2A3RA

Crystal structure of human sulfotransferase sult1a3 in complex with dopamine and 3-phosphoadenosine 5-phosphate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
287
structure length
287
Chain Sequence
RPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monoamine-sulfating phenol sulfotransferase
publication title Crystal structure of human sulfotransferase SULT1A3 in complex with dopamine and 3'-phosphoadenosine 5'-phosphate
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2005-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2a3rA00
1E79A 1JBKA 5FOTA 3GLIA 3SFZA 3FWYA 5EE5B 1V43A 3ASZA 5AJZA 5CLLA 4P4UA 1CF4A 4OBEA 3Q72A 4GZLA 4CEJA 4Z8YA 3THXA 1GWNA 1G8YA 3KTAB 1P2TA 2LWIA 2AHOA 1Q21A 5L3RA 1KK3A 2PCLA 4PZYA 3QEOA 1F6BA 1FP7A 2FNAA 5F98A 1SULA 4OJQA 5FOSA 1IN5A 2V55B 1GL9B 2FSHA 2D62A 3PVSA 3NTUA 1JR3D 3LW8A 3PV0A 4B74A 3RS5A 3KUDA 1M34E 4EIWA 3E2IA 1NIJA 3GFTA 3L0OA 1MOZA 4XTCS 1KO5A 1JNYA 2LKCA 2GK6A 4OHZA 3B13B 1K8RA 3IEUA 2HF9A 3L2OB 4URYR 5HE9A 1KDTA 2QN6A 5F3WB 2IEYA 4DDWA 2GEVA 4PAMA 2O8DB 1WRBA 3TSOA 1Q22A 4UQOA 4BUJA 2REXB 3KB2A 4D0NA 2GJKA 1R0XA 1XJQA 5J47A 1ZNYA 1YZKA 1OYWA 4QM6A 4MDFA 4KI0A 2O8DA 5LB2A 2CL7X 4HLCA 3PIRA 1SZPA 3CF2A 1VIAA 2YWEA 3TGPA 3QE0A 2QMOA 2FOLA 1G6OA 3KKMA 4NBSA 5P21A 1N6HA 3B8HA 1YR7A 3J81k 1DAIA 3UMSA 2C03A 3QG5A 3ZZUA 4DBLC 1BH2A 1YZQA 4NYMQ 3LXRA 1E2JA 4Q47A 3ZS8A 1XTKA 1DG1G 1VCNA 3QKUA 1TL7C 4YMTA 1UEIA 1OXTA 2CHQA 4IOJA 1GIAA 4Q18A 2CDNA 4C0JA 2ZEJA 1FZQA 2VF7A 5LB4A 4BLSA 4D4LA 1XXHA 2XB4A 1XD9A 2AKYA 3H2YA 1KO7A 1FUKA 1H8HA 3GJXC 1WF3A 3THXB 3SYLA 2AXPA 2QEQA 2WJGA 4P4SB 5H8WA 2WJJA 4PC7A 2R2AA 3SJCA 5BQ5A 2IUUA 1T3LA 2WKRA 5CJ2A 4HZIA 2ZIAA 4P3YA 1HT2E 3RLFA 2W0MA 3SNHA 5KHOC 3EZ9A 5EE0A 4JL6A 2XX3A 1U0LA 5L8VA 4KODA 1FUUA 5JRJA 4A8JA 1IOZA 3MWYW 3D6TB 1TF7A 4RKEA 3OEEA 1H8ED 2GJ8A 3F5FA 3KTAA 3AEZA 4XVRA 1W4AA 4TMZA 4EPXA 2F1IA 3FKSA 3OAAA 3U60B 1UJ2A 4LHVA 2Z4RA 1XRJA 1RJ9B 2G3YA 2Y8EA 1EXMA 2ZAOA 1ZM2A 3L0SA 1ZC4A 3QNUA 2XAUA 2X2EA 4JYBA 3T1OA 2QAGB 4LJ9A 3ZS9A 1KGDA 1N3BA 2ORVA 4KCGA 3OIYA 3TH5A 4IKEA 2CL6X 4NL4H 2A3RA 1A4RA 1E96A 3HDTA 2N46A 3GEIA 2IA5A 3ONWA 4KSCA 4D26A 5E95A 1KI2A 3QG1A 1IJEA 1UKVY 3NWJA 4PC1A 3KKOA 3SS8A 3EPJA 4O2RA 5M04A 4NCJA 1O3YA 3S1AB 1DELA 2O0KA 3M6AA 2F1RA 1G5PA 5ANRB 1R5OA 3KQNA 4MRVA 3AVPA 3GMTA 4XH9B 4GFDA 4B3CA 4ERNA 3DHWC 2CCGA 2IYQA 3R8FA 3SHWA 3LFUA 3EW9A 5EP1A 3RYTC 2A5DA 4Q1CA 2PMKA 1ZRHA 2FMXA 5CDFE 2IS2A 1G7SA 4QXAA 1EWRA 2N1BA 4CF7A 2H7VA 2KJQA 1GG2A 4PQRA 1I4TD 1TUIA 3CH4B 2QMHA 4Q4HB 5KNCA 5FUWA 2DB3A 4M8NE 3LBNA 1P6XA 4ZIRA 3GLGE 2PZFA 4A8JB 4EUNA 2OBMA 3AH8A 4Q02A 4YDHB 3K53A 2OEPA 4E5UA 3GJ6A 2P0EA 3UWOA 4W5JA 4LOAA 3SZRA 4JLNA 3ZQJA 3BFKA 1P73A 3QQ5A 2AR7A 5KNBA 3SOPA 5G40A 2GK7A 1FNMA 2F43A 2G6BA 4BLPA 5HZKA 1KZ7B 5FTJA 1ELOA 2Z83A 1G7CA 4JVNA 4B2LA 1NBME 1ZD1A 2RGEA 5E3HA 1GDDA 1Q3TA 5EJEA 2IYSA 3A58B 3D31A 1U8AA 1KY2A 2HT6A 1DARA 1DAFA 2A7QA 4LYHA 4TYYA 1ZAKA 2JATA 3BB4A 1IN4A 1N2CE 2UZ3A 4JMPA 3C5CA 2JJ1A 1G3UA 1SVWA 3F3YA 3CONA 4EPTA 3BXZA 3SBDA 421PA 2QGZA 4AG6A 3WHKA 4XTRA 1P9WA 4M1WA 1NVWQ 2ZUDA 2ZRNA 2ZROA 3SFVA 2IS1A 1TF5A 4MYHA 1ODFA 1Q44A 2B92A 2O8FA 4R98A 2XGJA 3GLHB 3VX4A 2DFKB 3GFPA 4UXIA 2GF9A 2F7SA 4TMVA 1E79D 5B57C 4NCNA 1E2PA 2XJ4A 3SU8A 4D4MA 1OIXA 4Q9HA 1W0KA 2BBOA 1GKIA 1Z0AA 2GWHA 1SVKA 2RMKA 1G20E 2NIPA 1FTSA 1Z2CA 5GJCA 3WY9A 3U4QB 1ANKA 3LY5A 3NC1C 2QPAA 3FHTA 2Q3FA 1GP2A 2JLZA 3TUZC 1W36D 3WP0A 3U2QA 1RRPA 4F4JA 4Q66C 2OESA 4BLQA 2ZANA 4BLTA 1P5ZB 5FBLB 1G41A 1PUIA 3QXJA 1G8HA 1US8A 4YMWA 2GETA 1OH6A 2IYWA 2ZU0C 3BB1A 1DOAA 4I1UA 2G9NA 1OKKA 1MT0A 4IDQA 2QM8A 3RABA 3EPLA 2JA1A 1A1VA 3VX3A 1AZSC 4D80A 3QPUA 3MWJA 1OJLA 3SQXA 4KFSA 1BMFA 1Q0UA 3SDZA 2P67A 1EX6A 2ZRAA 4LI0A 1EFRD 4HUTA 2FPLA 1E2GA 2UVQA 1OH7A 2QI9C 2O8BB 2G0TA 4HEJA 3K0AA 1E4YA 4CZ2A 1XD8A 5JEDA 5JLJA 2WWXA 2B8TA 2QM7A 2ZE6A 3P26A 3NG1A 3CX6A 3T5GA 2YWFA 4KV9A 4PSAA 4Q1BA 2G77B 1MO6A 3RS7A 2BKUA 4UNSA 3CR8A 2XSZD 4QHTA 1B0UA 2AX4A 3MAAC 4M1YA 3AF3A 3NH6A 4LYFA 5CITA 4BLRA 1OFIA 1CJKC 3O8BA 1VCOA 3DKPA 3M1IA 4KVAA 4OQNA 3KUCA 3E70C 4XWKA 1QHSA 2YC2C 1UBCA 5IK2A 1YRAA 1S4QA 3T1QA 1W0JA 1CP2A 4EFLA 3P1JA 1OE0A 2UZIR 2ZR9A 2W6ID 4WIAA 2XNSA 1FMJA 2JGNA 6Q21A 4NYJR 3HWSA 3DL0A 2DWQA 3SYNA 1KMHA 4CGZA 3TW8B 4DVGA 4G5GA 3TSZA 1D2EA 4Q4AA 1JR3E 1F2UA 1D8TA 1WQ1R 2X1VA 5HKKA 221PA 2WAXA 3W5JA 3K8YA 5JJKA 5KU1A 1G4AE 1GNQA 2BCGY 4HLQB 5DLQC 4OI1A 5GADl 2V7QD 4IW3B 4AKEA 5EE9A 2ZS9A 5TDHA 1ZUHA 1NLFA 5G3ZA 3SN6A 3A1TA 1P62B 1Z8FA 2QMUA 2YZ2A 4LY6A 4KITB 2ZSFA 5FOXA 4BFXA 4X8OA 4XWAA 4LBYA 2NPFA 3FGNA 1U98A 2IS4A 3C7KA 3THYA 1IQPA 5JBQA 2GAOA 2O8CB 4RZ2A 2TMKA 2ZYVX 5JWRA 3FTQA 2WJHA 2ZSAA 2B21A 4LDJA 4W7SA 4EQ6B 1WDTA 2WOOA 4M1SA 2PMDA 5AJYA 4B48A 1OXVA 4I81A 4W5HA 3K0SA 4MKHA 1IJFA 1JQJC 2BJVA 2ZJ2A 1ZNWA 3K09A 1XMSA 5F9HA 1N6KA 3VAAA 3DZ8A 2CNWD 3SI7A 5HCNA 3TQFA 1G21E 4POAA 1RKBA 2C5LA 2VEDA 2ODWA 3MD0A 2EW1A 3BFXA 1KO1A 4ACAA 4XD7A 4DSUA 2ZJ8A 5B2ZA 3WNDA 3QBVA 1U2RA 3BAFA 2ZRLA 1P2SA 3Q85A 4Q7MB 1AN0A 2I4IA 3CRW1 4LJ5A 3BH0A 1JI0A 2HYDA 4Q9JA 3QUSA 1XMVA 2RHMA 3I32A 1UM8A 1CR2A 4MYCA 1OXXK 3BRWD 3LVRE 1NIPA 2AN9A 1R0ZA 4KVGA 4BEBA 1QBKC 1XEWX 1U99A 1RE0A 2AFIE 5D3MA 3UMRA 1II8A 3W5IA 5LDDC 1U90A 4RD1A 4D25A 2J59A 1VKJA 2IYXA 5CDFA 1KSGA 2JJ8A 2ZE7A 1TU3A 2VHTA 2IF2A 3QSYA 1Z0KA 3LVQE 4TN1A 4C2UA 2XZPA 4JLOA 5K8IA 1Z07A 4ZI2A 1R4AA 1XXHB 1G3QA 4GOKA 2FA9A 3AQ4A 5IF9A 1GKYA 2DCUA 1Q12A 3IIJA 4Q9KA 4KXFB 1NL3A 1YJ5A 1EFHA 3K70B 2AWNA 2W6JA 4YXWA 4JKIA 5CB8A 3WYFA 621PA 2PLRA 5HR5A 4NDZA 2H17A 1S0UA 4RKFA 5EUQB 4ASUD 1XNJA 4TT3D 3X1YA 2GRJA 3ETLA 3IDQA 3O8DA 5FH9A 4TLCA 1UBGA 1HE8B 1NBMA 3OE7A 4B6EA 3WRYC 5HPYB 3AP1A 1MRNA 2ZRKA 3Q3JB 3WBJA 1GILA 3B82A 3WMGA 4HI0E 4IOLA 4QBGB 3EZ2A 5G3YA 2GJSA 4AC9A 4LJ6A 4G5SA 3U6KA 3K1JA 2C77A 1UBEA 3RS4A 3LQQA 1QHNA 4BFTA 4BFZA 3FMIA 2VP5A 5BYJA 2CLDX 1F3OA 1NG9A 1ZM3A 2FH5B 1RIFA 4M1MA 3IKJA 3THWB 1F2TA 1OIVA 4TQUS 1S96A 1NVXQ 2RGBA 4B75A 1SXJA 2DFTA 2GXSA 2QP9X 1VTKA 3NIBA 5LD2B 4LWZA 4GL2A 2VP6A 3VKGA 1UADA 3BH6A 4YMVA 3C8UA 4QBIA 1KI6A 3GJ8A 2PJRA 3HU2A 4B34A 1KI8A 3HYRA 4ITRC 1II0A 1XB2A 3VU9A 1N6LA 3O8RA 3I8SA 1ZNXA 3GLFE 4GOJA 5E7IA 4DZZA 4PC3A 4JLBA 1BOFA 4C9BA 1AKYA 3DEFA 1YRBA 4IFBA 4YQFA 1WBBA 2XJ9A 2J7KA 5KNDA 3RRNA 2BM1A 4NYJQ 1AIPA 5IRCD 1QHHA 1E4VA 1YHNA 2FF7A 1XZPA 4LCBA 1T3HA 1AS0A 2OZEA 3ZQ6A 1N0UA 1TX4B 4QG7A 3AKDA 2OBNA 4NYIR 3BOSA 3CPJB 5GJWC 2FZ4A 4HSEA 2ZYWX 3W90A 1Z28A 3QPVA 4MGYR 1JB1A 2VP2A 4MH0R 3B1ZA 1NSFA 2PBRA 4JKYA 2CCJA 4WZBE 2EYUA 2WBLC 3LX5A 4IVRA 2JDIA 3QI2A 1C1YA 3Q7QA 4UXHA 3OIVA 4PAOA 2BV3A 3QKRB 4TL9A 4FWTA 4CEIB 1TEXA 2EYQA 4Z51A 3WHLA 2JIZA 1W0JD 2IWHA 3EZ7A 3QBTA 4X8MA 1OV4A 4IHQA 5KPJA 4L16A 3CLVA 3EIHA 4YLGA 3RANA 1Q1BA 2Q3MA 1A5TA 2VSOA 4V02A 4QJ3A 2ZRFA 3W3AA 3UIEA 1AS3A 4AI6A 4CYMA 1XTRA 3EA0A 4LHZA 2PL3A 4NTZA 4Q19A 4OJKA 1JR3A 3I1FA 4DB4A 4GI7A 3THOA 4DJTA 4OHYA 5C4GB 4HZUA 2WV9A 4AIIA 1AJEA 1E69A 3CUEF 3FKSD 5CYOA 1KY3A 2FG5A 3V9PA 1WE2A 2ODNA 3AP3A 3G0HA 2JLWA 1I2MA 3UANA 3BD9A 3VFDA 2H18A 1LB1B 2J41A 3GCGA 3KJEA 2AD1A 3CR7A 4WAUA 4LJYA 4ZDJA 4OQFA 2RGXA 4AG5A 1Q1QA 4MA4A 2J46A 4C0AC 3RS2A 4Q7KA 1IN8A 3B9PA 3JZMA 1KJZA 1TTTA 4V0ME 4BZPA 2WZQA 4KYUA 3FFAA 4GMXA 3LDAA 3QKTA 1ETUA 1PV4A 2O52A 4JJKA 2LCFA 3LW7A 3GLGB 4RD3A 5CK5A 1ZIPA 3SJZA 4I1SA 2CEAA 2ZVPX 2VA8A 2ATVA 2P6UA 5SZKB 5CYPA 4HDOB 2CLCX 2ONJA 3IILA 2BBSA 5DNYB 3ZGXA 2GESA 4URZR 1G17A 5FR1A 2ZJOA 4HAUA 2A5GA 2IC5A 2F55A 2HLDD 4M1KA 3N2EA 2GZAA 1XX6A 3A1VA 3IIMA 3P32A 5FPKA 4EJSA 4JLPA 1DTSA 2BMJA 1AQYA 3NEYA 1UPTA 2V6IA 3D3QA 1BYUA 2A78A 2G83A 1I4LD 3D8BA 3KJGA 2O8EA 2DPXA 2WIBA 4Q01A 4A0HA 4A2QA 5DHAA 5FBVB 1AK2A 4A0GA 1WA5A 5FUYA 1T5IA 4JL8A 2CJWB 1GOTA 2JLSA 2GCOA 1IAQA 2F43B 1ZM7A 2YNMA 1KI4A 4A1FA 2RAPA 4HAZA 2GHIA 2J87A 2OCPA 4D0GA 1CXZA 1NF3A 3E1SA 1E94E 1DAMA 3CRQA 2X19A 4OQXA 4Q4JB 2MSCB 1U9IA 1II9A 5DSZA 1T8TA 1R2QA 2WJIA 1LF5A 3NBYC 2YYZA 4MRNA 2CVFA 2C2HA 1KNXA 3EA5A 4HAVA 4D4JA 3L8YA 1NKTA 1TF2A 1PLLA 3FFBA 1E9EA 3TIFA 1W2GA 4A0FA 1JXOA 4B76A 4TZ6A 5BWMA 3CZQA 3T06B 2NO6A 4E09A 3ZIAD 2NMVA 3GJ7A 1A2KC 1WP9A 2PLFA 4BFVA 1P4SA 2DFLA 1Z83A 3R7WA 3FHOA 1EWQA 1OFTA 4URVR 1F60A 1T6NA 2WWYA 5C2JB 1E2KA 2FFHA 4M2LA 2QQEA 1FQJA 1G19A 3AF1A 2GCOB 3FHCB 3VR6A 4X8HA 3OE7D 4OK3A 5AJVB 2NQ2C 2OHFA 3QOFA 5HCIA 4CVNA 3K0AB 2A5YB 1R10A 4TYNA 2YC4C 1NY6A 4Q4LA 4C7OA 3L0IB 2ZU6A 2BIFA 1YZNA 1LS6A 1QHYA 1SHZA 2ZUCA 4HLUC 4I4LA 2BEKA 4RCZA 3EPHA 5BN4A 1EFRA 1W2HA 1XCPA 1IN7A 1UAAA 1JALA 2QPOA 4FMDF 3P4XA 3K0CA 1AA9A 1BKDR 1DO0A 1P2VA 2V54A 4B3DA 3DMNA 1IHUA 4Q7LA 4V03A 3DM5A 4JT2A 1P7CA 3CWQA 1US8B 1U94A 1YR9A 4A6XA 3U7HB 3L82B 1KK0A 3RSLA 5EP2A 4B73A 1DAHA 1FMLA 2VYFA 1D2NA 3CPHA 4G01B 4NYIQ 3MJRA 3ZDQA 2C99A 4KFRA 2OM2A 4TQAA 4BPBA 4C3ZA 1KYIA 3AVVA 1Q3HA 521PA 3QPWA 1P2UA 5EUMA 1N0VC 1YKSA 2WMOB 1VG9B 1YVDA 2QTFA 2DR3A 5EP4A 1KMHB 3TK1A 2GVDC 2AXNA 4B71A 1JAIA 1RZ3A 3TSWA 4XIGS 4JYCA 2P5SA 1SHKA 5L3QA 5TV2A 1IXRC 3B1VA 2ZRCA 2GZDA 3ZVNA 2CJWA 5JI3E 3UG6A 2H92A 4R2HA 4O2LA 4QKQA 1KHTA 2QZ4A 3IHWA 1U0JA 5J4YA 3VNVA 1Z0JA 1AKEA 5H70A 3IQWA 3NEJA 1AGPA 2ZITA 2E9SA 3OEED 5KPDA 3VKHA 1KSFX 4LHYA 4BFUA 4I1VA 4A82A 3RWOA 1E9DA 721PA 4ABYA 2ECKA 3A4NA 4B43A 1JEDA 1Z6YA 5G41A 1S3SA 4H1VA 2QENA 3GPLA 3AKYA 1UEJA 3RHFA 3U3MA 3BWDD 1LV7A 2J7PD 1M7GA 1QZXA 3EC1A 1CLUA 2GA8A 4GMDA 1A7JA 4YMUA 1Q1EA 1OH8A 4FWIB 2OLKA 3A6PC 5AUNB 1OT3A 1YR6A 5E7JA 2A5FA 4FMCB 4MGZR 1NSTA 2ANBA 5FI0B 3A4MA 2IHYA 1D9XA 1NN0A 2F3RA 2MMCA 2JIZD 4PAQA 4PX9A 1KOFA 3ASYA 4JJZA 1E6CA 1IN6A 2J0UA 3OZXA 3MWLA 5JHGB 1XJCA 3CW2A 5J4LA 2JLRA 1SVOA 4EPRA 4HLUA 4RJLA 3PENA 4WVFA 1W36B 1MABB 1VHLA 4QBHA 4BFYA 1ZM4A 3ADBA 4HAWA 1L8QA 2WSSA 3SJAA 2XNDD 3ZVMA 2QP3A 3NXSA 3ZH9B 5JI2E 2ONKA 2CBZA 3DKVA 1NVUQ 2WTUA 2DWOA 1GM5A 3CB4A 2NGRA 3JVUA 2Q9CA 2W58A 4Z8XA 1KIMA 1XD2B 2VHJA 3KXLA 1DAKA 4X8LA 1ZVQA 3B6EA 1XJ0A 4OI4A 4BZQA 2NPIA 1IY0A 2WWWA 1H8HD 3HR8A 4GBMA 3TRFA 3I61A 4R2IA 1E0SA 2GDJA 2QA5A 5JWHA 3T1TA 1RRCA 1N6NA 3K09C 1E9BA 4ESHA 5DYIA 2JEOA 2GBLC 4C2TA 3GJ5A 1L7VC 2HT1A 1SKYB 4LGMA 1P9RA 3LD9A 2BC9A 4P33A 2OCAA 5CIQA 3W8NA 5AUPB 4KAXA 3OHMA 2P2LA 3CWZA 3GJ0A 3ZVLA 1E3MA 2IXGA 2XSZA 2DBYA 2NOAA 1BIFA 2QBYA 1S3GA 4Q5IA 2ZI7A 1K5GA 2PCJA 1NI3A 4DKXA 3MSXA 1SVMA 4FCTA 1E0JA 2ZJAA 4PHFA 2ZRJA 4TWZA 4DLSA 3EZFA 3ZZTA 4MITA 1T9HA 2XZOA 4R9UC 5JJLA 1UDWA 5B64A 1SGWA 1HA3A 4PHHA 1YR8A 5JEEA 2FX3A 4P31A 2BBTA 1E2NA 3QF4B 2JDID 1LFDB 3WBKA 4JZKA 1HH4A 1XP8A 2F9LA 2FU5C 2UKDA 3JVVA 1KDOA 1FQKA 1HQYE 4LC1A 4QFMA 4JLAA 5LPNA 1W0KD 1B23P 1E9CA 1ZP6A 3I73A 3DOFA 1OIWA 2BCJQ 2W0SA 2FV8A 3TAHA 1HYQA 4XOIA 3NHBA 5DI3A 4ZDIA 3CRVA 4NCKA 5DIFA 3VKWA 4R71A 1SQ5A 1SXJB 1A82A 1ZU4A 3CKLA 3KX2A 4JVMA 1JJ7A 5D3QA 3LA6A 3T5DA 4BZXA 3X1ZA 1G3MA 5E4FA 1J99A 2CE7A 2C9CA 1UKEA 1T5LA 3TNFA 2FE4A 1VIYA 1OKKD 5IT5A 2WVJA 1WXQA 2Z4SA 2OCYC 1C4OA 3MLEA 4ARZA 2JJ2D 3U44A 4DCSA 5FOVA 1W47A 2KBEA 4RCYA 1OHHD 2YINC 2YV5A 4Q03A 3S1AA 1OFUX 2QUZA 4P0TA 4TL8A 5K8LA 1DO2A 1RYFA 1PVOA 1S8FA 3W9YA 1I2DA 5TVKA 1L4UA 5JS8A 1K5DA 3HU3A 1NP6A 2WIAA 3I72A 1Z0DA 2FFBA 1M1YE 1TQ4A 2D06A 2J0VA 4LSGA 1FW6A 1P60A 1KTVA 1Z29A 2AL7A 2VF8A 2XTNA 2KSQA 2E1RA 4RVCA 4D6PA 2VTKA 2CL0X 1S2MA 1GZSA 3H4MA 2A5JA 3MWKA 4RZUA 4MKIA 4A92A 3DZDA 4NP6A 3PCRB 2QSZA 4OHXA 5KSPA 2NO0A 5A5GA 3QXXA 4NCHA 3W3ZB 4DIEA 3ZLJA 5UKDA 5BXQC 2F1JA 3AP2A 3CPEA 5HZHA 1VG1A 4XVQA 1R5BA 4DIDA 1D9ZA 4URUR 1SKYE 1XEXA 3W8RA 1DPFA 1RRGA 1UF9A 5FFMA 4D81A 4QBFA 4BFSA 3AGPA 3WNBA 3AVWA 3AVOA 3LX8A 4JLJA 1RFLA 1XFAA 2CVHA 2Q21A 3BFVA 4RZXA 3PUYA 4N0DA 1G9XA 4LJ8A 3R9WA 2HJVA 1F5NA 2C78A 1VCMA 4II7A 2R62A 3OEHD 3AUXA 3ADKA 2GCPA 5FBRB 2V7QA 2HUPA 1P61B 3W6OA 4D0LB 3B5JA 3EIEA 4IEEA 4Q1EA 1BYIA 1SKQA 2IUSA 5DYGA 5DGXA 2ZI4A 5EZ5A 3FYHA 3RC8A 3UKDA 2I1QA 4Z54A 3VNUA 1M7HA 1W49A 5BYKA 4Q00A 2JLVA 2YOHA 3LRPA 5KYKA 2WSMA 1LF0A 4CW7A 3HYTA 2ZTSA 2G1JA 1Z3IX 1NMZA 2ZE8A 2P65A 2OXCA 2ZJBA 1XTIA 2IT1A 3CM0A 3BE4A 4KLZA 3RSOA 4LC0A 1FNNA 1XD2A 3KL4A 5TY0A 1QG2A 1KI7A 1PJRA 1R0WA 2IL1A 5L3SA 2HJGA 3PUXA 2VHCA 1GAJA 1G3RA 4P32A 4FN5A 3KFXA 3K0CC 3ZYCA 3QF7A 1G6HA 2ODEA 2CK3D 1CS4C 4TQ9A 2GXUA 3KQUA 1S1CA 1O87A 1OB5A 4ZV4A 1NNEA 4DLXA 2BM0A 1R0YA 3Q5DA 5A4JA 3RRZA 2J45A 1CKEA 4RY2A 3MFYA 1SVLA 3BS4A 2ZI9A 1FOEB 5EP3A 3U3JA 4V0NA 4KBFA 3QVVA 1KO4A 3D7MA 2D7CA 2QRNA 5H68A 1TADA 1H65A 4ZCLA 2EFHB 4IDOA 1XTSA 2G1KA 2RH5A 4WA7A 1Z5ZA 2GJ9A 2VP9A 4QJ4A 3ICEA 4OI0A 3BORA 4TTPA 4IFEA 1HURA 4DLWA 5JHHB 4B3GA 3KFVA 4XJXA 3EXAA 1FX0B 3R7WB 4WXPA 1N6OA 1CJMA 821PA 3AVUA 3AM1A 1NLYA 5DE3A 4C0LA 4LBZA 1EX7A 3SYKA 1XCGB 4CEHB 1E2MA 2ASEA 2D2EA 4D2IA 1HEIA 3MGCA 4A15A 2VL7A 1KI3A 2R65A 3FPAA 4N0EA 4D82A 3QIAA 2EQBA 2ZS7A 1IXSB 4YMSA 5E7MA 2CHVA 3SBEA 3QEJA 4PZLA 4ASUA 2GZHA 1Z6GA 5CLQA 3T61A 1CBUA 1QVRA 1ZU5A 3BIFA 1OFHA 4IVPA 2FEOA 1XDBA 4MKGA 1XEXB 4TT3A 1WB9A 4KBGA 4ACBA 3BH7A 2ORIA 2ZSEA 4GT1A 4LHXA 4PZZA 2P6RA 3MG9A 3PJRA 4A8JC 2IXFA 4UNPA 3QJYA 4NKRA 3Q8XB 3RRYA 4XVUA 1NBMD 3QY0A 1MR3F 2QGNA 2ZSBA 4ZIRB 1RW4A 4NZYA 3HR7A 1YU9A 2IF0A 1OB2A 4GOXA 3REGA 4O0MA 1DADA 1HT1E 3OFNA 2O8EB 3DM9B 1RC8A 3P4YA 3AVTA 5KDLA 2ATXA 5D3MB 3N5CA 2JLUA 8OHMA 3H84A 3VU9B 4CIDA 1PLKA 3DOEA 3CX8A 5CIWA 4B35A 2C9YA 1ZC3A 3HPRA 3I5YA 4PPQA 2XEXA 1VG0B 3R9XA 4C7OB 5SZHB 2WPDD 4MGKR 3UATA 2W2XA 4OQMA 4RFVA 1LS1A 1OH5A 2PZEA 4IVQA 1J90A 4URWR 1W1WA 1KKLA 4TMXA 3KQKA 2YVUA 3FDIA 1N25A 5DN6A 1COWA 1WMSA 3GEHA 3WMEA 3CZPA 4DUGD 4I99A 4ZKEA 4PO1A 3Q7PA 3TUIC 1W48A 1LW7A 5J4KA 1GITA 4LV8B 4JL5A 2ZETA 4EFMA 2WJVA 3DPUA 1GNPA 3T35A 5BN3A 1VYUA 4TMTA 2ZRDA 4U02A 5AJWA 2C98A 5GVRA 2HYIC 2HXYA 4FMDB 1FFHA 2ERYA 2BWJA 4MQBA 1TQ6A 4LRWA 5F9FA 1QRAA 3VTKA 1JPJA 2D2FA 4KHZA 5FTMA 2YHSA 3GJ4A 3CNNA 2ANCA 4KJZA 2QG6A 4MRRA 2JJ2A 2WHXA 1N5KA 3IO5A 4HB2A 2V1UA 4M9ZA 2NO1A 2YOGA 2IYYA 2J3EA 2BHRA 4AK9A 3THYB 4NE2A 1SXJC 3TMKA 3GLIE 3N70A 2OSBA 3HPQA 4DT1B 5KSOA 2DHRA 4AYWA 4PC6A 1G5RA 4PPGA 4JSYA 1E2DA 4QL3A 2WKPA 1LVGA 3NDPA 3LBHA 3VR1A 1TNDA 1GRNA 2O0HA 2C8VA 4QGHA 2KI5A 2NZJA 3QVUA 1AZTA 1VDZA 4U00A 4DSTA 4ZCIA 1BS1A 3CRRA 4CEHA 1JPNA 4DLYA 1L4YA 1TQDA 1TAGA 2R6CA 3R8CA 3C14C 2QAJA 4FIDA 3LLMA 1T0HB 1Y3AA 4PC2A 1IY1A 1Y63A 2FSGA 2V1XA 1XU4A 1E1QA 1VMAA 4S2EA 1R8QA 4BEJA 2ZI6A 4EJSB 4PHGA 3C5HA 4FW9A 3FMOB 3UMFA 1E1RD 2GJAA 1G7TA 1Z0FA 3UG7A 1JJVA 3Q5EA 1X6VA 1FTNA 4HB3A 4E07A 3L8ZA 1ZNZA 4M22A 1Z6AA 4XSGA 4UNQA 3VR4A 4DDVA 1E99A 1W44A 2BJWA 2FGJA 5L3QB 2BKEA 1Z2AA 4Q9IA 1VHTA 2XXAA 2P3SA 5J4HA 1X8LA 1SXJD 1UDXA 3SC3A 5KDOA 5JS7A 4NHOA 1G18A 4TL6A 3ZVRA 1F2UB 3NH9A 4AKIA 3EASA 2RGGA 3HP1A 4NONA 4CT4B 2R6DA 2XNDA 4GSYA 1HQCA 2VBCA 3NKVA 1D2MA 1W4BA 4J0QA 4MUAA 2NG1A 1ZINA 2CXXA 2F6RA 1VCIA 2J7PA 4JIMA 4BRUA 3UPUA 2BDTA 2C96A 3FVQA 3BB3A 4BQSA 2VHQA 5JSZA 2FSIA 1ZUNB 1GUAA 4V0KA 2QPTA 4Q48A 1E2QA 2XB2A 4V0OA 1JR6A 4DCUA 1EK0A 1XEWY 4L5BA 5FPSA 1PUJA 2P5TB 2ZE5A 1CTQA 4LYAA 2O8CA 3PQCA 3T12A 2OFXA 5K8UA 1KSJA 1L2TA 2ZJZA 3U4QA 1U0HC 2NZ8A 4QGFA 3X1XA 1U9IC 2WKQA 1CR4A 2HV8A 5EZ6B 1GRQA 2J0QA 3NBZC 4DLZA 5FOWA 3SQWA 2WSSD 2V4ZA 5CJPA 2J0UB 3GLHA 4Z1MA 4L15A 4TMWA 2QAGC 4OYHA 4OK6A 2WICA 4XWOA 3ECCA 2GCNA 4TLBA 2FPMA 1Z6XA 2Q9AA 2ZRIA 4M21A 5C46F 5FUVA 3FMFA 2CCKA 2FZLA 2VSXA 5K8TA 4FCVA 2R6GA 4HYYA 4TSFD 2SHKA 4Q9LA 2O8FB 1Q1ZA 1YZUA 4PHTA 2RGAA 2IS6A 1E0AA 2DFNA 1XBTA 2QTVB 4H9GA 3TVTA 1UBFA 4M9XA 4UXJA 5AK0A 4DLTA 2FPKA 1F2TB 1M8PA 1GTVA 2L0XA 3Q9LA 2X2FA 3B1WA 4DT1A 5FL7A 1A2BA 2Q3HA 2IYVA 2V6JA 3GLFB 2GBLA 4Q4JA 4CEJB 4Q4AB 2REBA 4C4PA 1G8GA 4ON9A 3TUJC 2GILA 4PSVA 4KFUA 4W5WA 1CR0A 5EXXA 3TR0A 2IX3A 3TW4A 2IYZA 3EPKA 2BBWA 3U3KA 3CNLA 3A1UA 3F0TA 1VYVA 1KDPA 4M1OA 3ZIAA 2KBFA 2Z5FA 4AURA 1IBRA 2C9OA 2QBYB 3NHAA 4TLEA 3U44B 1KK1A 4YC7A 4BASA 3EWAA 1CU1A 3GEEA 4OL0A 1XTQA 2BMFA 2MMGA 3GJ3A 4M0LA 1XF9A 4L9SA 4YONB 4JSTA 4L8GA 4Y0VA 1U8YA 2ZI5A 1ZUIA 3RAPR 1N6IA 4M9QA 3AF2A 3OFND 1RRFA 5KSYA 1EFCA 2K5UA 1ZBDA 1KSHA 4KLNA 3OIWA 5DI3B 4KFTA 2D4HA 2CK3A 2H1LA 3KKPA 4B6FA 4OI2A 4HZUB 4JLVA 3OESA 4OQLA 4QOSA 4HB0A 3O8CA 1ZW6A 4ESVA 1DEKA 1S9DA 3RWMB 3RDPA 5AUOB 1R8SA 4RD6A 3W6NA 4IDNA 3NDBB 1UKYA 3VHLB 1Q57A 3V4FA 4E22A 2ZJ5A 1W4RA 2Z6VA 1W36C 3MUFA 2ZR7A 4GPTA 2AD5A 4IXNA 1HTWA 1RVDA 2IK8A 1ZM9A 3IO3A 4V0MA 5BW8A 4AYTA 4DB2A 3H1TA 1OHHA 1CRPA 2OUKA 4US0R 2RB4A 4NYMR 3OIUA 2PX3A 2ODBA 2J5XA 2QNRA 3AGQA 2A30A 3K0EA 2NTYC 2J9RA 2ZPTX 4Y0AA 1Z0IA 2HEIA 3REFA 2QAGA 5LD2C 2QP4A 1OYYA 2X77A 3VR5A 1ZJ6A 2REOA 2FWRA 4DEYA 2D74A 4HDQB 2W00A 1DE0A 2Q6TA 2NO9A 3EIQA 3BERA 1PLJA 4WBSA 5JECA 1KZGB 3EZ6A 2ZREA 4FCWA 1YZLA 1ESMA 4QGAA 2CE2X 2QSYA 4EQ6A 1E2EA 4RD4A 4US1R 1W5TA 2CMKA 3WMFA 5GJVC 2VH5R 3VQTA 5CM8B 5EE3A 4QHSA 5C1BA 3FE2A 4PQYA 4TYPA 4LHWA 1W46A 3GLFA 4M53A 2XOKD 1R5NA 3TR5A 3NC0C 4DSNA 2PJZA 1S1MA 1TEVA 1T0JB 1G7RA 1TPZA 2WWGA 5DHFA 5JWOA 4KO8A 1QHGA 4IOMA 4LBVA 1CULC 3MRSA 4TLAA 2D3WA 1I4DD 2DY1A 4C0KA 1ONBA 3LBIA 4BWYA 1G16A 4TYQA 4O3MA 3U3OA 1DBSA 5KSZA 3DDCA 2WJYA 2W83A 4PXAA 4GDFA 2WWIA 2QMEA 1II8B 3ZD7A 4ZPXA 2IYRA 1N6PA 2R6AA 1KO8A 1JEEA 2FDCA 4HAXA 1KI1A 4F91B 4DHEA 3TKLA 5ELXA 2BVNA 3TJZA 3THWA 3SR0A 5DO9A 4BECA 2VSFA 3FKQA 2H16A 1KAGA 3U5ZB 4A0RA 3VMFA 3MJHA 3DMDA 2ZRBA 3IUYA 4CEIA 4IXMA 3BGWA 1JQLB 4PQFA 3CX7A 2AKAB 3VR3A 4LK2A 4B44A 4NU0A 3AVXA 2RGNC 2AWOA 2ZR0A 5EE1A 2B8WA 4P4SA 4FINA 2R8RA 3PEWA 2D7DA 4RSGA 2KB0A 4S35A 4MRSA 5B30A 5GVSA 2B6HA 1MO4A 5G53C 1AQUA 2GAAA 3ZD6A 4BGDA 4Q7JB 3H86A 3O47A 2OBLA 2CLSA 4M4SA 5J4VA 4TZ0A 3UXMA 4HB4A 4LPKA 4EAQA 2HCBA 3IPXA 5IHPA 2WWFA 3KQLA 3SJBA 3W34A 1Z08A 4HDCA 1OPXA 5FTLA 4C30A 2PEYA 4QJ5A 1G64A 1TUEA 2NO7A 1QHHB 1YE8A 2RGNA 4MRPA 4DLRA 3C41J 2B7BA 2EWWA 2FSFA 4IDHA 5DISB 1ZYUA 4OKSA 4ZCMA 3PUZA 4F93B 1E9FA 3QXSA 2ZI3A 3LQRA 5HTKA 1GRRA 2ZVQX 2XITA 3TAUA 4F38A 4JLMA 1XZQA 2QE7D 1TU4A 4Z1MD 3EC2A 1ZD9A 4W9MC 2BMEA 2GEUA 3B85A 3KZ1E 3OAAD 3TBKA 1TMKA 4PSKA 4R7ZA 2OCBA 4TSFA 4JLDA 3X1WA 2JJ1D 4JBXA 3ADCA 2XTMA 3L0PA 3OEHA 3PUWA 5TMPA 4ZKDA 4EFNA 2EFCB 4BFWA 3W6PA 5JMTA 2ZYUX 3AKEA 1EESA 1KMQA 4MYTA 1N5JA 3PR1A 4FMCF 1GNRA 1HY3A 3R20A 4AKHA 4DC9A 3AB3A 4LX0A 3EAQA 4TLDA 2GF0A 5AR1A 5FOUA 5FBWB 1EFTA 1FPMA 3LAWA 4L9WA 2G0NA 5TARA 4M1TA 1E2LA 4G3XA 2EFGA 3M4YA 2KWIA 2GEDA 3ADDA 1XXHE 4EPYA 2O5VA 3E5HA 5L3VA 1IY2A 1VPLA 2Z0MA 3QKSA 3AVQA 4PTLA 2R44A 1P3JA 3DO6A 3GD7A 5FPYA 3K70C 3GLIB 2QRZA 1GFIA 1K6MA 1XMJA 1IM2A 2GNOA 1N5LA 2WAYA 4WZ6A 1P9NA 4FMBB 4QHYA 5J40A 4HATA 4K8OA 1DAEA 1E2HA 4MGIR 4EDHA 2JAQA 2VQSA 4RFSA 4V0LA 1G8FA 4B2IA 4GP7A 5EXPA 3WRXC 4N1AA 2H5EA 1C9KA 4G5QA 5TXGA 3U61B 3QXHA 3IBYA 5DI9A 4AWXA 1G4UR 1CJUC 3C4JA 1XCMA 2IEZA 2YKGA 2AK2A 3U7GA 2QQ0A 2FN4A 2ZRPA 3QXCA 3IEVA 4TTQA 3LO5A 2ZJYA 3H0KA 4DCTA 3FMPB 4ZDWA 1P75A 4XD7D 4UKDA 3AF4A 4Q1DA 4UJ5A 1X8KA 1MRSA 4TMKA 4EPWA 1U81A 4UNNA 4LJ4A 2V3CC 3LLUA 4HAYA 5C4MA 3RVBA 5FTNA 1R6BX 2H8KA 4JLKA 1Z47A 1N0WA 4EPVA 3WXMA 4QRHA 2ZXUA 2IYLD 1Z06A 4FI3C 5JJIA 2VHUA 3L43A 2ZRHA 1G3IA 2YWHA 3I92A 3K9NA 4PPNA 1G8PA 1ZMXA 3UWKA 3ZJYA 1CEEA 2W6IA 1E1QD 1NG1A 5FI1B 5FPTA 1E0KA 1Z22A 1R7RA 3OF5A 4RFSB 2X8AA 3BK7A 4U5XA 1E9SA 1X1SA 1SVSA 2WPDA 2LKDA 4A36A 3AV0B 1OW3B 3P27A 2OFWA 3R9IA 3SE0A 5EQTA 4A2PA 1CIPA 1JXMA 1AGRA 3GP8A 2PT5A 3A37A 1QVAA 3PEYA 4NMMA 4CT5A 3GLGA 1P72A 1S9HA 2H57A 1KDRA 3I5XA 4GNKA 5B58C 4RD0A 4G1UC 1KKMA 4YXWD 3A36A 1X86B 1U8ZA 5CB6A 3LV8A 2ZYTX 4QM7A 1OXUA 1M6NA 2VRWA 1SXJE 3QKSB 2QL6A 1NJFA 1T3SA 2AFHE 3LH5A 4UJ3A 1MO3A 4A6PA 2O0JA 1X3SA 2WMNB 1T91A 1E2FA 1RJ9A 5KOYA 1MH1A 1E1RA 2RHDA 1V5WA 1JAHA 4BRWA 1TQ2A 2XOKA 3KJHA 3TE6A 2OXRA 1EGAA 2Q0HA 1GL6A 1OXSC 2PEZA 3PFIA 2QU8A 2BMDA 4Q4HA 4LV5B 2IWRA 1NMYA 3C15C 4C0BA 2QT1A 2FFAA 3JZAA 4OHWA 1E2IA 3KB1A 1NN1A 4DCNA 1YZGA 4Q1AA 3BC1A 1MKYA 2N42A 4QNMA 4IOKA 3QKRA 2DYKA 4LUCA 4PR0A 4KSBA 5GJBA 2B7CA 4ARZB 2VP4A 1Z6TA 5JSZB 1DVRA 1ZCBA 3G82C 4DLVA 3K0FB 1NVVR 1W5SA 3PEVA 1VG8A 1ESNA 3WYGA 3PUVA 1HUQA 2OG2A 3RS3A 5CK4A 4F92B 1DS6A 3LXXA 5AJXA 2JLYA 4QNRA 1QHXA 1WCV1 4CRWB 4F4IA 4HUQA 1KNQA 1YQTA 1J8YF 1E98A 1FX0A 4YDSA 2RKOA 4JBWA 4JVLA 2Q9BA 4ILEA 5EXSA 5FPHA 1N6RA 1BMFD 4RD2A 5L3SB 1J7KA 121PA 2EWVA 3G5UA 3GFOA 4DEXA 3I4LA 5J5CA 2YOFA 3V00A 4LZZA 4Q21A 4KU4A 4US2R 4TYWA 3KXIA 3EG5A 4DDUA 1W4CA 2IUTA 3AKCA 4D4KA 4IRUB 5AWFC 1IXZA 4Q1FA 4XSHA 1WBDA 3NBFA 2C95A 2HCJB 1BO6A 1UKZA 3PITA 2FEMA 1LTQA 1HV8A 5FUXA 2DWPA 3MCAA 4I1OA 5KDDA 2V9PA 5EXTA 3IHLA 2EFEB 2ORWA 3B60A 1CRQA 2GVZC 4TTRA 3CF0A 5CM9C 5HE8A 2ZRGA 2QT0A 4OHVA 4M9SA 3CIOA 2OO7A 4IEIA 2J1LA 4LJ7A 2W2TA 2FJUA 2QY9A 4B33A 4GP6A 2WM9B 5JRZA 2EFDB 3GLHE 3AF0A 4B47A 1GSIA 2PZGA 2HXSA 4PANA 3I62A 3TLXA 1G5TA 4QGGA 3TVDA 4B32A 4O25A 1GL7A 1NVVQ 3A1SA 5FL3A 5HKKD 3CO5A 4N3NA 4C0HA 1KJWA 2PT7A 3NBXX 4G0NA 1OF1A 2AK3A 4CDGA 4EKDA 5DN6D 5BN5A 1COWD 1OLOA 3M0EA 5TB5A 3ICQB 1UFQA 1D5CA 1NY5A 5JFGA 2OE2A 4ZO4A 2YJTD 1OSNA 1GKUB 3B78A 4WW0A 5FBQB 5FTKA 2MSEB 5SZIA 3SHFA 4QC2A 1IONA 3LNCA 3U3RA 2ZM5A 2YWGA 1XMIA 1MABA 2E87A 4WOPA 4MDEA 1XTJA 3U7FB 1Z63A 2QROA 3K0FA 4JT4A 3DVLA 3N2IA 5DH9A 2OT3B 3A4LA 2O8BA 3A1WA 3K9LA 4L4UA 2XXAB 4JBYA 2ZUBA 2VIIA 3I8XA 4MKFA 1DAGA 1NJGA 4A4DA 2XZLA 4P4TA 2HDNB 5IK2D 3PG5A 4B3FX 1QHIA 2OV2A 3B7GA 3PXGA 3X2SA 2ZQ5A 4DRZA 1GVNB 1J2JA 3CBQA 5H1YA 4G5RA 4NH0A 1M2OB 2QORA 4DWJA 4K46A 3ND9A 2CNWA 1QG4A 3IPYA 4AY2A 1G291 4BE7B 3KJIA 1JECA 2G88A 4HUQB 3WYAA 1QF9A 1MO5A 3QF4A 2GKSA 1Q20A 1RPZA 3NVAA 2HF8A 2IHBA 4GZMA 4PFSA 3CH5A 1XPOA 1ZD8A 1KK2A 4UNRA 2RGCA 1H8EA 4JS0A 3K9GA 5FR2A 3WP1B 2IYUA 1DG3A 4C0QC 2ZSDA 4FD2A 1F48A 2IW3A 3AUYA 3KKNA 1J8MF 2RCNA 4LPSA 3K70D 2FFQA 4G5OA 1CJTC 3FOZA 1YZTA 1FL9A 1EG7A 4IDPA 2XTZA 5F2EA 1SVIA 3T1VA 2Z43A 3LWNA 4KYIB 1NLZA 4LBWA 1AM4D 2R9VA 1QDEA 1J70A 2F3TA 4E03A 4FXPA 1XWIA 5A0FA 2V8OA 4WZAE 2IBMA 2JCSA 1LY1A 5KTYA 1HE1C 4EJSC 2PH1A 4DXAA 1NN5A 3PEUA 3KKQA 1NN3A 2WOJA 3FB4A 1VYTA 1N5IA 3B1XA 4PO9A 2GXAA 1ZCAA 3QENA 4BLOA 1NMXA 2A2ZA 2W2VA 4DDTA 3RRMA 2GXQA 3SEAA 3UK6A 4A2WA 4DUGA 3HU1A 2EVWX 1KAOA 3RS0A 1KJYA 1AS2A 1KI9A 5JZVA 1KI6B 3EARA 3EWSA 4AD8A 1E9RA 4AKGA 1XEFA 1NRJB 2FGKA 2MSDB 3U7EB 1XPRA 4RZ3A 2GTPA 1X1RA 5JCZA 1D6JA 2OILA 3WNCA 4MYUA 3IQXA 4ZI3A 2JLXA 1LNZA 2JLQA 4F7WA 1M74A 3MMPA 2VPPA 4HLDA 1XPUA 2C04A 1NKSA 2OAP1 1M7BA 2BOVA 2IYTA 2KE5A 4K81B 3TQCA 3ZZ0A 1T8UA 2ZRMA 2F1HA 4H1UA 3EX7C 3RC3A 1T4GA 2J0SA 2CHGA 3CF6R 2R6FA 4IJMA 3B1YA 4DLUA 4DSOA 1E32A 4DCVA 3V4RA 3GQBA 2VP0A 3C16C 4WXRA 2ZAMA 5IDVA 3VHXA 4AYXA 3IBGA 4PO8A 3RNLA 4NPHA 4LYJA 2I1VB 2VLIA 1RYHA 3K9HA 2ERXA 3P20A 3KXKA 4B3BA 4ZDKA 4GRAA 1CR1A 2IXEA 5AUQA 2OLJA 1X8JA 4JVSB 3IGFA 3IIKA 1PZNA 3BBPA 2F9MA 2A9KA 3B2EA 3BJIC 3KDSE 2OFOA 4A9AA 5JCPA 4MUBA 4C0SA 2EU8A 1W7AA 5SZJA 2RGDA 2W6JD 3B9QA 3HJNA 5C18A 3U6BA 3KQHA 2I3BA 2QTHA 1G1MA 4B3XA 2JASA 2HLDA 2QE7A 3I3SR 4OK5A 3CRMA 2VO1A 5KUTA 2PX0A 2ZS8A 4B2PA 4F4CA 2P6NA 3F8TA 4NCIA 5KO2A 2BEJA 3A8TA 4TL7A 3AVYA 1EFUA 4URXR 3X1DA 2OAQ1 3T34A 1CJVC 1VECA 1FP6A 2WWHA 3T15A 5LBIA 5FL7D 3VR2A 4PPFA 1ZIOA 4U7DA 4LV6A 4LJAA 1E9AA 1MV5A 3CNOA 3ND8A
chains in the Genus database with same CATH superfamily
4UEOA 4XB2A 1ZRMA 1RPTA 4CIAA 1SBTA 4RTKA 3HXPA 3SFZA 3COSA 1BJKA 2DUJA 1V43A 4L4SA 2G1UA 4AZ0B 5CLLA 4P4UA 3IAS1 1IPFA 4GZLA 4IHAA 1AV7A 4HH4A 1GWNA 2CLLB 3F8SA 1QIKA 4OIMA 4ZEWA 3KTAB 4D0SA 3VU3A 5MN5A 1GQRA 3EEQA 1OBVA 2C4VA 1AT1A 5L3RA 1I51A 1KK3A 3JQDA 3RVJA 3D5EA 2N3ZA 2GA9A 3C3CA 3FMGA 5BUQA 3VSDA 4I55F 4GE3A 5F98A 1N7JA 1HG0A 4OJQA 1N2CA 3BWXA 1TKBA 2LGJA 1OXMA 2Q3JA 4WCDA 5H3LA 3DUFA 4ZCTA 2C2OA 2D62A 5F4ZA 3PVSA 1CUDA 3CA8A 2PMWB 3WL8A 4L57A 4CFSA 1PWXA 4LTDA 3HNOA 3N2KB 3QW4B 3KUDA 4GXRA 3GUYA 1M34E 1WXGA 2PTHA 1NIJA 1QC5A 3GFTA 3L0OA 4GPD1 1U8FO 3MLBA 4XTCS 4G1BA 3REOA 3VJKA 2EJBA 2LKCA 1JNYA 4UM9D 3ZHTA 5AM3A 3ACCA 2XECA 4HTAA 3WAKA 4DIKA 4UE6A 4OHZA 3OTGA 2D1RA 2QRJA 1LX6A 4Z4GA 2HF9A 3L2OB 2BF4A 5AHOA 2QN6A 4E6EA 1UIMA 1K06A 2IEYA 3Q7IA 4LGVA 2HNAA 5E3IA 3PWTA 4DDWA 3OPMA 3ECAA 1VRWA 5IAAA 5CCEA 1ZD4A 2QX7A 3FDFA 1SR8A 3DF9A 4KKXB 1FXWA 2REXB 4G1CA 3N0WA 1ULZA 3FNQA 3H5AA 2YVQA 4D0NA 1BWPA 2QTCA 3GDWA 1R0XA 3OKFA 1G20A 1JIIA 2BI8A 2QRPA 4WH0A 1YZKA 2PL1A 2GAJA 4WZZA 1GXSB 1GZDA 4ZK2A 5LLTA 2O7QA 4ZU3A 4O8CA 5FPQA 2I91A 1EXDA 4IX9A 4KI0A 3VHXB 2CV0A 2O8DA 3K73O 5CVJA 3RSZA 1GKKA 1IY8A 3PIRA 2W8BA 3KQTA 1SZPA 5KKAA 3TGPA 1JVSA 2FOLA 1QO7A 3KKMA 4DLLA 3MT0A 1LI5A 1UMDB 1CEXA 3DQZA 3SYMA 4LZNA 4Q24A 1RQLA 3DBVO 2C03A 4DBLC 3AV3A 1ZVJA 4NYMQ 3LXRA 3TKYA 3RC7A 1A9XB 1F8YA 2P1RA 4Q47A 3ZS8A 1T9GS 1DG1G 1JIJA 1H4VB 2W71A 3DWFA 5HK8A 3TQSA 2IE8A 5DNWA 1AOXA 1MOSA 2Q3LA 3HB0A 1XKQA 2CHQA 1GIAA 4LN1A 5CU7A 2WIDA 4E32A 3MPUA 4WN9B 2CDNA 2JRLA 5BSGA 1HXHA 1CB0A 3QUTA 4I14A 5LB4A 2V96A 3AEKB 4BLSA 3BDVA 3HCDA 3FTEA 3FOAA 5T3YA 5NULA 2Q4RA 2JIRA 2AKYA 5AI5A 3BRCA 1FUKA 4N7JA 2G4LA 1S01A 2XYPA 4MAFA 3GZ4A 1NFRA 2DTXA 4PYMA 4AICA 1CQIA 4J4TA 5HM6A 4PC7A 1JNXX 5BQ5A 5T64A 2IUUA 4A0SA 1RTTA 1Y6ZA 5CJ2A 4HZIA 4R3WA 5GONA 2JL1A 3SNHA 4TTTS 3H3JA 4QG3A 3T52A 4ENTA 5KTPA 1DQYA 2V98A 2XX3A 3C6BA 3FYTA 4Y6QA 5L8VA 1FUUA 4FONA 4M0UA 2OGUA 4A8TA 2GK4A 4RKEA 5JSYA 3OQHA 2C7QA 3RIXA 2VG8A 3D7RA 2FLVA 4XVRA 4TS1A 1KU0A 3HKBA 4PCVA 4YIKA 5AIAA 2WNSA 1ODTC 3U60B 3OAAA 3I5UA 4JQYA 4MW0A 5EAIA 4AS2A 4LHVA 5KTOA 3F98A 4PG4A 3ZCSA 3AFOA 5IXYA 1XN1A 2G3YA 2Y8EA 5DBHX 1H9BA 3L0SA 5EKUA 3GEBA 4AUEA 1YL6A 5K0TA 4FE7A 4JYBA 2QAGB 1XYYA 2YYYA 2EDAA 5DTMA 5A3VA 4AJ9A 2AE2A 1I7LA 1HETA 1QIMA 3QTTA 1UDRA 1Y8CA 1A4RA 5JC1A 4K2AA 2JHFA 2IA5A 1K86A 1R18A 2Q29A 2V97A 3IV7A 3QBEA 2DUMA 4RWZA 4GG1A 3TLCA 1X70A 4JQCA 5BQXA 1MC8A 2VPTA 2ZBRA 3OWHA 3NAZA 4H7EA 4QPPA 5M04A 2CLFB 3NHPA 1SK9A 2P9JA 4QQNA 1KQOA 2VZLA 2Q5IA 3CN9A 3HJAA 5ANRB 4IAOA 4KIWA 4X1KB 3GVPA 4CCWA 4ERNA 1T9DA 3G0GA 3VZDA 2CCGA 2IZZA 4CLOB 4UEJA 3R8FA 3GEDA 4PXSA 4B6QA 1QP7A 3GZNB 2ISQA 4B4UA 3B51X 2A5DA 1BQ3A 4RK5A 4OGKA 2PMKA 4B82A 2FMXA 1IZ7A 5ICFA 2NYAA 3K9FC 2JIOA 4IICA 2N1BA 1S6YA 1OWNA 3FPLA 2O8VA 2D5BA 1P4AA 5KTNA 1UOEA 5DTIA 4Q4HB 4DCGA 5FUWA 5F1KA 5AW7A 5ADHA 3FRHA 1ADBA 4PNPA 3O3CA 5HUHA 4O33A 3EJ6A 1R6DA 4JXJA 3ZY6A 4RTJA 4DCOA 3CYFA 1BRTA 2D0DA 1R27A 2V45A 2WJ4A 4PSCA 1FQOA 4Z4EA 3O38A 4X95A 1P73A 2P4UA 4NJMA 1GRCA 3M5DA 3QE3A 4KAFA 5G40A 3SOPA 1JFTA 2H31A 1J23A 4GX1A 1KZ7B 3VMMA 5FTJA 3RC9A 1J39A 3L49A 4EHNA 4ABTA 1L5YA 2X15A 4D42A 4FKZA 1OC2A 5GINE 1HDRA 1GDDA 2EZ9A 5L40A 2HZBA 2E4XA 2X41A 1AVTA 1DAFA 1GSAA 2GYUA 3NHYA 3Q7EA 4LYHA 3TPFA 2C8LA 3BB4A 4NOLA 1IN4A 4OIFA 5IN5A 1P5FA 4XQCA 2PJDA 3NCHA 2YBEA 2V4MA 3PS9A 5SYMA 4DF3A 4KDFA 5DPMA 2P8JA 1WZEA 4DR5B 1V71A 4LRSB 5DM0A 1FJ2A 3AI1A 1KC3A 1G3UA 3CNQS 2PKCA 3GRZA 2JD1A 4FYMA 4IYJA 4RJTA 5IZCA 2QV7A 1PE0A 3CF4A 3A1EA 3WSWA 2I7TA 3HKBB 3LECA 1XZLA 4KOAA 2ZROA 3AX6A 2HLNA 1NV8A 2G72A 2LDXA 3BD8A 5DWDA 3MRVA 2R4TA 2QZJA 3H3XA 4UXIA 2ZYAA 3FDZA 3NO4A 3M89A 3OCYA 1COZA 3PIDA 3SU8A 1L4HA 1YI8A 4OUDA 4Q9HA 2AF4C 2BBOA 2NU9A 2XCUA 1SUPA 1BD4A 3E05A 3PXCX 1SVKA 1TCUA 3QU5A 5GJCA 4EM6A 4TTJA 3WY9A 4DGQA 3KIPA 3QW2A 5AJTA 1N8KA 2H11A 1CQZA 1LJLA 2Q6VA 3U1VA 1AQIA 3W1EA 1GP2A 4P0PB 4LF5B 4WXMA 3U3ZA 3QGMA 3P9ZA 2NSYA 5HCUA 5KNDH 4JNCA 1ENPA 2IFTA 3G2KA 3WP0A 3U2QA 4BO5A 3GC6A 1B8OA 4F4JA 2PSEA 4YAFA 5CFMA 2XDWA 2XMPA 1NMEA 4BLQA 4XRGA 5FBLB 2V9ZA 3JASB 4MLPA 4B84A 4A16A 1VLHA 1US8A 1RIIA 3D0QA 2WF8A 4KE8A 2GETA 2VUUA 2WDPA 3ZDZB 4BOYA 1EBUA 2HO4A 3BB1A 4H3KB 4E31A 1PS0A 1OKKA 4IDQA 4RL6A 4F8EA 3QVXA 3QPBA 4BO3A 3EPLA 3OJLA 1YA6A 1PK7A 3VX3A 1AZSC 5IUNC 1MIOB 3WWEA 3OPXA 3QPUA 4D80A 3FCYA 4D74A 4F6CA 4JI7B 4B8ZA 4EHLA 5CM2Z 4QASA 1NVTA 1BHO1 4AZWA 2UYHA 4KQFA 5ESDA 4EB6B 2IX9A 5COQA 2VPXA 4FDMA 4YAOA 2Q3EA 4INAA 2O8BB 3AEUA 4GZ3A 2G0TA 1O77A 2C3PA 3K0AA 1DRVA 1E4YA 2WTXA 1XD8A 4OHMA 4CZ2A 5K0ZA 2UXBB 2B8TA 4EVSA 3PQ3A 3IDZA 6LDHA 3QFRA 2A1IA 2FW8A 2YWFA 3GELA 4PSAA 4Q1BA 3ZV5A 4IL5A 4RM2A 1MO6A 1PL8A 2MSLA 1BDHA 2BKUA 4QECA 3VU8A 3HBMA 2HA5A 4D9IA 4G9EA 4M0DA 4ZJZA 2YICA 1B0UA 1PWZA 2QUBA 3CLKA 2A0XA 3R4VA 1EDZA 2PIDA 3AK4A 3B12A 3F1KA 4MZDA 3N76A 4NNPA 1OFIA 4X45A 1CJKC 1I7NA 5CA1B 5CITA 3RVKA 1C8KA 3LSTA 4FNAA 4XWKA 1V5GA 2YC2C 5ERYA 4L7QA 2HGSA 1GARA 1JP7A 3CE9A 5ARDA 3TTSA 3AL2A 1ACJA 4QLBA 4YHHB 2RBKA 3P1JA 2I6FA 4LF4B 1OE0A 3EOAI 4LISA 3MWDA 4WIAA 1TYDE 3KHKA 2WU8A 1RWXA 5E2AA 5L3ZA 3AXTA 3K94A 1EP1B 3ROXA 4MVJI 2R751 4NYJR 5JH7F 3S2GA 1EXNA 1M83A 5KNBH 5AW5A 2Q41A 4DVGA 3N75A 5EHQA 3DULA 4DWWA 1CZOA 1ZQ9A 3RIMA 1F2UA 1WQ1R 1X7ZB 2ZTLA 2X8BA 4J90A 2BR3A 3L6UA 4QRIA 3ZCRA 2MYNA 1RYEA 4N01A 5FX2A 5KUTA 3WI7A 1VQ1A 3K8YA 1IG3A 1VKZA 4UMDA 2F48A 4WCFB 1G4AE 2BH9A 2R66A 4KO3S 4XQEA 3S28A 5KJFA 5KU1A 2JK0A 4IW3B 4D3YA 3B5EA 2DEUA 2Q1WA 1Y4UA 2MJLA 3CURA 3M2PA 1ZUHA 4K9SA 1OZHA 1P62B 2P77A 4DMKA 2QVYX 4LY6A 4UNIA 5HSGA 1LPNA 4S24A 2IXAA 1SVUA 3LMKA 3HA5A 4GWLA 5EJ8A 3RU9A 1Z5UA 1U98A 3GO4A 3LOQA 3NAQA 4I5EA 1VLMA 1IQPA 1ZA2A 4O0LA 1D1SA 3QTBA 1T2VA 2GAOA 3F5QA 4G89A 4V0RA 4DUPA 3HA2A 4RS3A 1FLAA 2ZYVX 1E60A 2ZTMA 2P78A 3FDZB 2QE6A 4MI9A 3HO8A 3QVLA 1HL7A 1Z36A 4KGZA 4LDJA 4W7SA 3VSBA 5AJYA 2YCLA 4QQKA 4I81A 3NONA 4IBOA 2I4MA 3EQ8A 1QHFA 4O08A 2JIQA 2AZTA 3ZKWB 3QWHA 1JQJC 2P1ZA 3M49A 3A6FA 2B94A 2GWRA 5F9HA 1N6KA 2CNWD 3WGQA 4B9AA 3WSVA 3SI7A 3W2IA 1YDWA 3TQFA 2H3EA 1QO0D 2E6UX 2H2WA 2WYVA 3COWA 3GP3A 4POAA 2C5LA 4ABYA 4F9TA 4EW2A 1J4AA 3G2QA 5JVDB 2EF1A 3MD0A 4XFJA 2CDCA 1CUZA 4CMIB 4DSUA 3QBVA 3HB5X 2SCUB 4Q7MB 3A6LA 4G1EB 3FAZA 3P9QA 4LJ5A 2WNIA 4U8GA 4CG3A 1JI0A 4UMFA 3O6VA 2WIKA 1RSZA 4ONEA 2RHMA 3L7OA 4BFLA 3ABOB 4BAUA 1AKVA 1OXXK 3BRWD 3K0BA 1LLFA 4U4AA 5K0SA 3IAXA 4AJ2A 1OU4A 1ZS9A 1N9KA 4DMCA 1P0MA 3NDIA 1U99A 5AXCA 1WP4A 4EKYA 1UBNA 2MYUA 3I2JA 4EDFA 1KJ8A 2PAAA 4N7MA 4YB8A 5D1NA 1XMOB 3MWEA 2J3LA 1KOLA 1QR6A 3L3BA 3PU6A 4D25A 5CDFA 2QTBA 2V6MA 3NT4A 4H18A 1PKXA 1P3DA 4KMSA 1MJGA 3ISVA 3T0FA 4RA6B 1CY7A 1Z0KA 3GD5A 4R3UC 3QSYA 1GVHA 3HCAA 4BLWA 4IJQA 2IY9A 3C3YA 5SY4A 1PT8A 1V8PA 4KH1A 5K8IA 3A2MA 5I45A 4X54A 2CYAA 5C3UA 1QIGA 4W1PA 2F8SA 1WDMA 3AQ4A 1K08A 5IF9A 4ATNA 5I4CA 1RLUA 3IIJA 2CZCA 3PQ2A 1OGJA 2YFQA 4K9PA 4KXFB 4NBTA 1G38A 3K70B 2M1ZA 2W6JA 1JLRA 2ZSUA 4JKIA 3P2YA 3UFXA 621PA 4O8ZA 2GN9A 3S8EA 4NDZA 1GYQA 5AESA 1G59A 1AO3A 3D8HA 2AR0A 2N47A 2NSDA 1XNJA 2BFBB 3HVUA 1PTJC 1NW6A 2FLKA 2I80A 3HCPA 4E5SA 5HRCA 2BHTA 4YRBA 2YWRA 3M81A 3NTVA 4A2CA 3O8DA 3T3DA 3QMVA 1W59A 3U80A 5IBQA 4EMUA 2VJOA 1UBGA 1LZKA 3DA8A 3OE7A 1U8TA 2AC2A 3CO0S 4OAPA 2Z98A 3O74A 2L2QA 5DM60 4D5EA 3T1HB 1XDUA 4I1RA 1P1CA 2WAOA 4KP7A 4YJ2F 2Y27A 3PRYA 2AG8A 4M49A 1GILA 5M3BA 4DLPA 3B82A 4NBRA 4ZVTA 3BWMA 4QBGB 1UJCA 3OCVA 4CV3A 4AC9A 3OZTA 1U3TA 3U6KA 1IBKB 3DQQA 2R8BA 3K1JA 1K92A 1EVEA 1QPGA 3RS4A 4FLFA 1LLCA 4WLOA 4CR7A 3ILVA 3NTOA 2CLDX 1M2FA 3BF7A 4UBMA 2FH5B 2C2XA 3VO1A 5F21A 4HWSA 1F2TA 1OIVA 3WGYA 1KEZA 3K5HA 2WM2A 1AMNA 2RGBA 1JH9A 2DFTA 2GXSA 1KEWA 2WJZB 3DC7A 3KR0A 3JSAA 1R0SA 3PDHA 2NT3A 3DCYA 4FVTA 4TM8A 3UW3A 2NU6B 1Y6QA 3IIEA 3AM4A 3H19A 4WK4B 4MP6A 3CEJA 1P1KA 2VWPA 1CVLA 2V7PA 4LF9B 3FSRA 2CVPA 2JGMA 5A9SA 3FWHA 2PIAA 1OY1A 2CJFA 3ZWCA 1XB2A 4HDSB 2FRDC 2WA2A 3VU9A 3R0XA 5AM2A 1ZNXA 3C8DA 3GLFE 2I76A 5E7IA 1U7DA 5U1PA 1I2ZA 3U3XA 4PC3A 1Y5RA 3A9TA 5LMCA 2OB2A 2JHCA 3L4SO 4MVJG 3DEFA 3H4VA 3OF2A 4NE7A 1MXFA 3ZK9A 1ITZA 3D81A 5L51A 3U0VA 3ZHOA 3FWKA 1WBBA 1NGSA 5ALJA 5IBRA 5K09A 1C0EA 2AQ8A 4PLTA 2RGWA 3RRNA 3GY0A 3AEXA 2GPWA 1A2QA 4ER6A 2UXCB 1NRXA 4XPIB 2HHHB 1JQ5A 2H7XA 1T3HA 5ICGA 4K0RA 2OZEA 4TV9A 1KAQA 2OGTA 2CXNA 4WPGA 3AR5A 4BKPA 5IJ9B 3U3DA 4HSEA 2WG2A 2R48A 2DT5A 3OVMA 1KS9A 1Z28A 3L0DA 1ZH8A 2XIQA 3QPVA 2OK8A 4FEAA 1JB1A 2VP2A 4KN6A 3HJCA 3BGIA 2WJAA 2W8BB 3GPIA 5CX1A 5FJJA 1YXMA 2PBRA 3O31A 3UK2A 2CCJA 5CMLA 5I47A 4WZBE 5B4UA 1J8VA 3HHEA 1FIUA 4ND3A 3ZWQA 1ML4A 2RB5A 1O89A 3KYDA 4OGLA 1M5TA 1Z8DA 2XB8A 5T4EA 4D9JA 2IBSA 1JVBA 2BV3A 4TL9A 1NU6A 4FWTA 3CVXA 2EYQA 2RC6A 2HFJA 3WHLA 3NBKA 1W0JD 2ZIEA 3BMQB 4BIIA 2IWHA 3C3JA 1O0SA 5LLSA 2XMGA 1MX5A 4X8MA 4F96A 4X20B 3WIEA 5JXHA 3IT0A 4B0OA 4UTOA 2TECE 1IL0A 2PNJA 4MVYA 3RV4A 4EGFA 4OKIA 2X2PA 3EQ2A 3ZE8A 5LVAA 1KYVA 2YN2A 3TX2A 2E5LB 2YW2A 3VR6H 4JK3A 4BU0A 4H17A 4ZZ3A 4KYTA 4R41A 1A5TA 4K3VA 3Q3IA 4TKZA 2I33A 2VSOA 1Y48E 5JYDA 1ZXBA 3K7EA 4V02A 2V4UA 3S27A 4QJ3A 5FWYA 1AS3A 4AI6A 4CYMA 2B4QA 4B3RB 2J6HA 2CZQA 2PL3A 2BRUC 4XLLA 1OFVA 1XWWA 3KVYA 4J94A 2OXIA 1HEYA 4HZUA 2C7PA 2BGWA 2Z2KA 5CYOA 1KY3A 4PLPA 3KD3A 3H99A 4XIIA 3HUFA 3T5PA 3VNRA 4CEJA 3H9GA 4N3AA 5B2EA 1NNUA 3G0HA 1I2MA 5JSKA 2IUYA 2H18A 3PA6A 1JFRA 2JVIA 3I12A 1B6RA 1FS6A 3GAFA 3O73A 3SOZA 1EHCA 4AG5A 5KJ6A 2ZJ0A 5TQ2B 2JGKA 3RJMA 3A4YA 3JZMA 1TTTA 3OJEA 1EP9A 4PX5A 4LXIA 2DX7A 4KYUA 3DXXA 2RHCA 1WPGA 2OZPA 2C20A 1ETUA 4G24A 1O0BA 4JJKA 5C51B 3RRFA 5CVDA 4UD6A 3DLPX 3IVXA 1ZIPA 4I1SA 3UMGA 3A28A 1NZDA 1SNYA 4N6NA 3RRJA 3STYA 4NMLA 1NPDA 2I65A 4BGEA 1BHSA 3VTZA 4S2UA 1N2XA 3O1IC 3HZHA 2C5BA 1K97A 1CRWG 4C7MA 2P3OA 5FR1A 1SUBA 2ZJOA 1QZUA 2F55A 2HLDD 4BQRA 4IKOA 4N7BA 3LCVB 4RETA 3P32A 4RPJA 2PKWA 4JLPA 2BMJA 3NEYA 3GGSA 2HMYB 2V6IA 5AVSA 3LQKA 5CLFA 1I4LD 3D8BA 2O8EA 3PUIA 1WY5A 1ZK3A 3GG2A 3IJRA 4FX5A 1VLVA 2AMLA 1NE7A 2B36A 5DHAA 5FBVB 3SC2A 2DETA 1YBMA 5FUYA 2GBIA 2ILTA 3TOCA 4A0GA 2FHPA 3CJRA 1GOTA 2JLSA 2GCOA 2Y0PA 1QJCA 1IAQA 2F43B 4RYLA 3OIGA 4JV5B 4X1IA 1GUDA 2A4KA 1ISFA 1BU5A 3NTLA 2RAPA 1UP7A 5HIAA 4RKQA 1H5UA 2J5KA 5AM5A 2OCPA 4R1QA 5ALFA 3EQ6A 2X0IA 1CQXA 1DAMA 3E1SA 2X19A 4OQXA 4Q4JB 4MV6A 1EDOA 5BSWA 3GMDA 1II9A 3RYIB 4CL0A 2A7XA 5DSZA 1R2QA 3NBYC 4G6ZA 4M60A 3UK7A 1FSGA 3AYZB 3PNKA 3DTTA 3Q3GE 4URHA 1H66A 2H1CA 1PT6A 3KOMA 4DSAA 1CF2O 2B9EA 2BEVB 3C0KA 3H18A 3Q4GA 1UJ4A 4PYNA 4BNFA 4D43A 2EXXA 2EIHA 2QIOA 1TF2A 3TIFA 4B83A 1E9EA 1M73E 2QZSA 3H5OA 1SBYA 1N7IA 2GZ1A 2VZ0A 1FSZA 5BWMA 2RH4A 2NO6A 4MW7A 4E09A 3EQZA 1DQZA 4NBVA 4D99A 3GJ7A 4ZAXA 3SZUA 5B7GA 2JFHA 1P4SA 3S44A 3R7WA 1XDZA 5JW6A 5K0EA 3X2EA 3G8AA 3E27A 3NWBA 5C2JB 4PYLA 5KBYA 4YV7A 3UB2A 4DR6B 1KEPA 4M2LA 4DQDA 5IDXA 2AXQA 4JEMA 4YAIA 3NV7A 2HFKA 1J2RA 4MW2A 2NQ2C 2OHFA 2CWDA 4MHSA 3NM6B 5BV7A 2HSGA 4LHSA 2YC4C 4XX0A 3HJRA 3S2EA 5KYXB 1QHYA 3W5BA 1XRPA 4HLUC 4KQMA 4MR9B 2QDKA 3LF1A 4RCZA 1PV1A 2G5GX 3C85A 5HTOA 1JALA 2QPOA 4FMDF 5IS2A 4KQIA 1R15A 2JGEA 4D6YA 1CRLA 2V54A 3EAGA 5CNMA 4B3DA 3WGMA 3WQQA 3IXQA 3L46A 3N2KA 2O48X 3R6LA 2XPCA 1Z8NA 1NSYA 4JT2A 3OQ1A 2PYIA 4KIJA 3DZGA 4E15A 2XUIA 3O26A 1U94A 4A6XA 3RSLA 5EP2A 1EGMB 4C6TB 3MTEA 1FMLA 5FWAA 3D4NA 5F4BA 3MMXA 3N6RA 3UAWA 3ZDQA 2HK6A 2WJWA 1YS2X 4IZIA 4MWBA 4YQYA 2IIPA 2EIXA 3G2LA 4IF6A 5G0VA 4BPBA 5K45A 3AVVA 3GHHA 4JUCA 3EG9B 1VL1A 521PA 5IAKA 4ZXFA 3V7FA 5EUMA 2J5BA 3IXMA 1YKSA 2WMOB 3KPYA 1VG9B 1YVDA 2J67A 2DR3A 5EA2A 1KMHB 2BGJA 2FWPA 4Y7DA 3D2LA 3GXBA 5EP4A 3TSWA 4JYCA 1P2DA 3EF3A 5KVVA 4FR2A 1R66A 4JP8A 4L3WA 5LJIA 1IXRC 3QX7A 2ZRCA 3DWEX 5ESRA 4YRCA 3ZVNA 2VHYA 2YMMA 3HP7A 5D85A 3SQOA 2UUAB 4N5NA 4R2HA 2IBTA 2PBZA 4C3UA 2H52A 2OO5C 3JWHA 4LZWA 2QZ4A 4INPA 5BV8A 1A50B 1U0JA 3CEHA 1GPKA 5AVWA 1J5PA 2JGDA 2GM4A 1AKEA 5CA1A 2CDBA 3BF8A 1A8PA 3NHMA 2NQTA 3D3WB 1HE2A 1OU0A 2ZITA 3OEED 1TCBA 5E4TA 3RTBA 3TLYA 4EA8A 4BFUA 4FE4A 4O5OA 4A82A 3RWOA 1TYCA 2A9QA 4WOKA 3EHEA 4BUCA 3JX9A 1JJAA 1Z6YA 4EO4A 1S3SA 4GH5A 5LZ7A 1G9TA 3ESXA 2QENA 3IQIX 3JARA 3GPLA 4QAQA 1M2VB 1VHJA 3AKYA 3RHFA 1FP1D 3EFOB 1Q2XA 2WY2D 4CV0A 4M46A 4V38A 2R60A 1WXIA 3RSFA 3AEUB 3D7KA 4FSDA 4GMDA 5DYYA 4M1ZA 4YRKA 2C7BA 2EQ5A 1Q1EA 5AP9A 4B79A 4MI1A 4IWYA 2BRUA 4RPGA 4ZRDA 5HF6A 4EEZA 1T13A 1CCWA 4NBWA 1YFKA 3SIPA 3TKAA 5E7JA 1UK6A 3MB5A 4MGZR 4X97A 1F8XA 4P83A 5DGDA 5BT9A 4CM6A 4FFWA 4DE5A 4EY3A 3TL3A 1X3LA 3IMCA 4GPZA 1R12A 4UQPA 1F38A 3UC5A 4D79A 1PRYA 1NN0A 1U1FA 1WUTA 3F67A 4J0JA 3VR0A 4HNTA 1U6KA 2G8NA 2H0AA 1E1MA 1KOFA 3ASYA 5JXWA 1E6CA 2IZ6A 5IZCC 1GG8A 2M9MA 2I87A 3LUGA 4HNGA 5FBZA 4Y2SA 1CY6A 3WS7A 1UJBA 4BN0A 2IZ1A 1F1BA 4IHJA 4RJLA 5IJAA 4EATA 1VHLA 2H0RA 3MC1A 4FQ7A 2NNWB 4QBHA 2X4LA 4NULA 4ALNA 1JE0A 4K7JA 2WSSA 3IQZA 2XNDD 1J0XO 2QP3A 4Z2YA 4HRAA 3M4JA 3S6JA 3O1LA 2YIJA 3LUDA 4X0EA 3U4HA 4DLNA 2CBZA 3DKVA 2AF3C 3D8UA 3ELYA 4P54A 4D92A 1NVUQ 3EFHA 4BBJA 1VJ0A 2VH2A 2WTUA 1ECGA 4CIXA 2DWOA 1K3FA 4NFHA 4UMEA 5IABA 3K71B 4O2AA 2EF0A 3B9BA 3KL2A 3TLGA 3PPVA 4HS9A 1DAKA 4C5CA 4TTVA 5JS1A 1WZCA 1UANA 3B6EA 2NPIA 1SUWA 1UC8A 1WUKS 3K2BA 5LC1A 1UMKA 1V47A 5DX8A 5JWHA 1KPIA 3V1LA 2DOKA 4OG2A 1KE1A 3STUA 1O97D 3NLLA 2I2FA 4ZYXA 4DA6A 4MUHA 1LUAA 4YMGA 3LOPA 3PF9A 2AUNA 2GBLC 4IUCS 5CLIA 4C2TA 3DV0B 3TNJA 3NKFA 2AMVA 5JDCC 5FF9A 4LGMA 1P9RA 3E1GA 2BC9A 4P33A 2OCAA 3C3PA 3EXHC 1CF9A 3W7AA 3VZPA 1IPEA 2PH7A 2IHKA 3OHMA 2E21A 3GJ0A 1UBKS 3LJKA 2CD7A 3MJSA 1DBRA 1UQRA 2V0GA 2XSZA 5C8YB 1AF4A 3DTVD 5DCUA 2QBYA 3ZDFA 2XOEA 2BD0A 4J0KA 1H2ZA 1I24A 2FW9A 4QDOA 3D4PA 4P0QB 2FKNA 4JA0A 5JTUA 1NW9B 4IGKA 2EKLA 2O54A 2VDKB 2AA3A 1K6EA 1PN3A 4P4NA 3ZZTA 4DLSA 3N86A 4MITA 2EBWA 4EHDA 5B64A 3DL4A 1YR8A 4DCPA 2GFHA 4PG7A 2X0JA 4EG0A 3G49A 5H9WA 4ARCA 3R3JA 3E4CA 5JEEA 5JNLA 4MUYA 3H2JA 1Y3IA 2BBTA 2PR7A 3LZDA 5K0NA 5H5JA 1JSCA 3UN1A 4DPMA 1E8NA 5HK9A 4C07A 4IZ6A 1VLQA 1XP8A 1MGPA 4NJMB 3BTOA 2OQRA 1FQKA 1HQYE 1YRQA 2GF2A 4LC1A 4QFMA 5DNEA 1JHRA 3KQSA 3O9VA 3JD0A 1KVTA 1W0KD 3QU4A 4ISBA 5J5VA 3U09A 1B23P 1J2EA 1MIHA 3Q2IA 1U2SA 5KMGA 4XM0A 3Q9NA 3PDIA 4IEFB 3T99A 1J8DA 4FKMA 5DTJA 3PFKA 4EUFA 3C6QA 2QAIA 4KUEA 1EFDN 1NR7A 1VI2A 3LS2A 5DI3A 4IWXA 5B1YA 1IG0A 4NCKA 4AP5A 2PMCA 4UM7A 3PGMA 4HTFA 3H3FA 1SQ5A 1SXJB 3SX0A 3T7JA 4DRYA 4G0MA 3G7SA 4OLFA 3N2NA 3OX1A 4HLNA 1NQ5A 3E7WA 3T5DA 4X7RA 3X1ZA 4X66B 2SECE 1J99A 2CE7A 1RLJA 4XGRA 3SY8A 3LT1A 3P2JA 5AVOA 1TUBB 4NMWA 3T9AA 2FE4A 2XRZA 1WR8A 3P9RA 3O82A 4GXQA 4YUAA 3HACA 1RZRA 4FJ2A 2MINB 3GAZA 3JWIA 4P7KA 2HQOA 3U44A 3NM4A 4JB2A 2HNBA 4DCSA 4BP3A 1Z6ZA 1QIDA 2O1EA 2OYRA 1BS9A 5U4QA 2YVLA 5EESA 4UPVA 5C8VA 2AIRA 5HNKA 4QYTA 3JR3A 5JROA 2G0AA 3IT1A 1EB9A 4LJLA 1DUVG 2EJVA 2PRZA 2YXDA 4PLGA 5H81A 5GTDA 1S8FA 1HKUA 3S29A 3JALB 2CFIA 2FSSA 4J0GA 1XL1A 3DZHA 3UWDA 1PQ4A 2BGRA 5KINB 1K5DA 1NP6A 3NPAA 1J22A 1Z0DA 5AKIA 1HLGA 1U7WA 1XAJA 2X0EA 1FW6A 2C2YA 1YBFA 1DMSA 1K7CA 3PLNA 2O59A 2FQXA 4FGJA 5K0CA 4JXZA 2KSQA 4G85A 4JJIA 2E1RA 4HSGA 3RVNA 1DIGA 5EERA 3T9FA 3O75A 1GZSA 3MWKA 2A5JA 3A14A 3EVZA 1DDOA 1XQWA 2HU2A 3DZDA 1E58A 4NP6A 2QSZA 2X4GA 2W4QA 3VV2A 1V1MB 4ALLA 4CMKA 1J49A 3DAYA 2V5VA 3BTSA 2GPYA 3W3ZB 3PHIA 4DIEA 5DBIA 4QYWA 3AP2A 4E13A 5BXQC 4JU8A 4LG1A 3V7UA 1BDBA 4BNNA 4DIDA 5MF6A 4Q4DA 4DG9A 5FLXA 4YRTA 4RGYA 2JZOA 4GEGA 1XROA 1RRGA 5TMEA 5FFMA 3DB2A 4DZTA 2VHZA 1IQRA 3E9DA 4P35A 2JBWA 4O4IA 2IYFA 1O0CA 3AVWA 1RFLA 2WYHA 4RZXA 4Z9AA 5K3OA 4BCBA 2VYQA 3R9WA 3QJ5A 4G5HA 5JD4A 3DE4X 4ZI7F 4PV7A 1ND5A 1K7SN 1UBLS 3QV1A 2BMWA 3ADKA 3AY7A 4B3HA 3ZWAA 2V7QA 4JBLA 4WNAA 1U2GA 1CZKA 3EIEA 4IEEA 5KAPA 4BYGA 3KEMA 4MQ5A 2R6ZA 5DGXA 2YVKA 3TW6A 2QJTA 3U39A 2JLVA 1THZA 1W49A 3KWMA 3OQIB 3LRPA 3N3AC 5FUBA 1C9EA 3DV0A 2QXYA 2V3WA 1Z26A 4CW7A 5HS6A 3HYTA 1UT5A 1VBNA 2G1JA 2IKSA 1ZJ5A 3BXXA 1BE0A 2QR3A 3MGGA 3W9UA 3AUJB 4LOKA 4NS4A 4BVEA 2OXCA 4CM8B 1NDUA 3DOCA 4DL9A 5HJEA 2ZJBA 1NWHA 1SCNE 1XTIA 2IT1A 4V0QA 3CNHA 3E7DA 4FGZA 2C9ZA 3AHDA 4HF7A 4ZI7B 1KZ4A 2PFGA 3F47A 1PBNA 2P9ZA 4PINA 3BXHA 1BU8A 1PCXA 3RSOA 3UV3A 1XD2A 3EH1A 4HFMA 4EY6A 5TY0A 4YJFB 4LQLA 1F0YA 1GZVA 2IPMA 1WV0A 2VT7A 1NI4B 3B38A 5EG5A 1R0WA 5TJHA 3SDSA 5EJAA 2IL1A 1SBQA 5L3SA 4D9FA 1KVRA 3LDFA 1JBEA 1JG3A 5B36A 3CG4A 4P32A 4BIMA 3CLUD 3CSSA 3K0CC 3ZYCA 4QXMA 2QN8A 1A71A 3QF7A 1OLUA 1G6HA 1ML3A 2CK3D 1XTTA 4IIJF 5CPFA 1CDZA 1Y7LA 4BTVA 5EIXA 3H97A 4ZV4A 1SUIA 2BM0A 4DLXA 1MORA 3M8KA 2FWMX 2RBGA 3MIZA 4DRXB 3HYLA 1GTSA 2GCIA 1SVLA 2ZI9A 4LRQA 3TEJA 4QTUB 4AJPA 1KO4A 4P9NA 4Y1RA 1R37A 3JXEA 5LQSA 1H65A 2CB0A 5DTRA 4PNZA 1VZ3A 2P4QA 3PD7A 2ID4A 2OGSA 3VPSA 4LSWA 5AM1A 2OFPA 2G1KA 4B4KA 4EA6A 3E3LA 1Z5ZA 4ND2A 3CVYA 4HC4A 3UXYA 4OQZA 3G6WA 3HNPA 1A3CA 2VP9A 2Y0BA 1S3IA 5EKSA 5KWIA 1X7GA 2AJLI 4IFEA 1HURA 5FNVB 5JHHB 4B3GA 1YHZA 2QVGA 1TZ2A 4BYMA 1KZ1A 4MUIA 3KAJA 3EXAA 5IM4A 3EUFA 3VTFA 3FFWA 1N6OA 2IVFA 3ZIUA 2OQIA 3A2NA 3H1AA 3L05A 2DKOA 3NHLA 2ON6A 4AKSA 3X3HA 3KHUA 1D0IA 4LBZA 5B5SA 1XCGB 1FYFA 2FDRA 4YJ3F 2FMHA 2BTQB 2ASEA 1YAJA 2D2EA 1A0OA 1HEIA 2YZGA 5I7VA 2VXYA 1SBIA 5B7PA 2I4OA 4DTIA 3QIAA 1GADO 3HFGA 1U9ZA 4D46A 4I55B 2AJCA 4DREA 5E7MA 2BZ0A 1YQGA 2I71A 2PKQO 5BY2A 1KRWA 4NMXB 1VPWA 1SBHA 2GRUA 4RNDB 4PZLA 4ASUA 1X0VA 3NHFA 5CLQA 3G1UA 1E7YA 1CB7A 4ZODA 4UULA 5ALPA 1OFHA 2FEOA 4MKGA 2R79A 4OPMA 3KR9A 4U7JA 4OHFA 4ACBA 2ZSEA 1RT9A 3CTPA 3PJRA 4X1IB 3C6MA 4A8JC 1UCFA 3RRYA 3QJYA 1Q84A 1QPBA 1WBJB 3SICE 3SX4A 1Y33E 6AT1A 2AJDA 3JQEA 3OWOA 5JH7B 3K6SB 1JHOA 4NZYA 4WTOA 1YU9A 2FR8A 2IF0A 1I5EA 2PAFA 4AN0A 4ZT2A 5CLHA 1OB2A 2M98A 3F3KA 1GPBA 2NUPB 3PNYA 2A92A 3CUKA 1SXHA 3F7OA 4ICIA 3QHQA 4K6OA 2IEDA 1XFDA 2XUZA 3DM9B 4WLNA 4BRSA 5JV5A 3HJFA 1H4TA 2BUCA 4E0BA 2EG9A 3M83A 2YHUA 4YV1A 5KYUB 3ICWA 4Q05A 2BEVA 1L7DA 2DF8A 2Y1XA 4CIDA 1MAUA 3B7WA 2PVCA 4RJIA 4X93A 5KOJA 2XEXA 3PE6A 3KYJB 2FR0A 3OPVA 4C7OB 1TJ5A 1WKBA 5IC4A 1FRZA