1WOIA

Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
Knots found
sequence length
303
structure length
303
Chain Sequence
GPAHLPYGGIPTFARAPLVQPDGDWQADVAALGVPFDIALGFRPGARFAPRALREASLRSVPPFTGLDGKTRLQGVTFADAGDVILPSLEPQLAHDRITEAARQVRGRCRVPVFLGGDHSVSYPLLRAFADVPDLHVVQLDAHLDFTDTRNDTKWSNSSPFRRACEALPNLVHITTVGLRGLRFDPEAVAAARARGHTIIPMDDVTADLAGVLAQLPRGQNVYFSVDVDGFDPAVIPGTSSPEPDGLTYAQGMKILAAAAANNTVVGLDLVELAPNLDPTGRSELLMARLVMETLCEVFDHVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords agmatinase
publication title Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 114
structure length 303
sequence length 303
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31 +31 +31
ec nomenclature ec 3.5.3.11: Agmatinase.
pdb deposition date 2004-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1woiA00
4Q3PA 4HZEA 3THHA 3TH7A 1P8QA 3E8ZA 1HQGA 1T4RA 3NIOA 1T4PA 1P8PA 3THJA 1RLAA 3MFWA 1P8NA 1P8OA 1WVAA 3E6VA 4RHQA 4RHKA 3MFVA 3LHLA 1WOGA 4IU0A 4Q3SA 4RHJA 2EIVA 4HXQA 2EF4A 3GMZA 5HJAA 1TA1A 2A0MA 4IU1A 2RLAA 2ZAVA 3DJ8A 4HWWA 4IXUA 5RLAA 1HQ5A 1P8MA 3PZLA 1D3VA 3NIPA 1GQ7A 5CEVA 4RHMA 1T4SA 4RHIA 4IXVA 1ZPGA 1HQFA 1T5GA 4I06A 2PHAA 1ZPEA 2EF5A 4Q3VA 3RLAA 4IE1A 4IU5A 4GSMA 4ITYA 1R1OA 4IU4A 3LP7A 4G3HA 1PQ3A 4MXRA 1TBJA 1TBLA 4Q3UA 4RHLA 4MYLA 2CEVA 4GWDA 4Q3RA 1GQ6A 1HQHA 4Q3TA 3LP4A 4MYFA 4IE2A 4CEVA 4GSVA 5HJ9A 3E6KA 4Q41A 1WOIA 3GN0A 3MJLA 4FCIA 3F80A 4Q3QA 1P8RA 3E9BA 4GSZA 2PLLA 1WOHA 3SL1A 1T4TA 3KV2A 4RLAA 3SKKA 1T5FA 1XFKA 4MYNA 4Q3RC 4DZ4A 3E8QA 4IE3A 1WVBA 2AEBA 3THEA 4MYKA 1CEVA 3SJTA 2PHOA 1P8SA 1TBHA 4FCKA 1HQXA 4Q40A 3M1RA 3TF3A 4Q42A 3CEVA 4GWCA 3SL0A 3NIQA 3MMRA
chains in the Genus database with same CATH superfamily
2VQJA 4Q3PA 5FCWA 5EFKB 5G0GA 4HZEA 5EFGA 3TH7A 2VQWG 1P8QA 3THHA 4BZ8A 3E8ZA 2VQMA 4LXZA 1HQGA 5EEFA 1T4RA 3NIOA 1T4PA 5D1DA 1P8PA 4QA0A 3THJA 3F07A 1T67A 1RLAA 3MFWA 5A2SA 5LI3A 1P8NA 1P8OA 1WVAA 3E6VA 4RHQA 4RHKA 5DC6A 5THUA 4BKXB 4QA7A 4ZUOA 3MFVA 4ZUMA 5EF8A 3LHLA 5THSA 1WOGA 4IU0A 4Q3SA 1ZZ3A 2VQVA 4RHJA 5G0HA 2EIVA 5THTA 4HXQA 3Q9FA 2EF4A 3GMZA 3C0YA 3F0RA 5FUEA 1TA1A 3F06A 4BZ9A 5HJAA 2A0MA 3MZ7A 2RLAA 2ZAVA 4IU1A 3DJ8A 4HWWA 4QA5A 4BZ7A 4IXUA 5RLAA 1HQ5A 5DC7A 1P8MA 3PZLA 1D3VA 5G10A 3NIPA 5THVA 1GQ7A 5CEVA 4RHMA 5EFBD 1T4SA 3RQDA 5EEIA 3Q9CA 2VQOA 4RHIA 4A69A 3MZ3A 4IXVA 5IWGA 5IX0A 5G0JA 2VQQA 5DC5A 1ZPGA 1HQFA 1T5GA 4I06A 2PHAA 3MZ4A 1ZPEA 5D1CA 2EF5A 4QA4A 4Q3VA 5EFJD 3ZNRA 5G11A 4ZUNA 3RLAA 4IE1A 4QA3A 4QA2A 4IU5A 4GSMA 4RN2A 3Q9EA 4ITYA 1R1OA 4IU4A 4ZUQA 5JI5A 4BZ6A 1ZZ1A 3LP7A 1PQ3A 4G3HA 4MXRA 1TBJA 1TBLA 4Q3UA 4RHLA 4MYLA 2CEVA 3Q9BA 4GWDA 5D1BA 1ZZ0A 4Q3RA 5EEKA 4RN0A 1GQ6A 1HQHA 5DC8A 4BZ5A 4Q3TA 3SFFA 2VCGA 4ZURA 3LP4A 4MYFA 5G3WA 3MAXA 4IE2A 3SFHA 4GSVA 4CBTA 4CEVA 5HJ9A 3E6KA 5EENA 3EW8A 4Q41A 1WOIA 5G0IA 5G1AA 3GN0A 3MJLA 5G1CA 1T69A 4FCIA 3F80A 4Q3QA 5G0YA 1P8RA 1VKGA 2V5WA 3E9BA 4QA6A 1C3SA 4GSZA 3MZ6A 2PLLA 4QA1A 5G1BA 3MENA 4ZUPA 1WOHA 3SL1A 1T4TA 5G12A 3KV2A 4RLAA 3SKKA 1T5FA 5BWZA 4LY1A 4CBYA 1XFKA 1C3RA 4MYNA 4Q3RC 4DZ4A 2GH6A 5G17A 3E8QA 4IE3A 1WVBA 5ICNB 2AEBA 5EFNA 4RN1A 3EWFA 3THEA 4MYKA 5EF7A 1CEVA 3SJTA 2PHOA 1P8SA 1W22A 5G0XA 1TBHA 4FCKA 1HQXA 4Q40A 5G13A 4CQFA 3M1RA 3TF3A 1T64A 4Q42A 3CEVA 3C10A 3C0ZA 1C3PA 2V5XA 5EFHA 4GWCA 3EZTA 3ZNSA 5EEMA 3SL0A 3NIQA 3MMRA 3EZPA
chains in the Genus database with same CATH topology
4Q3PA 4HZEA 3THHA 3TH7A 1P8QA 3E8ZA 1HQGA 1T4RA 3NIOA 1T4PA 1P8PA 3THJA 1RLAA 3MFWA 1P8NA 1P8OA 1WVAA 3E6VA 4RHQA 4RHKA 3MFVA 3LHLA 1WOGA 4IU0A 4Q3SA 4RHJA 2EIVA 4HXQA 2EF4A 3GMZA 5HJAA 1TA1A 2A0MA 4IU1A 2RLAA 2ZAVA 3DJ8A 4HWWA 4IXUA 5RLAA 1HQ5A 1P8MA 3PZLA 1D3VA 3NIPA 1GQ7A 5CEVA 4RHMA 1T4SA 4RHIA 4IXVA 1ZPGA 1HQFA 1T5GA 4I06A 2PHAA 1ZPEA 2EF5A 4Q3VA 3RLAA 4IE1A 4IU5A 4GSMA 4ITYA 1R1OA 4IU4A 3LP7A 4G3HA 1PQ3A 4MXRA 1TBJA 1TBLA 4Q3UA 4RHLA 4MYLA 2CEVA 4GWDA 4Q3RA 1GQ6A 1HQHA 4Q3TA 3LP4A 4MYFA 4IE2A 4CEVA 4GSVA 5HJ9A 3E6KA 4Q41A 1WOIA 3GN0A 3MJLA 4FCIA 3F80A 4Q3QA 1P8RA 3E9BA 4GSZA 2PLLA 1WOHA 3SL1A 1T4TA 3KV2A 4RLAA 3SKKA 1T5FA 1XFKA 4MYNA 4Q3RC 4DZ4A 3E8QA 4IE3A 1WVBA 2AEBA 3THEA 4MYKA 1CEVA 3SJTA 2PHOA 1P8SA 1TBHA 4FCKA 1HQXA 4Q40A 3M1RA 3TF3A 4Q42A 3CEVA 4GWCA 3SL0A 3NIQA 3MMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q3P A;  4HZE A;  3THH A;  3TH7 A;  1P8Q A;  3E8Z A;  1HQG A;  1T4R A;  3NIO A;  1T4P A;  1P8P A;  3THJ A;  1RLA A;  3MFW A;  1P8N A;  1P8O A;  1WVA A;  3E6V A;  4RHQ A;  4RHK A;  3MFV A;  3LHL A;  1WOG A;  4IU0 A;  4Q3S A;  4RHJ A;  2EIV A;  4HXQ A;  2EF4 A;  3GMZ A;  5HJA A;  1TA1 A;  2A0M A;  4IU1 A;  2RLA A;  2ZAV A;  3DJ8 A;  4HWW A;  4IXU A;  5RLA A;  1HQ5 A;  1P8M A;  3PZL A;  1D3V A;  3NIP A;  1GQ7 A;  5CEV A;  4RHM A;  1T4S A;  4RHI A;  4IXV A;  1ZPG A;  1HQF A;  1T5G A;  4I06 A;  2PHA A;  1ZPE A;  2EF5 A;  4Q3V A;  3RLA A;  4IE1 A;  4IU5 A;  4GSM A;  4ITY A;  1R1O A;  4IU4 A;  3LP7 A;  4G3H A;  1PQ3 A;  4MXR A;  1TBJ A;  1TBL A;  4Q3U A;  4RHL A;  4MYL A;  2CEV A;  4GWD A;  4Q3R A;  1GQ6 A;  1HQH A;  4Q3T A;  3LP4 A;  4MYF A;  4IE2 A;  4CEV A;  4GSV A;  5HJ9 A;  3E6K A;  4Q41 A;  1WOI A;  3GN0 A;  3MJL A;  4FCI A;  3F80 A;  4Q3Q A;  1P8R A;  3E9B A;  4GSZ A;  2PLL A;  1WOH A;  3SL1 A;  1T4T A;  3KV2 A;  4RLA A;  3SKK A;  1T5F A;  1XFK A;  4MYN A;  4Q3R C;  4DZ4 A;  3E8Q A;  4IE3 A;  1WVB A;  2AEB A;  3THE A;  4MYK A;  1CEV A;  3SJT A;  2PHO A;  1P8S A;  1TBH A;  4FCK A;  1HQX A;  4Q40 A;  3M1R A;  3TF3 A;  4Q42 A;  3CEV A;  4GWC A;  3SL0 A;  3NIQ A;  3MMR A; 
#chains in the Genus database with same CATH topology
 2VQJ A;  4Q3P A;  5FCW A;  5EFK B;  5G0G A;  4HZE A;  5EFG A;  3TH7 A;  2VQW G;  1P8Q A;  3THH A;  4BZ8 A;  3E8Z A;  2VQM A;  4LXZ A;  1HQG A;  5EEF A;  1T4R A;  3NIO A;  1T4P A;  5D1D A;  1P8P A;  4QA0 A;  3THJ A;  3F07 A;  1T67 A;  1RLA A;  3MFW A;  5A2S A;  5LI3 A;  1P8N A;  1P8O A;  1WVA A;  3E6V A;  4RHQ A;  4RHK A;  5DC6 A;  5THU A;  4BKX B;  4QA7 A;  4ZUO A;  3MFV A;  4ZUM A;  5EF8 A;  3LHL A;  5THS A;  1WOG A;  4IU0 A;  4Q3S A;  1ZZ3 A;  2VQV A;  4RHJ A;  5G0H A;  2EIV A;  5THT A;  4HXQ A;  3Q9F A;  2EF4 A;  3GMZ A;  3C0Y A;  3F0R A;  5FUE A;  1TA1 A;  3F06 A;  4BZ9 A;  5HJA A;  2A0M A;  3MZ7 A;  2RLA A;  2ZAV A;  4IU1 A;  3DJ8 A;  4HWW A;  4QA5 A;  4BZ7 A;  4IXU A;  5RLA A;  1HQ5 A;  5DC7 A;  1P8M A;  3PZL A;  1D3V A;  5G10 A;  3NIP A;  5THV A;  1GQ7 A;  5CEV A;  4RHM A;  5EFB D;  1T4S A;  3RQD A;  5EEI A;  3Q9C A;  2VQO A;  4RHI A;  4A69 A;  3MZ3 A;  4IXV A;  5IWG A;  5IX0 A;  5G0J A;  2VQQ A;  5DC5 A;  1ZPG A;  1HQF A;  1T5G A;  4I06 A;  2PHA A;  3MZ4 A;  1ZPE A;  5D1C A;  2EF5 A;  4QA4 A;  4Q3V A;  5EFJ D;  3ZNR A;  5G11 A;  4ZUN A;  3RLA A;  4IE1 A;  4QA3 A;  4QA2 A;  4IU5 A;  4GSM A;  4RN2 A;  3Q9E A;  4ITY A;  1R1O A;  4IU4 A;  4ZUQ A;  5JI5 A;  4BZ6 A;  1ZZ1 A;  3LP7 A;  1PQ3 A;  4G3H A;  4MXR A;  1TBJ A;  1TBL A;  4Q3U A;  4RHL A;  4MYL A;  2CEV A;  3Q9B A;  4GWD A;  5D1B A;  1ZZ0 A;  4Q3R A;  5EEK A;  4RN0 A;  1GQ6 A;  1HQH A;  5DC8 A;  4BZ5 A;  4Q3T A;  3SFF A;  2VCG A;  4ZUR A;  3LP4 A;  4MYF A;  5G3W A;  3MAX A;  4IE2 A;  3SFH A;  4GSV A;  4CBT A;  4CEV A;  5HJ9 A;  3E6K A;  5EEN A;  3EW8 A;  4Q41 A;  1WOI A;  5G0I A;  5G1A A;  3GN0 A;  3MJL A;  5G1C A;  1T69 A;  4FCI A;  3F80 A;  4Q3Q A;  5G0Y A;  1P8R A;  1VKG A;  2V5W A;  3E9B A;  4QA6 A;  1C3S A;  4GSZ A;  3MZ6 A;  2PLL A;  4QA1 A;  5G1B A;  3MEN A;  4ZUP A;  1WOH A;  3SL1 A;  1T4T A;  5G12 A;  3KV2 A;  4RLA A;  3SKK A;  1T5F A;  5BWZ A;  4LY1 A;  4CBY A;  1XFK A;  1C3R A;  4MYN A;  4Q3R C;  4DZ4 A;  2GH6 A;  5G17 A;  3E8Q A;  4IE3 A;  1WVB A;  5ICN B;  2AEB A;  5EFN A;  4RN1 A;  3EWF A;  3THE A;  4MYK A;  5EF7 A;  1CEV A;  3SJT A;  2PHO A;  1P8S A;  1W22 A;  5G0X A;  1TBH A;  4FCK A;  1HQX A;  4Q40 A;  5G13 A;  4CQF A;  3M1R A;  3TF3 A;  1T64 A;  4Q42 A;  3CEV A;  3C10 A;  3C0Z A;  1C3P A;  2V5X A;  5EFH A;  4GWC A;  3EZT A;  3ZNS A;  5EEM A;  3SL0 A;  3NIQ A;  3MMR A;  3EZP A; 
#chains in the Genus database with same CATH homology
 4Q3P A;  4HZE A;  3THH A;  3TH7 A;  1P8Q A;  3E8Z A;  1HQG A;  1T4R A;  3NIO A;  1T4P A;  1P8P A;  3THJ A;  1RLA A;  3MFW A;  1P8N A;  1P8O A;  1WVA A;  3E6V A;  4RHQ A;  4RHK A;  3MFV A;  3LHL A;  1WOG A;  4IU0 A;  4Q3S A;  4RHJ A;  2EIV A;  4HXQ A;  2EF4 A;  3GMZ A;  5HJA A;  1TA1 A;  2A0M A;  4IU1 A;  2RLA A;  2ZAV A;  3DJ8 A;  4HWW A;  4IXU A;  5RLA A;  1HQ5 A;  1P8M A;  3PZL A;  1D3V A;  3NIP A;  1GQ7 A;  5CEV A;  4RHM A;  1T4S A;  4RHI A;  4IXV A;  1ZPG A;  1HQF A;  1T5G A;  4I06 A;  2PHA A;  1ZPE A;  2EF5 A;  4Q3V A;  3RLA A;  4IE1 A;  4IU5 A;  4GSM A;  4ITY A;  1R1O A;  4IU4 A;  3LP7 A;  4G3H A;  1PQ3 A;  4MXR A;  1TBJ A;  1TBL A;  4Q3U A;  4RHL A;  4MYL A;  2CEV A;  4GWD A;  4Q3R A;  1GQ6 A;  1HQH A;  4Q3T A;  3LP4 A;  4MYF A;  4IE2 A;  4CEV A;  4GSV A;  5HJ9 A;  3E6K A;  4Q41 A;  1WOI A;  3GN0 A;  3MJL A;  4FCI A;  3F80 A;  4Q3Q A;  1P8R A;  3E9B A;  4GSZ A;  2PLL A;  1WOH A;  3SL1 A;  1T4T A;  3KV2 A;  4RLA A;  3SKK A;  1T5F A;  1XFK A;  4MYN A;  4Q3R C;  4DZ4 A;  3E8Q A;  4IE3 A;  1WVB A;  2AEB A;  3THE A;  4MYK A;  1CEV A;  3SJT A;  2PHO A;  1P8S A;  1TBH A;  4FCK A;  1HQX A;  4Q40 A;  3M1R A;  3TF3 A;  4Q42 A;  3CEV A;  4GWC A;  3SL0 A;  3NIQ A;  3MMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...