAB A;  2OSM A;  2POU A;  5A25 A;  1DCB A;  1KOQ A;  5AMG A;  1URT A;  3PJJ A;  3HKQ A;  1ZSA A;  1KWR A;  1CNH A;  3OIK A;  5SZ2 A;  1HCA A;  1IF9 A;  4PQ7 A;  3S97 A;  3MWO A;  1RZA A;  3N2P A;  3KS3 A;  3P4V A;  4PYY A;  3U3A X;  3UYQ A;  3M5E A;  4LHI A;  2FNN A;  4QJM A;  3M98 A;  1FR7 A;  1CAK A;  2NNG A;  3N4B A;  4QIZ A;  5DSN A;  4QSA A;  3S71 B;  5SZ3 A;  1BZM A;  2FW4 A;  2NN1 A;  4XFW A;  3K34 A;  1FQR A;  5DSM A;  1HUG A;  5FL5 A;  4QJX A;  4KNN A;  1BN3 A;  3DCC A;  4Q87 A;  4QSJ A;  4L5U A;  1FQM A;  4YX4 A;  5JGT B;  4M2R A;  1TEU X;  2HNC A;  2WEJ A;  1YDB A;  3V3I B;  3OKU A;  1FLJ A;  1I9N A;  1Y7W A;  4KUY A;  3V3H B;  1CCU A;  4KV0 A;  2CA2 A;  3S9T A;  1A42 A;  2NN7 A;  5JG3 B;  2NXS A;  3M5S A;  1MUA A;  1BNT A;  2FOQ A;  1CAJ A;  1CVA A;  3F7B A;  3MHM A;  5FNH A;  5G01 A;  4Z1K A;  5DSI A;  1LZV A;  3HS4 A;  3HKU A;  3S77 B;  4MLX A;  3P5A A;  1CIN A;  3T82 A;  3P44 A;  5DSR A;  3IAI A;  1OQ5 A;  4WR7 A;  3MNH A;  2NMX A;  5CA2 A;  4Q07 A;  4Q7P A;  3JXH C;  2FOY A;  3U7C A;  1CIL A;  5FNK A;  4PXX A;  2VVA X;  4YGF A;  5BNL A;  4TWM A;  1AZM A;  3CZV A;  3D93 A;  1UGG A;  4MLT A;  3F8E A;  4RUX A;  3S74 B;  3IBN A;  4FVO A;  3SBI A;  3RYX B;  1HVA A;  1CVH A;  5FNI A;  4FIK A;  4RIU A;  3CYU A;  1G4J A;  1IF4 A;  4MDG A;  5HPJ A;  4L5W A;  5FNJ A;  3RZ1 B;  3Q31 A;  4RN4 A;  3FFP X;  3M14 A;  4QK3 A;  1G4O A;  1HEC A;  3KOK A;  2IT4 A;  5SZ4 A;  4CQ0 A;  3DCW A;  3V3F A;  3MYQ A;  1OKM A;  5CLU A;  1G45 A;  2FNM A;  1XQ0 A;  2EZ7 A;  4RFD A;  3RYJ B;  4COQ A;  2NXT A;  4E3F A;  1CAY A;  8CA2 A;  2ABE A;  5FLT A;  1DMX A;  3OYS A;  1LUG A;  3KNE A;  1G3Z A;  4UOV A;  1BV3 A;  4IWZ A;  4M2W A;  2NXR A;  1JV0 A;  5BRU A;  5DVX A;  1UGB A;  1CAO A;  3TVO X;  4BF1 A;  1RZD A;  1ZFK A;  4KNM A;  1AVN A;  3EFT A;  5EH5 A;  4JSZ A;  4TWL A;  3DA2 A;  5EKH A;  3T5Z A;  4KP5 A;  3D0N A;  1ZGF A;  1RZE A;  4KNJ A;  3RZ8 A;  1CVD A;  2OSF A;  2Q1Q A;  1TG3 A;  2GEH A;  4ZWZ A;  2WEG A;  1XEG A;  2W2J A;  4RIV A;  3NJ9 A;  4GL1 X;  3CAJ A;  2H15 A;  5DSK A;  3RJ7 A;  5DSQ A;  3IBI A;  2X7U A;  1TEQ X;  3IEO A;  2FMG A;  3K2F A;  1CVC A;  3IGP A;  3RYY A;  5DRS A;  4QSB A;  1FSR A;  1CCS A;  4HEW A;  1G52 A;  5BRV A;  1Z97 A;  4Q6E A;  4C3T A;  4XIX A;  1CAI A;  1BNU A;  1FR4 A;  1Z9Y A;  1ZGE A;  4QTL A;  5J8Z A;  4Q06 A;  1CNC A;  1TB0 X;  4RUY A;  3K7K A;  1T9N A;  4K1Q A;  4Q08 A;  1RZB A;  3V5G A;  5DSJ A;  1HEA A;  5EH7 A;  4G0C A;  3F4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...