2AN4A

Structure of pnmt complexed with s-adenosyl-l-homocysteine and the acceptor substrate octopamine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Mode of binding of methyl acceptor substrates to the adrenaline-synthesizing enzyme phenylethanolamine N-methyltransferase: implications for catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2an4A00
4BLVA 2OPBA 1H1DA 2NNWB 3ID6C 1FPQA 3GRRA 2ZBRA 1AQJA 3G88A 3AWIA 4F84A 5E1OA 1N7IA 5HOQA 1X19A 3UJ7A 5P8WA 4MTLA 4PYMA 4PWYA 2JJQA 2AN5A 1VL5A 2YXLA 1M6EX 3BKXA 1RI5A 4KVZA 1L3CA 2E5WA 2ZCJA 4X1OA 5GP1A 2HV9A 4ATNA 5DX0A 1HMYA 3TKYA 3CJRA 2OKCA 2UZ4A 5E1MA 1MHTA 4YV0A 5C9ZA 1VLMA 3ELUA 2AZTA 3BXOA 4M7RA 3B3FA 1QAQA 2ZBPA 3DUWA 3LKZA 4XUDA 5DTMA 3NDIA 4RTRA 3BT7A 4C07A 3S68A 3L8DA 3DH0A 5EMJA 5C0OE 4FSXA 4HGYA 4E30A 4E2ZA 2VDWA 1AQIA 2HTEA 2YTZA 4HGZA 4CXMA 2ESRA 5DPMA 5DRYA 3DMHA 5GWXA 3AXTA 2V7EA 5K0LA 2AOTA 3VYWA 5LQRA 3EVFA 1INLA 5HIKA 3P2KA 4E32A 2AOUA 2H1RA 2I6GA 5K0GA 3LCCA 3LDGA 4FZVA 3EVAA 3MB5A 1XDUA 4HTFB 5CVUA 2ZTHA 3TKAA 2AR0A 3M6WA 4QTTB 4KDRA 5LSAA 2C7PA 3C6KA 3P9KA 3CJTA 1KIAA 3T7RA 5LQCA 1YB2A 2ADMA 2PX8A 1G55A 3BWCA 1F38A 1VIDA 3KPWA 3GIWA 5E2BA 3P71T 4WXHA 3A25A 2FHPA 4GBED 5FHRA 2AVDA 4C05A 3OU2A 2O05A 4R6WA 3THSA 3UJDA 2IIPA 2PXXA 3M6XA 3R3HA 3E23A 5DM4A 4DCGA 5G02A 5K05A 1JR4A 4M36A 2JH8A 4KW7A 5T64A 2ONYA 3LKDA 3NDJA 5ICEA 1NW3A 4CTJA 1PRYA 2IGTA 1SKMA 3GU3A 1T43A 5U4XA 3G7UA 5EEHA 1I9GA 3TPZA 5JR3A 1JG2A 1XCLA 4QVKA 2AN4A 3V97A 1YFJA 4OX9Y 9MHTA 2CWWA 1EAMA 1EQAA 3I53A 4R6XA 2Q41A 1ZG3A 3B7PA 3VC1A 4RTSA 3LPMA 3M6UA 1TPYA 1VP9A 3SSOA 1BOOA 3TM5A 1L3BA 2QYOA 3C3PA 1ZQ9A 4Z2YA 3PX2A 2EJUA 2OZVA 2ZIFA 2FPOA 5E9QA 4WVLA 4CTKA 2A14A 1M0EA 2JHPA 4P7GA 1FP1D 3MCTA 4UOEA 3MCZA 2IPXA 3GO4A 5HIIA 5GIPE 2AN3A 2JHAA 5LQNA 1YUBA 2ZFUA 3H2BA 1FBNA 4LG1A 3EEOA 3RW9A 5D1HA 5BXYA 2V74B 5KVAA 1NW6A 1RI3A 3M4XA 2HWKA 1EJ6A 4KDCA 4PYQA 2AOTB 5KQRA 3A7DA 1WZNA 2QM3A 3SSMA 3HNRA 1YFLA 4QPNA 4PYIA 1WXXA 3QOXA 3NVKI 10MHA 4GC9A 2GA9A 3P2EA 3B5IA 1NBIA 1HNNA 5EEGA 4CWAA 4PYOA 4HH4A 3BGIA 3GRVA 5K0NA 1RJGA 4C04A 3Q87B 4R05A 3UJ9A 1JSZA 3BWBA 4DCMA 2JH9A 4RX1A 3EVGA 3FYCA 3LSTA 1SQFA 4YMGA 3FYDA 5EKUA 4FGZA 5EKXA 3F4KA 3DLIA 4GEKA 5CCXA 1ZKDA 3MHTA 4C03A 2OB2A 1VBFA 5LQJA 5EOVA 2Z6UA 1Z3CA 4PIMA 3FRIA 3UA4A 3ANXA 1D2HA 1Q0TA 5ERGB 3WSTA 1QAMA 5DTRA 4PNEA 4ER5A 5DLYA 4RTLA 4RTMA 2IH2A 7MHTA 5DT2A 4POOA 2ZULA 1VP3A 3AJDA 3EGVA 5E8RA 5EMLA 5EIFA 5HIMA 2EFJA 3T0IA 4GC5A 5EVJA 3HCDA 4FT4A 4BLUA 1KPHA 3LBYA 3KQTA 2ZSUA 5E9WA 2PBFA 5FWDA 4DMGA 1UWVA 4RTJA 4EVIA 1RJFA 3Q7EA 3SSNA 4QDJA 3NW9A 3BZBA 4YMHA 4P7JA 3QV2A 3O7WA 1G60A 4AUKA 5DM0A 1JTFA 2PVCA 3TLJA 1YZ3A 2G1PA 2C7RA 2UYQA 3BWMA 4RTNA 3PX3A 3UJ8A 1Y8CA 2I62A 2Y1XA 4MIKA 2CMHA 3LX6A 2EJTA 3KQMA 3P9IA 4RYLA 3TM4A 2XYRA 2YX1A 3ELWA 2P3LA 3OZRA 5F2OA 3TMAA 3SXJA 4V0RA 4MHTA 2PV0A 2IFTA 3EMBA 5F2KA 5IH3A 3EEYA 5DRTA 2F8LA 2HR1A 3B3GA 2BR4A 5ICCA 5DXAA 2QY6A 3NMUF 4PGGA 3KQVA 3NTVA 5FA5A 1I1NA 5CD1A 1N7JA 1SG9A 3FPHA 3HEMA 1XJ5A 2CMGA 2PXCA 3BWYA 3KR0A 5EC8A 5EMMA 5HFJA 3I9FA 1NV8A 1RJEA 3KPJA 3HP7A 2P7HA 4GF5A 5H02A 3MGGA 5FQNA 5T67A 1P1BA 4QQNA 2GS9A 4E2WA 4RTKA 2IDJA 3CC8A 1Q0SA 2N47A 4YV1A 3SX0A 3UJBA 2P1DA 3DXZA 2UYCA 2UYOA 2WA1A 3DR5A 1KYZA 2KW5A 5DWQA 1B42A 2EG5A 1UFKA 5FCDA 4F86A 4GOLD 1JQDA 5GIOE 1EIZA 4RVHA 3OFJA 3GNLA 3P97A 2BH2A 3PLAE 1IM8A 5K0FA 3KU1A 1ZHFA 2DPMA 3G2QA 4KIGA 3RIEA 5ICGA 3G5LA 2PX5A 3CKKA 3LECA 3MTEA 3KPUA 5ICFA 5EHIA 2IDKA 1EG2A 1NBHA 2K4MA 4HTFA 5DTQA 5FWAA 2I7CA 1WXWA 1DCTA 3DOUA 4QPPA 2YQZA 3PFGA 3GGDA 1VPTA 5LQUA 1O9GA 1R00A 2B2CA 3OE4A 1NW8A 5CVVA 1KYWA 2JG3A 2PX4A 2G71A 1YF3A 8MHTA 4DA4A 3A26A 5CM2Z 5EQJB 4FT2A 1ZGAA 4HRAA 2OO3A 3UJ6A 4CKCA 5GOZA 2PXAA 3EVEA 3HCEA 3UJAA 3GRZA 3U81A 3JWGA 3MQ2A 4IV0A 3ER8A 5CVEA 2Z6AA 2XVAA 1N2XA 1BC5A 4LECA 4EMSA 4X60A 3FUUA 5GM2A 3EVZA 3KPVA 4FP9A 5E1DA 3IEIA 5HILA 1YZHA 4PCLA 5K8VA 2ZLBA 3GJYA 2AOVA 1SVUA 1XDZA 2FYTA 1R6AA 1AV6A 5K03A 4EQZA 2PT9A 2CL5A 5KYGA 1D2CA 4HSGA 3LCUA 5EZSA 2P41A 4E2XA 4PYNA 2C7QA 3LGAA 4RVDA 3O31A 2G72A 3MTIA 1KPIA 3C3YA 4XCXA 3PS9A 2NXJA 3R9XB 4A6DA 4BLWA 3CVOA 3KKZA 1QZZA 4IV8A 3JWHA 5IKMA 2BM8A 1SQGA 3FPEA 4GOMD 3SMQA 3P8ZA 4PCAA 1NT2A 2UYHA 2PGXA 3VSEA 3BUSA 3HTXA 3JWIA 3NWBA 4FS8A 4MQ4A 3TR6A 3LHDA 4C4AA 4ER7A 5DM1A 4FR0A 1NE2A 4PYLA 2BR5A 4AX8A 5EIWA 3A7EA 2XYQA 2IBTA 5K0BA 3MERA 2ZZNA 4P58A 3KQSA 2GAFA 1ZGJA 2OBFA 3FUWA 4QTUB 4AZTA 5LQKA 3FTEA 3FRHA 5E9JA 3OPNA 1JTEA 3HCBA 1KP9A 3DTNA 2HNKA 4P7FA 3I58A 2ZW9A 5K0EA 4PONA 3HVKA 2GLUA 3OZSA 1TW3A 4M37A 4OBXA 3GCZA 4AZVA 2QRVA 1DL5A 2YUIA 4X61A 4XUEA 1JG1A 2IH4A 5EMKA 3UBTA 1O54A 3OFKA 2GB4A 1RI1A 1L3IA 1BHJA 4BP1A 2YXEA 3DLCA 2G8NA 2PLWA 3FZGA 1KHHA 2G70A 5MHTA 5EGSA 2ZZMA 2P3QA 1JG3A 5BW5A 5F2NA 1RI2A 2P3OA 2R3SA 4E2YA 3THRA 4RTOA 1KXZA 5HEKA 3A4TA 3P9CA 4BY9E 2BR3A 3FTCA 3DMGA 3UWPA 3GWZA 2EX4A 1G8SA 1I4WA 3VC2A 3HCAA 4EKIA 2VS1A 3E05A 1L1EA 3KQQA 1BKYA 5GM1A 2R6ZA 5B1SA 4DKJA 3B89A 2XVMA 2ZWVA 3HM2A 3SM3A 5T6BA 2NXNA 1IY9A 3OZTA 4U7PB 5CVDA 3REOA 4DZRA 2JHCA 2B78A 2C7OA 2FRXA 1NW5A 3M6VA 4O29A 4YUYA 3AY0A 1IXKA 3FUTA 3BKWA 3HA5A 3OE5A 2Y1WA 3E8SA 4R8RA 3KQPA 4ER0A 3DULA 5K0JA 3RODA 5M5BA 4FSDA 4DQ0A 1XCJA 4DF3A 5BP7A 3EPPA 3PVCA 3DMFA 3GDHA 3ELYA 2BZGA 4U7TB 3R6TA 4HC4A 4X63A 4V0QA 1X1BA 2IP2A 4GUAA 3I64A 1JG4A 3OU6A 2PWPA 1M6YA 2YXDA 2O07A 1XDSA 2FCAA 3R0QA 1UIRA 4ISCA 4AZSA 5K09A 3ORHA 3PFHA 1EJ0A 4RWZA 3CJQA 3SVZA 2NP6A 1JQ3A 2PT6A 4L7VA 3UFBA 2XYVA 4QQKA 2PKWA 2P8JA 5E1BA 3ER9A 5FQOA 4C06A 4E33A 3HCCA 3CCFA 5FULA 5BW4A 3FUXA 3G2MA 2ERCA 3C6MA 4LWPA 3C0KA 5DM2A 3SR4A 5K01A 3G8BA 4IKPA 1QYRA 4KWCA 3HA7A 5EZQA 4CKEA 3QOWA 3G8AA 5EHGA 4E70A 4F85A 4ZTBA 1R74A 5FA8A 1X1DA 3I5UA 5E2AA 4PGHA 3LCVB 2VDVE 2ZWAA 5DX1A 2OB1A 4RTQA 4LWOA 2AOWA 3BGVA 3FTDA 4RVFA 2ZVJA 4YUVA 3EMDA 2AOUB 3LL7A 5E8JA 2WA2A 2XBMA 2VP3A 2OY0A 1TW2A 1P91A 5CIYA 1WS6A 1KPGA 5CVJA 4NECA 3IV6A 4PYKA 3KR1A 5FUBA 3IYLW 2P35A 2QE6A 3CGGA 3G2OA 4GOND 3K6RA 1AF7A 3KPYA 4OBWA 2PWYA 3SGLA 3FUVA 3PT9A 3JWJA 4ER6A 5KQSA 3TFWA 4M38A 4XUCA 4EKGA 3KHKA 4MWZA 3D2LA 3HA3A 4RTPA 1O9HA 1QAOA 5FTWA 4KRGA 5JUWA 2I9KA 1JSXA 4YUWA 3FPGA 3TOSA 4H0NA 3T7TA 2AS0A 1NW7A 3OU7A 2IBSA 3NJRA 3K0BA 4ER3A 5DXJA 3DXXA 3O4FA 2BM9A 5KS2A 3EGIA 3KQOA 4A6EA 3KR2A 3ME5A 2B25A 1VQ1A 3AXSA 2Z6QA 1XTPA 2VZ9A 3NWEA 2YVLA 4PINA 4Y2HA 5CUQA 1SUIA 3FPFA 2H11A 1DUSA 3FPJA 3DXYA 3HCFA 2PX2A 1ORIA 3EVCA 2ONZA 1L9KA 3EVBA 3LBFA 2H00A 4OA5A 5LQAA 3DP7A 1F3LA 1PJZA 2ZBQA 3LDUA 4KIFA 4QDKA 3KR9A 4X41A 3EGEA 4GQBA 3ELDA 4CKBA 1NV9A 1ORHA 2ZIEA 3P9NA 3NVMB 5DSTA 3V8VA 1NKVA 1X1AA 3TRKA 1P39A 2O57A 1RI4A 5EPEA 1XXLA 5D1NA 3PTAA 4Y30A 3KQWA 1WG8A 4PIPA 3G2PA 4EK9A 1R8YA 1RJDA 5K0CA 5LR6A 1FJXA 5FHQA 3CBGA 1R18A 4B17A 4C08A 4YV2A 3P2IA 3HVIA 2YR0A 5DX8A 2O06A 4DM3A 4G56A 4RV9A 2NXCA 4K6MA 3IHTA 2GPYA 3GXOA 1D2GA 3G89A 1OR8A 3X0DA 2NXEA 3GRUA 2QRVB 3B3JA 1G8AA 4YUXA 2ORED 2OYRA 5HIJA 5CCBA 2DULA 2ZZKA 3M70A 5DSXA 2FK8A 4IWNA 2NP7A 2OXTA 4YUZA 1VE3A 3ERCA 2VDUE 2O0LA 2PSSA 2ZIGA 4PYJA 4JXJA 4QVGA 3E7PA 3UA3A 3KQYA 5C1IA 1P1CA 3GRYA 3M33A 5EG5A 3BGDA 2LD4A 3G5TA 5FADA 4E31A 1JQEA 2PJDA 2FK7A 2B9EA 4BP3A 2IH5A 2CKDA 1X1CA 4R8SA 2GH1A 3MAGA 1FP2A 4GOOD 4AZWA 4P7KA 2NYUA 3UJCA 5HZMA 1MJFA 1R8XA 3EVDA 2WK1A 3UZUA 3FTFA 2AOXA 1XVAA 4OA8A 3PB3A 1G6Q1 3TQSA 3HVJA 1SUSA 3T7SA 4OQDA 1KR5A 1U2ZA 3LDFA 2P7IA 4RVGA 5GINE 4OQEA 3A27A 2P40A 3OCJA 3HVHA 4RSRA 1V39A 2AVNA 1G38A 3R24A 2HMYB 4HG2A 2PY6A 1QANA 2B3TA 1WY7A
chains in the Genus database with same CATH superfamily
4BLVA 3CM0A 3UWSA 5MF6A 1EFRA 4IXNA 3R7WA 4BS9A 5B55A 1TTPB 3TINA 1FFXB 1JZQA 3NNSA 4PSUA 1ELOA 3FCEA 1UBLS 2CLFB 5A3JA 1N7IA 5CNJA 4E5YA 5TDHA 2BP7A 2P6OA 4MCIA 2C4NA 3BTVA 3HBNA 2JJQA 4RPJA 1YHYA 2V7BA 1SD5A 3C5EA 3OPQA 3K96A 4FPXA 1Z7BA 2O3SA 4CDNA 2D59A 3I3OA 4HLCA 4IIBA 3WBBA 1SXJD 1ZD4A 5EVCA 3B3AA 1RT9A 1N1DA 1XRQA 1TIKA 2GD6A 5EWMB 1PV2A 3UQZA 3VZRA 1K2VN 2JJ1A 3BG5A 4GI5A 2R1TA 4E88A 2PTHA 5ES4B 5JPIA 2ZBPA 4M8SA 3V1KA 1VJ0A 5DNWA 4J1TA 5BV1A 3KZMA 3HKEB 4BNYA 2OFWA 5BN1A 3VU3A 1WXEA 4MS3A 4FSXA 4HGYA 4TTRA 2IYAA 5CT5A 1ZJZA 1KEVA 5LLDA 2G40A 3DMHA 3GWGA 1VMEA 5LQRA 3Q9LA 5FXMA 1AS3A 2ID8A 3EVFA 3JV7A 3U7QB 3FYHA 1KI7A 2I6GA 3UB2A 3WO0A 2ZZNA 1QS0B 1AHNA 4HNRA 2GYWA 3DC7A 1II9A 3TE7A 1AKQA 1MAUA 2AR0A 4GPTA 2YBDA 1UZUA 2GN0A 2ZJZA 1JE0A 4UDNA 4HWTA 3L4EA 5H82A 1G5TA 4KXYA 1VIDA 2P2DA 4Q47A 2WE8A 3V4SA 2EZ9A 2AEEA 4KBYA 5JY6A 2X3YA 4B5LA 4FEAA 2FEKA 3A0UA 4RGQA 3T4XA 1XU4A 4H2DA 4X71A 4FFSA 4IRMA 4PXAA 5C34B 2P1ZA 4S0ZA 4TTJA 2C1XA 1IK6A 2DQKA 2XR1A 3P4UA 4Q9KA 4X97A 3B82A 3QEKA 3HI4A 4CBVA 2ZDHA 3M9XA 4IXDA 4P34A 1M67A 4RDIA 4F3NA 1M0TA 2KLHA 2XZTA 2YXBA 3PRKE 2CWWA 1IUPA 3QKRA 4IGEA 1S4QA 5E7QA 1U9YA 1N9ZA 2ID7A 4HFNA 4R6XA 3LKBA 3JAKB 3VC1A 4DMUB 4JGIA 2I4IA 1C29B 3QXXA 1L7XA 1F48A 4OUDB 1ZQ9A 1KZHA 3K1ZA 4DR2B 3QTBA 4WA8A 3CNLA 3CH7A 1MC5A 2ZIFA 3BSYA 1XK6A 3KSMA 3WTCA 3K9CA 2UVQA 5K3AA 5BXQC 4B8YA 1ISGA 1FOEB 4MDYA 4K9QA 5IZCA 5LQNA 1CE8A 3KYDA 1YUBA 3BTUA 1KAHA 1UEIA 1ZRSA 4ZOAA 3ROEA 2QD4A 3S2IA 3A7DA 1YV9A 1WZNA 1XWWA 1DJNA 1ORVA 1ULUA 3BGWA 4KXMA 5B2FA 2XNSA 1GPMA 2ATCA 4TWBA 1OE0A 2VP9A 3UAWA 3UK1A 1RAHA 8GPBA 5DULA 3NHUA 1LFAA 1QV6A 4ND2A 3GLTA 5JS8A 4UUQA 4PCVA 1UKVY 1V26A 5AKIA 1REQB 1VI2A 4XYGA 4IQFA 1EYZA 4KBGA 2FY8A 5LZ9A 4MYDA 3LZ6A 4OH1A 1OMOA 2AI1A 3QPVA 4B79A 4O8ZA 2Q9UA 4B6GA 2IH2A 4GLJA 4CKEB 1S9DA 1UEJA 1CEYA 3IMCA 3JYOA 1HC7A 2LIVA 5AKHA 3W34A 4RABA 2HQ1A 2F1OA 2BJWA 2NAFA 3Q2OA 5A2GA 4MI3A 1Q22A 1T29A 2DT8A 5CYPA 3CEAA 3K8OE 1X1RA 2CW5A 3P4XA 3Q9SA 3DQQA 2OSVA 2ZB3A 4RQAA 3N8GA 1R6TA 4NBKA 2G9RA 1FZTA 4E1VA 4JI8B 2ENWA 4KR9A 4ZQGA 1G60A 2Z2IA 1JYEA 5C7LO 1J0XO 3KJEA 5I5GA 3PHCA 1C1XA 1BS2A 1EPUA 2I66A 4F2GA 1D8TA 1FDSA 5DM1A 3UJ8A 1EDZA 4ARCA 2CMHA 2QR5A 2EJTA 3RSZA 4U7WA 3EYAA 3NIFB 4FDMA 4BLQA 1GU1A 3CT4A 2PV0A 3OY2A 4NMHA 4YGXB 5BUQA 5LP6F 4FFWA 1QOQB 4IDNA 2RI1A 4IGAA 4GAEA 1AKNA 4GIBA 3S1LA 1QQBA 2NU6A 3KDPA 4KDFA 4C4XA 3DD5A 5DXAA 1RZVA 1KR2A 1LA2A 4ONEA 4QRIA 3BQ9A 4MMXB 1D09A 1FSFA 1OV4A 3GLVA 3TTXA 1XPOA 5LOVB 2DFPA 4IAOA 3KZOA 2WYOA 3JD0A 4GPIB 5DCYA 1DDIA 4F9TA 2R97A 1XKTA 5J43A 4BNIA 2DOKA 5BR8B 1IEVA 2FJ0A 2D54A 3UM9A 1ZK2A 4J75A 3A70A 1VHTA 4ZQHA 2Y0BA 2BTQA 1NVTA 3TRFA 3TLGB 1BAPA 2NNLD 4LZPA 3FR8A 3R7SA 4AZ3A 3SWWA 1X38A 4C21A 1CVLA 4RAQA 2HRQA 3FF1A 4FYWA 3D5QA 1D5CA 3UTCA 4BNTA 5IH7A 1AGPA 2OE2A 1FXWA 3GFPA 1RC1A 4QT4A 2RBGA 4HNAB 5AD1A 3RABA 4YMVA 1PX0A 2JK0A 4IKOA 5ICFA 2UKDA 1J33A 1UINA 1WXFA 1IRIA 4NKRA 2K4MA 4NK5A 2HRBA 2O2HA 3WZLA 4I14A 3ZV4A 2BHNA 2G77B 3ANNA 1N2CE 2YQZA 3JD1A 3U48A 5A9RA 3G9QA 4LFAB 3K3PA 1UMCA 4DA9A 4AP5A 2K7FA 1FYVA 1D03A 1R9JA 4YWHA 3X2EA 1TJ4A 5C7OO 4KR2A 4HEA1 2O8EB 1MN6A 3MQ2A 3PNPA 2ZJYA 4CHGA 2OO7A 4RD6A 2C4WA 4TPKA 1ZUNB 3G8CA 1QOPB 5F1YA 3INYA 3MPUA 5FAXA 1IY1A 5B7PA 5IJWA 4HHEA 1YB7A 2FPSA 4J2TA 4M6WB 4R2HA 5EIBD 4FDUA 1MB3A 1R27A 4CM4B 3WMRA 2JI6A 4CT5A 3PDIA 3OUTA 2AOVA 5J58A 2GYUA 3U7FB 4B8WA 2O2IA 1I2AA 5IX8A 2WB4A 3IAM6 1AC5A 4NZNA 4R0MA 2WPDD 2C9OA 4XDYA 1V16A 3RS8A 4CV3A 3CZ4A 4JBGA 4ENSA 2B36A 2WAMA 1JPVA 1EGHA 3ACDA 4Z4CA 4HS4A 4MUIA 3JSAA 4TRRA 1K97A 3UPUA 4F8JA 4YRNA 1Y6RA 2QSZA 4IYJA 1SOWA 3DHVA 5HJ5A 2WG2A 4BQIA 2UZ1A 1MCZA 2AZ4A 4HOYA 4N5HX 4Q93A 4XDHA 4RYDA 1XDBA 3QE3A 1KAMA 1T2VA 4MQUA 2PYDA 2QN9A 5A4JA 3S7TA 3PPVA 4LSWA 3WMFA 3BMOB 1CEEA 4JXXA 4MW9A 1LDGA 4W9NA 2BWJA 2WYIA 2AW5A 3WKCA 4ZT4A 1I24A 5CJ2A 2X4LA 3FPSA 1KORA 2C84A 3O2QB 5IBPA 3OIWA 3LUPA 4R8MA 1T9BA 2ZB4A 2ZQYA 5CEFA 1QG6A 2PEZA 3DTNA 3JQBC 2QBYB 3C3KA 4WUVA 2ZW9A 5AR1A 3HZOA 5CA0F 4B1FA 2PUGA 2GM4A 3AR9A 3KEOA 1BJKA 2CEKA 2LTAA 3GROA 1F7VA 1K7YA 4UZSA 3A3PA 3GVHA 1LBTA 4BNGA 4TT3A 4HN2A 2H0RA 3CRW1 4LCEA 1OSNA 1DOZA 2WU8A 2QYSA 3QVKA 3NXSA 4MVJE 1PLLA 5ANRB 4UAJA 1XTZA 3DUFA 4DA6A 1F14A 4LYAA 1PG0A 2GD0A 3U4DA 4U9HS 3ZQUA 4RTOA 3UY4A 4KI7A 3QEOA 4LSMA 1YI0A 2RH9B 1OLUA 1J8VA 1NRWA 2PYZA 2CXNA 2HPZA 1RZ3A 5ENZA 5CCXA 5TF0A 1YQUA 3R7BA 2WIFA 2H1FA 1I33A 2OQIA 2Z08A 3T5MA 4DM7A 1BKYA 1DQPA 2R6ZA 3EXIB 4WKBA 4BJ3A 3WAGA 4LJRA 5KJ1A 3OCUA 2C0QA 1ECLA 4CKZA 2IRWA 1E2IA 1B2RA 2WPDA 3TTSA 3UHOA 1E2QA 1XD8A 3FWHA 4IVPA 2AG5A 3OEYA 2B78A 2HWXA 1NW5A 2BGRA 2DPHA 3EB9A 4BP9A 3WKEA 5ALXA 4YUYA 4LRWA 2BHRA 2NTVA 4V0LA 5CT6A 1NBMA 1U3WA 4Y2SA 4YRZA 3E8SA 5I4BA 1A4RA 1T15A 4OPMA 4UD2A 1NJ6A 3A6HA 4I1IA 3FD8A 1SU6A 4L4UA 1NUSA 5EKDA 5LZ2A 3HN6A 4JGGA 3RWOA 2FRDA 3WQRA 2XNKA 3RHFA 1T0JB 3HFRA 3SHWA 1M8PA 5KNLA 4GUAA 1UF9A 1K6IA 5ESRA 4OQQA 5AI8A 4L0MA 2I6TA 1P9LA 3KEGA 5J2TF 5AXAA 3GEBA 1CIPA 4IMIB 4ZI7F 5JANA 5EP2A 1WQ1R 2I6SA 3QPBA 1G3UA 4RWZA 3WA6A 4J29A 1HNZB 4EF6A 1FEZA 4EY7A 4UBNA 3ZU6A 4HQ0A 3R6WA 2E4VA 3FNHA 5HG0A 3NOVA 4ZZ2A 4EPTA 2Y1DA 5CDHA 3RAGA 1J22A 1YB5A 5CNKA 4ZOLA 5JAQA 1HG0A 1P0IA 1PGQA 2ZE8A 3C2QA 1YUNA 3X43A 1VSVA 5FBQB 5HZGA 5BUSA 2DAPA 3DYVA 1DIHA 4F85A 2ZYAA 4AO8A 1JB9A 1JILA 1UKEA 3W4IA 4CLRB 4DBZA 1OLXA 4POOA 3NHYA 1C14A 1IB0A 1XZGA 1UT8A 2YCBA 2IHUA 5HSGA 2COUA 3B7GA 2C8LA 3N05A 5DHRA 1JIXA 3AQIA 2HRZA 3EUFA 4LI0A 3P94A 4F3RA 5CB4F 2P35A 2Q4DA 4IJQA 5BNFA 4EW2A 5IC4A 3QNUA 4RVOA 1US8A 5H4HA 4GFDA 4HRYA 4ZZ1A 4MV5A 1IBCA 1YFZA 2PIAA 2IXDA 4M9QA 3DPIA 3F5FA 1W8DA 4P3OA 1RHRA 1KI6A 9LDTA 3ICQB 2I9KA 3OMXA 2O4CA 4I5EA 3TN7A 1ZITA 2VRBA 4A73A 3RANA 3GLIB 3BXGA 3LX8A 2CWDA 3GIDA 3NETA 4GMFA 5TS3A 3L43A 3F1LA 2F1HA 2VSXA 2CB0A 2Q9BA 5HTKA 3IOBA 4C43A 4EYQA 1M2WA 3DXXA 3WXBA 2B8JA 1DX4A 4QQFA 2C5SA 2LZ0A 1DTWB 4LYDA 3N3AC 2OFPA 1VQ1A 4E4RA 4WEQA 4Y2HA 1N1MA 5IUKC 2O9JA 3AWDA 2Y0EA 3LQQA 3EXHC 3MWFA 1JJFA 1GPUA 2Q45A 4IIJA 1KP2A 4ARVA 4TZKA 3RYTC 1Z0ZA 1UPCA 2ALJA 2ZR9A 4P3PA 1CIVA 1E7MA 1XQVA 1HETA 4F93B 2PX2A 4GLBA 2BUAA 2GZ2A 2JGDB 3EVCA 4L08A 2GMWA 2VH2A 4CMJA 2V6JA 3HU2A 1CRLA 4OHVA 2EKPA 1USKA 4FIZA 4ALMA 4AIIA 1W35A 2JFXA 3MINB 3EGEA 1T4CA 1GNTA 2PRYA 3RYHA 3L4KA 4FUQA 2IOFA 3E7XA 2ZR7A 4BOYA 2QE7A 1MABB 3G5MA 2ZT5A 4P31A 3MEQA 4N12A 2O57A 2F9FA 1L5FA 2QKYA 2QN1A 3PXAA 2VSFA 4JJ7A 2IZ7A 5AJTA 4F9EA 3BOSA 121PA 3OCVA 3QHAA 4R98A 1XD2B 3PEFA 2XY4A 4AN1A 4WE3A 2CN1A 3CE9A 3P2IA 1TF5A 4GM0A 4RPHA 4TKUB 4C4YA 1VJDA 1U9IA 2HJSA 4J94A 2DERA 1KYVA 4AJIA 5NLLA 1V5WA 4K6MA 1AG9A 3U7QA 5KTRA 5LU8A 4BNZA 1O6BA 3ETJA 2BT4A 4FYYA 2O8NA 4L5CA 4TVKA 4E15A 3H9BA 4QGBA 2QRVB 1JLSA 1YR6A 2KX7A 2C5HA 2UYYA 3ND6A 4UMVA 4YH1A 1KMNA 4BVGA 1PFWA 4FZJA 5E4TA 2JEZA 1H8EA 5CCEA 2NZUG 3VA7A 4FM9A 3ZZ0A 3EJ6A 4RZHA 3LI2A 3EGWA 2B94A 1JDTA 1TZJA 4KK3A 4A1OA 4M86A 2QLLA 1Z7YA 2IDZA 1O94C 3KLMX 1QIHA 1U2GA 4B44A 4GRAA 4X00A 4RQUA 4BO1A 1AZLA 2HJVA 3ZY6A 3LT0A 1X1CA 3D3EA 1E1DA 1XDGA 4RZSA 3EA4A 2JFOA 4QUDA 4G0OA 5ELLA 5L4SA 2HHHB 1FXWF 2FX3A 3V7UA 4MQEB 1LKZA 3PT5A 4OQYA 3AP2A 5AW9A 5IDVA 4PZUA 3PC8C 4WKNA 5D2CA 2B1GA 2DC1A 2D3WA 1QFZA 1QE3A 4R84A 1APBA 1ZXXA 4OP2A 4DV7B 4M99A 1TUGA 4L5AA 4UULA 2DR3A 2IGBA 4D8TA 4DG5A 3MGCA 3EUEA 4PPYA 4MMZB 3GCDA 3K5WA 5TJ9A 4J90A 3ZXIA 1Z8FA 1UEXC 4LHWA 2QZSA 1QZ3A 4LZLA 1JAHA 1HDEA 1JXQA 1QANA 2B3TA 2DHCA 2MYPA 2VBFA 2CDAA 1JXOA 1SK9A 3E9EA 5TC4A 1TQ2A 2HIMA 1H1DA 6REQA 1VSUA 3F4LA 2J07A 3HGMA 1JBEA 4Q9HA 3WWDA 2D8MA 4B46A 3PGJA 2AXNA 3SR0A 1AN9A 4FJ0A 4DPKA 1RWOA 1GKLA 2HRRA 2P9GA 1M6EX 2YXLA 4KQJA 2JD1A 3KHSA 3IOYA 3KUXA 1NG1A 1W4AA 4JN6B 4WX2B 5KSOA 2ZCJA 1MR3F 2J0VA 1EFLA 3FCAA 4CGZA 3TCXB 1Z7WA 4FN4A 5ILQA 4YV0A 3TI9A 2HCFA 3C3WA 4DSZA 1H4TA 1S1CA 1DU4A 1SQSA 2DHEA 2XADA 3FZEA 1XEFA 3I8XA 3QF4B 4HDAA 4Q18A 1QYIA 3I1YA 4QL3A 2PE5A 3GA5A 1YQGA 2EU8A 3KFLA 5F12A 3ZDXB 3IQWA 2BFEB 4ARIA 1MOSA 1X8KA 3DUWA 3KVNA 3MWKA 3UG6A 2NSJA 1Y8RB 2WWXA 3KOOA 1NJ8A 2XGGA 1QTNA 1Z8DA 1IOVA 4G9EA 5YASA 4G5RA 3WOHA 4BLPA 2J09A 5JZMA 1EH5A 2A0XA 4Y2GA 5GWXA 2GUGA 5JD5A 4YJ3B 1ZC4A 3CRZA 4C0WA 1VBKA 3W4JA 3DO5A 3I2HA 5ELXA 3LDGA 3E9RA 2FVYA 4GP6A 2VPTA 3N70A 5IT9A 4K5QA 1HDRA 2XKAA 3M6WA 1ESEA 4CKYA 4TLDA 3LOUA 2CFSA 2PX8A 4XQCA 3M82A 4RNCA 5EWLA 3W5UA 5AOCA 3U4QA 3I83A 1AMNA 1Y8ZA 1PL8A 3RUIA 3MUOA 4IUBS 2FI1A 1DXOA 4JUDX 2P2CA 3BK2A 1GU7A 1V7QA 3LRPA 5FUXA 1TJPB 1EZ4A 3THWA 5CT8A 4LBYA 1JG7A 3RS3A 2W43A 3S2EA 4CTJA 2NLOA 2XMBA 5I8PA 5F7OA 1SRQA 2XXBA 4O4HF 4H9GA 1G9XA 1BE0A 2WYHA 2XYPA 3ELBA 5FLKA 5KHAA 5PGMA 2V6IA 1KYTA 2OVFA 1H6BA 4GX2A 1P4SA 1YA6A 2AE1A 1SHUX 2QG6A 2V9CA 4IIHA 1IE3A 3TXAA 4G5GA 4TLAA 3ZKAA 4YT5A 3TCNA 4JI4B 2FMKA 4QFMA 1E8DA 4QATA 5C32A 3RB8A 2XCTB 3T6KA 3EARA 4RK7A 1JHOA 1QHNA 4EHNA 2EFHB 2ZB2A 4EI2A 1D6MA 1TM1E 3L7BA 3QPUA 1YHNA 1YJQA 3RW9A 2OORC 1DXQA 4QODA 5JNTA 5M7EA 4ZGGA 1ZMXA 5E4JA 1THZA 1XVUA 2ZVDA 3PQ2A 4GUDA 1K2WA 1M6HA 3HCOA 3I0NA 3HNRA 4HAIA 4QPNA 5SZIA 3V4VB 3QOXA 3U60B 5DT9A 4GC9A 1N8TA 1C0LA 1LK0A 1E0JA 4DEVA 3NPMA 4MVJA 3GEPA 2INGX 3NBQA 3PNSA 2RHWA 3OIGA 5JJ5A 4BCBA 2BBOA 4IQGA 1T26A 1DEXA 1GNLA 3DLIA 5EPUA 3G85A 2C2OA 3JQBA 2JF0A 1GL3A 4ABTA 1SCDA 3IAXA 3VHLB 4PIMA 2HA0A 4BIIA 4PNEA 1Z88A 1H8HD 2PT7A 3GLUA 3NU1A 1FUYB 1XD9A 1VP3A 4O5AA 3KKOA 1KO7A 3TIFA 3VKWA 2MOKA 1N6NA 2EFJA 2XNHA 1WULS 2CFTA 3R0JA 4MS4A 5FORA 1W5FA 4AP9A 4B6FA 3EXHA 1MNAA 1GZVA 1PK7A 4PZPA 2HLDA 2X5JO 1DX9A 2ZIWB 4IJ6A 4KU4A 1H4QA 1UWVA 1UDWA 2OCDA 3GH1A 4ZOLF 4O4HA 4JT8A 4IG4A 2CV1A 1F3OA 4YB8A 3K1AB 4NQZA 2B4QA 1QS0A 2A8YA 5AK0A 1YZ3A 2ZIAA 2ILVA 3CPHA 4NTZA 3KZNA 1VMDA 3EAGA 4GR5A 3JYNA 3ZHYA 3O73A 5COAA 5B6JA 1HX7A 3DPSA 3WGIA 2VPWA 4D42A 1MO4A 4RGBA 3WA7A 4L8FA 2DQZA 1K66A 4K87A 3VR0A 3CNHA 3RT1A 2IFTA 2NT3A 2QOEA 3CEJA 1VPVA 3IPLA 3JVUA 4ZDKA 2BFPA 3MBKA 4BB6A 4DV5B 2IBMA 3AQ4A 3JAMA 4QQRA 1BCSB 2O5RA 2P9YA 1NULA 3NTXA 4LBVA 4YCAA 1SC9A 5CLLA 3DDCA 4MUXA 1I7PA 2D13A 2CE7A 1X8JA 1RQNA 2WBLC 3CRQA 3NIDB 3PRYA 1UWLA 1XZHA 2PRJA 4I50F 5IAKA 1KQNA 3RUCA 3BWYA 1RQ2A 5EC8A 1W75A 2P0EA 3BWXA 3I9FA 2PDAA 1PTJC 5LJLA 4GOKA 4FTWA 4E3ZA 3MTAA 3R0VA 1RRKA 1UFRA 4JOBA 5DMHA 2OGWA 1A5SB 4FEEA 4D25A 1Q6YA 4FGLA 2ADFA 4FMCB 1L1RA 2WA1A 2ASEA 4L2IA 3H04A 5HYVA 1FNMA 1TOAA 5EXPA 3L8CA 1LDEA 3GUVA 5CTAA 1R0RE 5G0TA 1QBGA 2YZ2A 3TXXA 5DHUA 2ODQA 1X7YB 3A4MA 1IHUA 3AFHA 1O94A 2BFOA 1NVAA 2IP1A 4PZEA 3R7WB 5HHTA 2ZVQX 1GZSA 3KU1A 3DOFA 1ISHA 1TI7A 4TMFA 2Q6VA 1PEKE 3U4AA 5BW8A 4HTAA 1SVLA 1TX4B 1H8HA 3KPUA 1Z5OA 3VHXB 4O4JB 4XTCS 1NBHA 5IVIA 2PJZA 4G36A 3FDZB 4Z1MD 3WJ7A 4UASA 1DKNA 1R00A 4IIJF 1HE8B 2V3WA 4XEUA 4R9SA 3EXIA 2NTEA 3HNPA 4DQUA 1GZ5A 3SHFA 3UJ6A 5EQJB 3E2IA 1KFJB 2W6IA 3F6CA 2NU9B 4AROA 3N6RA 1WCIA 1XRRA 1G4HA 1EK1A 1I3NA 1X77A 2JNWA 1SY7A 3ZG6A 4FX2A 4BFWA 1VL6A 4NIMA 4OLFA 3GJ5A 4W5RA 4N7MA 3E9QA 4BN5A 4E5VA 4R2LA 4HWPA 5F4ZA 4NE2A 2BFDA 5FV7A 5KC9A 1RKBA 2H57A 2OCXA 1M6NA 2HNAA 4B4KA 5K03A 3IAHA 4CMKA 1PJBA 1D2CA 3CE6A 3Q3VA 1YZKA 1GA4A 2FFJA 4YRIA 1QP4A 1GZHB 3WL8A 3QSYA 4PYNA 1M0WA 3I3SR 1B6TA 2BFBA 4C87A 2H9AA 2EWWA 3NBFA 2UUCB 1F6DA 3G2IA 4XCXA 4NV1A 4KV9A 1SKQA 1L5QA 3NT4A 4DMMA 3I5YA 1YNOA 1QGDA 5EINA 5FLXA 1AGRA 4TSFA 1N57A 1EUQA 2HXYA 2D1QA 1NT2A 3K9GA 4EHLA 3RFUA 1IONA 3CO0S 1JLRA 5K4GA 1E1YA 1OZAA 2OZEA 3CLKA 3M5DA 5JSYA 4FCCA 4GO1A 4UKDA 2JASA 3DM5A 1VKJA 4Q34A 4IUDS 4YMLA 2QRKA 4F4FA 4XSGA 1I5RA 3C3BA 1DC5A 2VHTA 2YY5A 2JLAA 2N0SA 2AD5A 4TT3D 1XMXA 2HSEA 2PVSA 4P58A 4Q7LA 4DIMA 1EWYA 2IY8A 2FN8A 4TYWA 3QZUA 2E4UA 3FVQA 4EUEA 2VHUA 1FU7A 4PONA 2NSDA 2HU2A 2QSUA 4IGIA 1CRWG 3BQNB 2QD5A 3OESA 1P5HA 4ASUA 3H6KA 1DAFA 2JGMA 3BORA 3OT1B 3LOPA 3C7KA 3PQFA 5KYYB 5EMKA 3UBTA 1O54A 4Y0VA 2QTVB 3U9SA 1YCDA 2X42A 3L02A 4GKAA 4YHBA 4PG7A 1A4IA 4YRDA 2FP4A 2DT5A 4PG8A 3RG2A 4YCCA 3EQZA 3HO8A 2ZZMA 2P3QA 2EBFX 5EJ4A 1I80A 1JG3A 4CF7A 2GCEA 3EF1A 4QOFA 1T3ZA 1VXOA 3MQ4A 1RNLA 1U0GA 3V8NA 5DYNA 4U02A 3N8NA 2ID9A 3GJRA 3MCAA 3YASA 4U2DA 3UWPA 1H42A 3A31A 4RC9A 3OQOA 1IVNA 3ILXA 4MS4B 1LQUA 1OF1A 1ADGA 3FF4A 4RSMA 1PWYE 1UMDB 4I8IA 4RFSB 1UMBA 2G1KA 4WZAB 2H59A 5T6BA 4BX8A 2FPRA 5H1YA 3REOA 4B76A 3OZTA 3EIWA 1R64A 2NPOA 2JI9A 3AGPA 3PUIA 4NZMA 2JHCA 3SBEA 3TOZA 3VM6A 4AS3A 4CQMA 1QNLA 2OCGA 3I9KA 3LCMA 1CUYA 4AKIA 4DC9A 5HKOA 4B3CA 3PNKA 2VAVA 3E5HA 3HA5A 3WLHA 1ZVQA 2G8LA 1KO8A 3KQPA 2O48X 4US1R 1G3IA 1IQ0A 3ZDEA 5LWHA 1SZPA 2OD9A 2F1JA 2DFTA 1M2JA 2W2NA 3MG9A 4ENWA 2KSQA 3DMFA 1QMPA 3IQZA 4X63A 3COJA 5TX7A 5TIIA 3BE5A 2Z4RA 3GMIA 3GLFE 1ZVMA 2QQEA 1GKUB 5CM9C 3PQEA 4B6OA 4BXOA 3R0QA 4ISCA 3ZHZA 1ZCZA 4ZGBA 5TQJA 1GA1A 4YAUA 1KIMA 4FDTA 3UKOA 2H65A 4G1FA 3RO7A 3WNCA 1N1GA 1F9AA 4I7EA 2NTYC 3SC2B 3E58A 3ZJ5A 3B6IA 3RAFC 4FILA 4NVRA 3B70A 2XKJE 3IP6A 4RKWA 4NG5A 1R6BX 4NH0A 3FUXA 5HPYB 3E03A 3FPKA 4FB5A 5K01A 4TN5A 1R0KA 3OF5A 4LXHA 3HA7A 1PTKA 4WLNA 1M5RA 4TMZA 3D2AA 3HZHA 4KUGA 1XXHB 3IEPA 2JJ2D 4QIHA 4E70A 2V0CA 5A4IS 2UXDB 4JQZA 4XFKA 3HVUA 3K0SA 4RCVA 5KQPA 4TLMB 4R1LA 5JPCA 3T1YB 3C6BA 3VZDA 3RHSA 3ZE7A 2RC6A 5CA0A 2ZYGA 2J6IA 2WWHA 3WBFA 5DZSA 1DLIA 4BKRA 4AKGA 5E8JA 4D41A 4UPEA 5DN9A 2XB8A 5FI0B 3N2NA 2I65A 4OSOA 3WXMA 3TZHA 3CW8X 3H4TA 3O6VA 1FMJA 3K0FA 1KY4A 4ZVUA 4NXNB 1Y34E 3FFWA 1LZLA 4JA2A 3CH5A 2ORYA 1T8YA 3JWJA 3MD9A 4F1WA 2IOHA 2DPGA 4ILEA 3VH2A 5IJ9B 4UCFA 1VBNA 2VSYA 3DKPA 2GWHA 3IVAA 3LT2A 1SIOA 4NMXB 3NJ8A 5DI3A 3RGWS 3SBDA 4O4LA 1FSGA 3TOSA 4CKXA 3AOEA 2ORIA 3U5TA 4K6OA 3WIDA 2FMTA 2IBSA 5F1PA 5ALYA 2D2FA 3K70C 4HXYA 4CW7A 2GEBA 4AFNA 3AV0B 1CQWA 3A2NA 4UARA 5GONB 5DHTA 3T41A 1H1TA 2C82A 5ALNA 4A92A 1ZJWA 5A2QA 1WV1A 2YVLA 3ZKWA 4CQNA 4C01A 2EZUA 1JALA 3UWMA 1QRAA 3I2KA 3L7MA 3AEQA 1ZLYA 5JG7A 1S02A 2CYCA 2R8RA 5JU6A 1NXWA 5IF3A 4NV0A 3DWEX 1AK1A 4YPFA 1JA9A 1Z4OA 1EFDN 1N3YA 1NF2A 2EDCA 3VNVA 1P8AA 2CNBA 5AIAA 4DY4A 1H2RS 4LVUA 2WJAA 3OX2A 4GQBA 4RKEA 5AUPB 5DIZA 4M1YA 5A71A 1TTHA 2R5FA 2A67A 1OIVA 2OO5C 2ZK7A 4GX0A 3TEFA 3V8VA 4NAUA 5M3BA 3A6KA 4A27A 4NHOA 3S1SA 5EPEA 4PG4A 3WRYA 2Y05A 3KSBC 1U7PA 3WGNA 3TQRA 5JAUA 1WAMA 2Z6VA 1T13A 2B37A 3IMGA 1YE3A 2NO0A 2UU9B 1JNXX 5TF4A 2F3QA 2V03A 3AM3A 2H0AA 1AUOA 2HB6A 1M66A 3P5BA 1TVMA 4O63O 3LQFA 3LQ1A 4CL2A 1ZEJA 1WLSA 1UAGA 2ERYA 5D5PA 1IH8A 5DFAA 3NVDA 3TDMA 1CB7A 1HQCA 1RQLA 3ADOA 2J0EA 3ESBA 4KAXA 3GRUA 2IU0A 2HSWA 2NTJA 5HIJA 4J43A 1V9LA 2C92A 1Y3IA 2ZZKA 4P4UA 1K8XB 1TFUA 4A9AA 1GG8A 1LTHR 2ZROA 3L0OA 3V8QA 4BC1A 4BVJA 5A5EA 5IKPA 2VDUE 2ZPAA 3CRVA 5KNDH 1XMOB 3C5WP 5FPSA 4HLUA 3D8UA 5LJIA 4N5DA 3P19A 4WL0A 2P9TA 4TVOA 1ORRA 2VHJA 3MD0A 1H93A 3DDSA 4KQ9A 5ALJA 3D6MA 4N4AA 2CKDA 1VE1A 2IH5A 1CRQA 1XKLA 3LHSA 2TS1A 5FOSA 1NDQA 5F7XA 3MCVA 4P7KA 3VR4H 5LD2C 3E27A 2J9XB 4MWBA 4YP5A 2VTVA 2RAPA 1FRNA 4OQPA 3OSUA 4P84A 3EVDA 5AP9A 1DPGA 3FDXA 1G21E 3GA0A 2AK2A 2Q4EA 4IJVA 4UNSA 2P9EA 1PKEA 3VDNB 1HSZA 2A88A 2FSIA 4UTNA 1SUSA 2Y6UA 4PLHA 3IKTA 4PF1A 2W42A 1RPZA 2ZBGA 5CFQA 1N34B 2QD3A 4FHFA 5EQFA 4KFTA 4EWLA 3R24A 5BSTA 2CXOA 2DUUA 3BC1A 4OMFG 3TBKA 4R3NA 2YNMA 1L7MA 1XZNA 1HDZA 3FMOB 3LBIA 4XRGA 1YB4A 3PJFA 4E14A 3ENZA 4MQLA 1U2RA 2ET6A 4DLBA 1GT6A 1RXCA 2GRJA 3QF7A 4CM3A 1P1JA 5FB3A 3HSKA 1NI5A 1VKHA 2I3DA 3KQHA 3GLRA 2AN5A 1VL5A 2Z4SA 3IT2A 4GRDA 3NTOA 3RT7A 1FUIA 3H0CA 1KRWA 5E0KB 4LN1A 3KXLA 3VTZA 3HZZA 1KL7A 3CJRA 1Y8AA 3C6XA 3SXUB 1DMRA 3MS2A 3L7NA 2Q5LA 4C89A 4GSKA 4X1YB 2P4SA 1COZA 2I6QA 4RJIA 3B85A 3T9DA 1OXTA 3W5HA 2DUJA 4QD3A 1OXXK 4P4SA 4TTAA 2CYAA 1L5RA 1OASA 1E6EA 4KE8A 5A3VA 2Y1OA 3IXLA 1OXMA 3GRKA 4Q4HA 1I0IA 3IVMA 3KD3A 2AR7A 5COQA 1EX1A 1H1LB 4Z7JA 1DO8A 3BZUA 5DB4A 3AR4A 4FKMA 1JH9A 2R6HA 2VNSA 1N0WA 1ZK1A 4MKHA 1NRXA 5HCUA 4R1OA 2DBYA 5I7WA 3JYQA 5IU6A 5FWXB 3UMMA 1K6MA 1Y9ZA 3OOSA 4IH4A 3MJCA 2HRCA 1WJGA 2B2XA 2PGLA 5DGTA 3DAYA 3LT5A 3AIOA 1Y4AE 4JQCA 1A69A 2QUHA 4KDRA 2R44A 1CUEA 2NM0A 3CB2A 4L6CA 2WEKA 3P9KA 3TLMA 2HHLA 4EGQA 3NXKA 5IKEA 5LQCA 2AQIA 2JVIA 4EVRA 4XWYA 1NJSA 5LPNA 1HEUA 1KKUA 1QSGA 1X7GA 4E7PA 1QYCA 1MQ9A 2YRFA 1ANKA 2N46A 4A0RA 2O3JA 2VEDA 5FHRA 5EJAA 5CX4A 2W2PA 2POCA 2NU9A 1OZGA 1PFYA 3BCHA 3C6QA 3F5MA 3G0GA 2GBCA 3I0ZA 4MR8B 2LDBA 5BT9A 1EI9A 4EF5A 3OP1A 1E6UA 5HRUA 1NF8A 3HLYA 3A9WA 1AM4D 4DHEA 2IGTA 5B30A 1T43A 1V1MB 2IUYA 4Z7OB 3VFDA 3AUFA 1ULZA 3AY3A 1MO2A 3ETCA 5DJ5A 4B2YA 1Z0AA 2ZUCA 5CFOA 4NEHB 3WYAA 2BEVB 2PRSA 1E1CB 1Z4IA 3B7PA 4QLOA 4RTSA 3HGTA 4Y0AA 5AKGA 5C18A 3WL5A 1XX6A 1MVOA 3LU1A 2W5UA 4MVJD 1SVWA 3ROGA 3U2QA 3KT0A 1MF7A 1WZEA 4KPGA 1EDDA 1XA4A 4N7BA 3ZNOA 4F9GA 3AEKB 3ZQKA 1T91A 2GUWA 2ZB7A 2ASVA 4GPEA 4REOA 4D6PA 4DLLA 4F21A 3GGCA 4XIYA 1XUOA 4RKRA 4F3YA 1JKIA 2TMGA 2AG0A 4TKVB 4NZYA 4UU0A 3UB3A 1JUDA 3NYIA 1FZQA 2VO1A 1IZYA 2DMRA 1OTYA 4XM1A 4KQXA 1UQUA 2AOTB 1FS4A 1OI2A 1J1ZA 3CX3A 3IB3A 3MGBA 1I7LA 1Z38A 3LLVA 1CEQA 4QTXA 5ALVA 5LXTA 1GPBA 1DT3A 2HU8A 4B6RA 1NLZA 1FU8A 3JZDA 5JMWA 4TGLA 1JKXA 4EB6B 4C04A 3GLQA 4P1ZA 2FKAA 4DAEA 3JQAA 5JBNA 1SXQA 4IW3B 3S2SA 4F2PA 1SQFA 1PKXA 2XIJA 4YMGA 3A2KA 3HB1A 4P22A 4M8NE 4IUCS 2XZLA 3K6KA 4XDGA 2W58A 4WN3A 1Q17A 2C07A 3H5OA 3RF7A 2DKFA 3ZS9A 1PLKA 2NUAA 3IP9A 4Z4FA 3H5NA 3IKVA 1BHQ1 1Z35A 2GCOB 4W7SA 1XN1A 1BVRA 4Y6QA 1DOHA 4BQEA 3C43A 3AVVA 3RRZA 3GZTB 4PHCA 4FHGA 3SEFA 5JADA 2QMYA 2PL5A 3OLWA 4MCAA 4RLQA 3X1MA 1NNUA 4YYEA 2JEYA 4X94A 4O3MA 5CX1B 5IDWA 4W6ZA 2PGJA 2GD1O 3ZGYA 1TQ8A 3NUQA 3Q5DA 2PVCA 4BV3A 3F78A 821PA 5E6SA 1OYOA 2YWDA 4FFVA 1TADA 1TO2E 2XQFA 4NMLA 1A2OA 2P8SA 3GLGB 5H8WA 2I62A 4BMSA 3I9OA 3TECE 3KOZA 2FUEA 3LX6A 4CDMA 1O03A 2GPTA 1SG0A 1UL1X 5EAIA 3S1AB 4FHZA 2VDRB 3DDUA 3HRKA 4AJ4A 2XRZA 4MHTA 3U4MA 5F2KA 5AKEA 4Z6KA 2Q07A 4CCAA 4DLRA 2Q29A 1KJ8A 2HR1A 4B8ZA 5LUAA 4WJZA 4PGAA 1V16B 2JIRA 2ZIVB 3ORSA 4NS1A 2VJAA 2XYGA 4YP1A 4DABA 1ZOIA 3HEMA 4YACA 3ETNA 4KN6A 5D3QA 2Q7DA 2C4TA 3JW8A 2PXCA 3KR0A 4Z4QA 4M87A 3KPJA 2YN0A 2FUNB 2BCGY 2O2ZA 1P1BA 4UCXA 5CIQA 2W2MA 1YNSA 2PQMA 3CIFA 3K53A 3E9MA 3AG6A 4KNWA 1Q0SA 1YVUA 2WD7B 4PQRA 2AFHB 3BK7A 3IBFA 1GKYA 4Z1MA 2QVYX 4GQIA 5DWQA 2JFUA 3DKVA 4S1WA 4HMQA 4O8CA 3SJBA 3K9FC 3WGGA 2DLCX 2VHZA 3HLKA 2QRPA 4C0BA 4H0FA 1R4NB 1VHWA 2PL1A 3AKYA 3O74A 4HWKA 4Q01A 1O96B 2HK9A 2PX5A 1OPXA 1I36A 5LUBA 2GN9A 3HKDA 4H17A 2TMDA 4LDAA 5ULLA 2PUAA 4DJTA 2BFFB 2XCUA 2ZU6A 3HSYA 5T41A 2GAAA 5JARA 2I7CA 2GJ8A 5IHPA 2CNWA 2X6TA 2CBGA 1UP7A 2SECE 2KE5A 1PGJA 3N9IA 4NOMA 3AR3A 3ZCUA 4YCSA 5HF5A 2H4ZA 3LYAA 4HYEA 1UMDA 1EX6A 3KJIA 3AP1A 4D81A 5K2MA 3UW1A 4A91A 1ZFNA 1PNOA 1H2AS 1U11A 2PXAA 3T5TA 1GQ2A 1UXGA 3LQRA 1DIAA 3U81A 2MSWA 2VZLA 3Q8XB 3N6XA 4XM2A 2VPZA 1ZGCA 3LHFA 5I9MA 2ZRPA 3PKJA 3U3MA 4L4XA 4ARAA 4D9KA 3VTAA 1LF0A 2VDWB 3MJTA 4F9FA 2HMVA 1MXFA 1VKOA 3MGKA 1MOZA 1UDCA 3RIHA 1KO1A 1IMOA 3CISA 1XDZA 1ENPA 1DBQA 2NYVA 2DWCA 3ZWMA 4KQIA 5L3VA 5KYUA 3LCUA 4JCCA 3CX6A 4OMUA 2WIGA 4P0QB 1U0HC 4FR2A 1MO3A 2JARA 3BH7A 4P0TA 4E2XA 4URZR 3SF8B 4KPFC 1FS5A 4HEA6 1BFUA 1A0OA 1OIWA 1W5BA 2J67A 5KYXA 2Y1EA 5AJZA 1EWTA 5DNDA 5I01A 5MGBA 1DAPA 2EL9A 2NO6A 3HBMA 3VDMA 4B43A 3LF2A 3P0RA 2JJ1D 4PWZA 4YP6A 3TB4A 2DWPA 4RLSA 1VC2A 3BFKA 3QKRB 4JLSA 4RQTA 4JH0A 1L7OA 3MWYW 3OZWA 2R6CA 4M1TA 4QE3A 4MQ4A 4KITB 1DBRA 4ZAXA 1LNZA 4GLFA 2XUQA 4ZFNA 5B1EA 5FH9A 2WY2D 3DL4A 3A7EA 4FW8A 1OH6A 2BGKA 5T3YA 3GR6A 1Q50A 4AZTA 2HBYA 1F2TB 1KYIA 1ULBA 4LXGA 2V0GA 4DGSA 5KVQA 1JTEA 2GEVA 4QLAA 1E6CA 4RK6A 5L3RA 1HWYA 4ZI7B 2R66A 4HQKA 2GLUA 3EPRA 1Z6YA 2M6LA 4ALJA 2O1SA 5EFZA 4HYYA 3M6LA 4K6HA 4W5TA 2A78A 3ZWOA 4RHYA 4DCNA 5IKXA 1TRHA 1W85B 1XMVA 1LNQA 1XJWA 3LQYA 2WTXA 4OYHA 4X20A 5F23A 1B41A 2YXEA 1QH1B 2GPBA 2PX6A 5A62A 5EZ6B 2JIOA 1DNPA 4KYTA 5DOZA 2B7CA 3SZ3A 3DTTA 1C50A 2PSDA 1WXGA 3OT4A 5DI3B 1AQUA 1RAFA 3D7MA 2DP4E 2AC4A 3K94A 3WV5A 4EPYA 5B6PA 3QYFA 2V97A 4N65A 4NZPA 3HKEA 5AK5A 1LD3A 3CZQA 3OPMA 4RFVA 2X14A 3M4NA 4TV8F 3VC2A 4A2QA 1VCOA 4G4SO 2WTNA 3IA7A 1NVDA 2AX3A 3D4OA 2NXNA 3LBNA 4U7PB 5CVDA 4B35A 2YDXA 3K0AB 4XZ3A 1K98A 4D46A 2IYFA 3WJAA 4N82A 1HH4A 4PAWA 2QTLA 3PWTA 5G4LA 1BWQA 2HU7A 1Q11A 3CSSA 4PE5B 1RYHA 1UR5A 1N5JA 1O6FA 3NONA 2YOGA 4HEQA 4GZMA 3EEBA 1AKUA 1FDRA 2JGLA 2X19A 1WEHA 1Y6ZA 2O3UA 2F3TA 2TSYB 2VQSA 4IVRA 1VFPA 4BFLA 1C30A 1KWKA 1UC5B 1VLZA 3ITKA 3PVCA 4JP8A 4PX5A 1W5AA 2VNIA 3SQLA 4V0QA 1DDGA 1OI3A 2OMKA 5E6UA 3UMJA 1GTVA 5I3CA 1B26A 1GGEA 1X1BA 3INGA 2CC2A 4O0MA 4JXZA 1CQJA 3V8MA 4D0LB 4L8LA 2HBZA 4FI3C 4DV2B 5AVVA 2BE7A 5K09A 1DJPA 1NN5A 1WO8A 2PRZA 4R1MA 3H4VA 1J7KA 4BFUA 1F6BA 1K1EA 4DNQA 4ESVA 2RIPA 2NVWA 2GFHA 3L7JA 4DMFA 3T35A 3EWAA 5AW8A 4TWZA 3RSLA 1SU7A 3G2MA 3UEOA 1QK5A 2XUOA 1XZEA 4K9OA 1G1MA 1Y1LA 5L7TA 4ZAGA 2PANA 2POQX 4OGGA 1CCWA 4CPDA 2GBIA 3OSZA 1USWA 1QGAA 2W48A 2WWWA 1JJVA 3VV3A 2FFAA 4P2BA 4TTTS 1KBZA 3Q4GA 4ZTBA 3H17A 4BMOB 7AT1A 1AH2A 3VZCA 4TX1A 4IRUB 1M73E 2I1WA 2VDVE 3SSAA 3UH0A 2AD1A 2ZOSA 1X92A 2AOWA 1CXZA 4J9UE 5A3RA 4IMJB 5KOIA 4X9XA 2FSPA 1VRWA 2FSFA 2XI4A 2YV1A 1FP6A 3VR6H 3MJVA 2OY0A 5D85A 2PS0A 3BS4A 3EG9B 1WS6A 1H65A 5L40A 3P26A 4EHIA 1OX4B 5IBQA 1GR0A 3GLFA 3K9BA 3E48A 2WWRA 1MIOA 2OV4A 3AILA 5L53A 4MLDA 1Z12A 3MAJA 4K2HA 1GPKA 3IEXA 1JSXA 3W5BA 1P72A 1WW2A 4FQ5A 2OAEA 1E5QA 5CG2A 1G5QA 4NBVA 2IDMA 1TMYA 2Q28A 3SP1A 3OOHA 3NBAA 3O4FA 3HYNA 1N2GA 2BMDA 3KLPX 4QARA 3KQOA 1Q0PA 3KR2A 1T9DA 1ZLXA 3ME5A 4X6YA 1R4MB 4ZU1X 2A35A 1Y3BE 4W9MC 5CUQA 4MVJM 5LC1A 1S0UA 2I6FA 2XWSA 4J9VA 4DA7A 1ACLA 2CMDA 2YXNA 3DLBA 3BIFA 3C24A 4Z51A 1KI9A 2C8VA 2CFIA 3GT0A 2HIAA 2ISCA 3OTQA 4HFRA 2X0IA 1OZ0A 4JASB 3OQHA 3H16A 1J99A 1K6JA 1P2SA 1SBQA 1FFHA 1KVUA 3ILHA 3QBTA 4TWAA 1IXRC 3HJFA 1N6KA 1TYBE 3FDIA 4I55B 3IILA 1LQ2A 2W2OA 2XDYA 4WI1A 4WZZA 3SXUA 1FVXA 1GILA 4IXTA 3C8ZA 2P68A 1ZVKA 2XVXA 1PD1A 4MGIR 3I2YX 4CKBA 1I2ZA 2BOVA 3VGPA 1X70A 2WSLA 5TARA 5J4VA 5JRJA 1AKEA 3DE4X 3I28A 3E84A 1JDJA 1VGVA 5AO9A 4BO5A 1BEEA 3CZAA 4DUGD 4F71A 5F9HA 4C7OA 2DTEA 5G0SA 1EFHA 2B82A 2ONCA 2WUGA 3KQWA 5H3CA 3R7DA 1XVVA 1R8YA 3QA3E 4EK9A 1Y3CE 3GFVA 3CBGA 1P5JA 1DC7A 3CFYA 4Q02A 1NHGA 2JGEA 3PQCA 1COWA 1BEUB 4ZT2A 1S1MA 4KCGA 3FPCA 4GM4A 4QUBA 3KU4A 4ETIA 4B9EA 1N2OA 3G89A 2QGFA 1V8PA 3VRHA 1OR8A 4Q9NA 4DIDA 2QRLA 5WRFA 2NXEA 4EUHA 2IT1A 2IUEA 2ORED 3IV9A 2OYRA 1K7FB 2BSXA 2I7DA 3NG1A 3M70A 4YALA 4ASUD 2FK8A 5JD6A 2ZBFA 3CG0A 3TR5A 1EWRA 2O2JA 5D3MA 2C9MA 5K99A 3O8OB 1IB6A 4PHFA 5KQMA 3P2YA 4FX5A 1L8QA 1DKMA 1UDAA 1T8RA 4TL6A 4E5SA 1CIJA 2NUTB 4HH1A 3UXMA 4MS1B 4HDMA 4JQOA 3SFTA 1V8OA 1ZU4A 1MPTA 4ND6A 2B1RA 5KYYA 3IUQA 1A9RA 2YNMD 4BVEA 3IKMB 3JQFA 2VP2A 2WNIA 1G7RA 1Z33A 4NH4A 3I6YA 2FA9A 1MJFA 3RHZA 1TNDA 3GFTA 5K6TA 1WY5A 2YN2A 3B6MA 4RDCA 3FTFA 1XMIA 2Z2KA 5HUJA 2AXEA 4IRXA 5AJHA 4QDOA 2J3KA 3P9ZA 5ECYA 4UTOA 2IYYA 4WERA 2Q4BA 3RBVA 3WLQA 3ZI0A 5GINE 1EFPB 2J48A 3KXKA 1NAHA 4MGZR 3RARA 4DSAA 3P2MA 1OWOA 1NX6A 3H1TA 3EZ9A 3AVYA 4X90A 1DIOB 5IC6A 3JX9A 3U3DA 1BS9A 2WJYA 3QX8A 2MSEB 4M1WA 4RMJA 2Q6TA 1DZIA 2IYUA 3AYZB 2YTZA 4FGJA 4DYDA 1WY7A 3BMNB 4FHDA 4LBZA 4QNRA 3T5CA 5A4MS 2VDMB 2RGBA 2H5JA 3GPLA 3NEPX 1Z6GA 3MTBA 1OB2A 4H6XA 3G88A 1V8DA 3AWIA 3LZDA 4D3XA 3LLSA 1M8KA 1QWOA 1JEYB 1E61A 3QUCA 4JI1B 3SF0A 1IDOA 2NGRA 3DE5X 5ALWA 4JZYA 4KVZA 1OBHA 3REQB 4RLFA 4DUZB 1ZR2A 3VC3A 3KIPA 1U90A 1PBNA 3IBCA 3JQ9C 3UB4A 5DM60 3ZEIA 5H0IA 1P0FA 4LMBA 4G5QA 4LS3A 2XITA 1N75A 3G49A 3NIBA 1DE0A 4BBZA 1CG6A 1QK4A 2N1MA 2XQKA 2ZXUA 2ZYIA 1O95C 4TLBA 1EDOA 1QMGA 3IQXA 1LLUA 2DHRA 3LZCA 4UEQA 3SZGA 2W6ZA 4OQNA 4V0NA 5AKXA 1CUJA 5THKA 3ZDQA 2GK6A 4RULA 1LH0A 1VMAA 4JL8A 4E30A 4E2ZA 1QO0D 4RY8A 1UBFA 2D2IA 4WHMA 5JZVA 1W9MA 2XWJI 2GEKA 5A5GA 1G8PA 1B93A 2PM8A 1X1SA 2QPAA 4XQ0A 4NXMB 4WLVA 4KR6A 3KXIA 1T2UA 1U7UA 1AIPA 3HKBA 2H1RA 2N9UA 4ITUA 2BM0A 1VL8A 2VDLB 3GFSA 2QP3A 1NBMD 3LTNC 1X7XA 3NO4A 2GFIA 4KXQA 2I3AA 4QU5A 1XXHA 3QPCA 4G5YA 1SUWA 3CPSA 3C6KA 4HO1X 2DQ4A 2TRSB 3CJTA 3DOIA 4QU9A 1LDYA 1E2JA 1YB2A 2R1ZA 1JBQA 2G4VA 1C7ZA 3PLNA 3QP9A 1EBUA 1M1YB 2F1RA 3OI7A 4MRVA 5FTMA 2A9RA 4A5OA 3GVPA 1HPLA 1DBVO 2O52A 5BPFA 2AVDA 1TYEB 2GHIA 2WF5A 3LFUA 5AOVA 1WVMA 2JLSA 4E6PA 3ESYA 4OU5A 4XFJA 4IO0A 4LHSA 2OBYA 5FPPA 2BMJA 4CM9A 5AVSA 2JH8A 4J0DA 3L8ZA 1DG9A 1X15A 4IDHA 4CVNA 1PRYA 4UE6A 3GU3A 1XEXB 1ZSNA 1ZSYA 2DGDA 2DFKB 1E9RA 2JBAB 2LNDA 1XCLA 2OHOA 2ZJFA 3F98A 3MC1A 4OJMX 1U0LA 1YC2A 4PRZA 4QVKA 2MCFA 4YRGA 9MHTA 1RYFA 2PL9A 3LPMA 4JBHA 4RK4A 3EW9A 4HUJA 4KGVA 3UBMA 4GGMX 3D59A 3PX2A 1WUYA 3A6LA 3R09A 4D3ZA 5AVWA 2CDBA 4AJLA 2BY4A 2GGSA 3FNEA 1OVGA 1CZLA 4MRMB 1U7XA 3TPCA 4EUKA 3UJNA 1YMQA 2IPXA 1C1DB 2VJNA 5KINB 2YJ4A 1M0SA 1BZYA 5KWEA 3MINA 2P11A 3SQOA 3AERB 3NM6B 1N2HA 2EKLA 3KG2A 1J70A 3DEYX 4OHZA 3UHJA 3I45A 1UBKS 3PL1A 3ZLTA 4E5MA 2FMUA 3CX8A 2F62A 2R84A 3M1IA 3KJFA 1U28A 3QVUA 3UOAB 3VX3A 1CX9B 4TROA 1TT5B 4U3JA 4QLBA 3GCGA 4LY0A 5AVRA 1XAJA 3P2EA 3V1UA 2X2FA 3KWFA 3EQ6A 4RPCA 4RS3A 1QGUA 1HQYE 1W9HA 2WTEA 1L4EA 1KQPA 2WICA 4M1KA 3TZCA 4F06A 1U0BB 3BWBA 3JALB 2E7ZA 3HXKA 1G21A 4MIOA 3FYCA 4HAZA 5JATA 4XVUA 3UT0A 3ND9A 1S8FA 1YS9A 3CN9A 1ZSVA 4TZ0A 4IEFB 5J5VA 4W5NA 2SCUB 1O9BA 3VPGA 2Z6UA 4L5JA 4O2BF 4RVNA 3NBZC 3ZD6A 1GCAA 2PH7A 7MHTA 2HF8A 2VYVD 2WLSA 6Q21A 3ENQA 1A2BA 3ONVA 3IR5A 1AGXA 3JVDA 1IYZA 5IW8A 2JIQA 3QJGA 4XLTA 3AIMA 4CV0A 4D57A 2QN2A 1QTQA 2PWZA 5KAPA 5J2TA 1HYHA 1A8UA 3OOYA 4HGPA 1KPHA 3FSEA 4R1SA 3WQQA 2OP0A 4XIJA 4QXOA 5FWXA 4RTJA 3SSNA 3VJLA 2XA2A 1LPNA 4ND5A 5HKLA 1WU7A 3NW9A 1L1FA 4F2DA 2UUAB 4BO9A 1RAEA 1SUDA 1TUIA 4FWBA 3RK4A 4JJ4A 4BU1A 4CKWA 2H1OA 1WTCA 3NCTA 4RXMA 3X1JA 4G0WA 3ZCTA 3WK7A 4QECA 2X9QA 1PR9A 2JFQA 4K46A 3DKKA 4YJFB 3TMKA 1KK1A 1GQRA 5L4NA 1OZFA 2OBNA 3GEGA 3PEWA 3ELWA 1P2FA 3HCWA 4GVXA 1AQNA 1JX6A 1WHTA 3VAYA 1UH5A 4QGFA 2D8AA 1P2VA 2QAJA 1Q19A 3D8NA 4CLXA 1ZY2A 1F2UB 1E18A 4F2HA 4IYRA 5CXSA 3H05A 3ASZA 4M89A 4QREA 3RSFA 2E4YA 5IZ4A 3LY7A 3VVBA 1RU3A 1UK8A 5JH7A 3K15A 3OA2A 1U94A 3PQ4A 3IDFA 3ZX4A 1WW8A 5BY2A 1AT1A 3G9ZA 3NTQA 3AUSA 3N7UA 3PDIB 3UHAA 2Y1CA 3WSVA 2NSLA 1KYXA 1RJEA 2O4UX 5H02A 3VSDA 3AZPA 2VDKB 3MGGA 2BL4A 4MYHA 5CGQB 2DH6A 1NNI1 2GS9A 3RI3A 5K0TA 2IYRA 3VPAA 4QRHA 1YAHA 4F38A 1U1CA 2UYOA 3FMIA 3UMCA 4XUGB 3E2MA 2YFKA 4A26A 2ZRFA 3P0FA 4F86A 1LRJA 3QY0A 3R74A 1PJ2A 1BTOA 2P65A 4YCLA 3A6JA 2JLVA 4NBLA 4HPXB 3HL4A 2WC1A 3SICE 2QM7A 1AK2A 4F4JA 4ITVA 4EG7A 4E08A 3I42A 3V8BA 4HTFA 4NULA 1JAXA 4WLEA 5FWAA 5BWBA 3WHLA 1N5MA 3PFGA 1UMKA 5K8TA 3QU2A 3NNNA 1Z4MA 2CXXA 3ZU5A 2ZAYA 1R0WA 1TPZA 2PUEA 3NALA 4M9XA 4N3BA 5JV5A 1GUZA 1Z2OX 1Z18A 2X0EA 4DG8A 2P9BA 1UAAA 1JH8A 1ZGAA 4JMPA 2GBLA 1J39A 3G9UA 1WR8A 2C7GA 2RB4A 2WU0A 4U0KA 3EH1A 4MUMA 3CLVA 1S8OA 3L06A 4XB1A 3TAHA 3U09A 1GNPA 2VAPA 1WZIA 1BC5A 3LPLA 3NKLA 5CURA 1JG6A 3EC1A 4PR0A 5CJPA 2QZZA 2X13A 3DEFA 4NFHA 2ZJ3A 5HILA 3GCXA 2ZIXA 3SYMA 3KVOA 9ABPA 3AF3A 2AWNA 1L5WA 3K0EA 3QQ5A 5AVTA 4EQZA 2PT9A 2CL5A 2NV0A 3B51X 1S96A 1NMZA 2W2KA 3DS8A 3HH8A 3N76A 4GBGA 1SZJG 5F9FA 3IUBA 2OYCA 4DANA 4KWIA 3ZTWA 1A88A 3QI7A 5IK2A 4MR7A 3UC9A 1XZDA 3ZDBA 3L4BA 1XRLA 1NXVA 1OA0A 3DKRA 3RC2A 4CMBA 4TMTA 3EOAI 1CUAA 3E9YA 3S2FA 2RGNA 1G5RA 1JQLB 1Z0IA 3PNBA 1BMQA 4Y6GB 5IKMA 4YS6A 4MQFB 3I32A 3FVRA 5TPZD 1SCKA 5D51S 3RKSA 5BVHA 4B3HA 3OOWA 4QBTA 2A5GA 4E5NA 1T8WA 3CV3A 3OAAD 4UBKA 3GBVA 4LA4A 1V6SA 4EKYA 3TGWA 2RHOA 5CBPB 1FTNA 3U7IA 2ZUTA 4EVSA 3RKUA 2JAUA 4C2BA 2WTAA 1LRLA 3LDHA 4GYJA 4XYLA 3QSGA 4K05A 4MR9A 1SULA 1X7YA 1N9GB 3B6EA 4AIRA 4K6GA 2XKBA 5DOVA 3Q6MA 4EELA 2C9ZA 1DPFA 2FP4B 1KVSA 4RHUA 3CRNA 1W7AA 5BNTA 3OM9A 4UQLA 4WWHA 2Q6IA 1TM4E 4N39A 4HVAA 3RIGA 4WKCA 3MOGA 1JIIA 4L5YA 3H2GA 4QYXA 1ID8A 4RA9A 2OCAA 3KEMA 1G7TA 1QPBA 1BE8A 3MZ0A 1FNBA 4URVR 1VIYA 1AN0A 1CK4A 3W6OA 3L4SO 2J5XA 2FW8A 3DAFA 1KHHA 3UUWA 2X0RA 3HUEA 3LHIA 2BTOA 4Q3AA 1X1TA 4EMBA 2HFJA 1N9KA 1H5QA 1KI3A 2ODNA 3PHLA 4W63A 3T1VA 1UBOS 2QRJA 3A1NA 4FGKA 2IS4A 1Y7HA 3VSBA 4XFDA 2H1LA 3O9ZA 4D8YA 2ATIA 2D1TA 4K6FA 3TFQA 1DAMA 3M2TA 1JDSA 1V8FA 3HCAA 5G1PA 4UVIA 2BHSA 1KRHA 4AJNA 2B61A 1G9TA 4WACA 4TTIA 4HWOA 5E7JA 3W2HA 1I51A 4GYWA 3J81k 1GQSA 4HZUA 1GCUA 1UDBA 4XAQA 4ZO8A 3S70A 2NX2A 2XRFA 4X7RA 1XMPA 1HTWA 3K1AA 2F59A 1OAAA 3FY4A 4TL8A 3SNHA 1JHDA 1T5TA 1XCPA 2BFBB 2IEAA 4PLCA 4U00A 2O6HA 5LYJF 3LWNA 4UMDA 1G2PA 2MT9A 1BDBA 3BKWA 2QLBA 2YYZA 2P91A 3ABSB 4YJFA 1XLTA 4RH3A 4D9JA 4YRCA 3OAAA 1MX9A 3MA0A 2RGDA 4ID9A 4BECA 4KNYA 2HQBA 1P17A 3FM9A 2AQHA 4K9PA 3WS7A 5A0VA 2CJYA 3OO1A 4IF6A 3TVYA 4OKSA 1LU9A 3V8EA 1YBMA 3ZCRA 1XMQB 5BMVA 1JMKC 1ZD1A 3NHKA 4PC2A 2QX4A 2Q5IA 3BXPA 3N59A 5E3IA 4DR3B 3NYRA 3I64A 4EL5A 1C8LA 2PS3A 1UIRA 2GF9A 2W2TA 3DZHA 3E7DA 2EF1A 3L6BA 4NFSA 3TBHA 4IDDA 3RSHA 3RU2A 4DRZA 5C7IO 1M2FA 3QX9A 1PWZA 3H5WA 3U61B 3AY6A 3IP5A 3STTA 1QIMA 1Z0UA 3FXAA 1EEXB 1XQ9A 1HF3A 4Q82A 4P3XA 3DVLA 2JLXA 2CVFA 4BUJA 1YZQA 3B9RA 3DOOA 2YL2A 1QE5A 2VPYA 5K9ZA 4PZCA 4PGMA 1H2ZA 1NYQA 2C9BA 3QEBZ 4JSYA 1MW8X 2QTRA 3H86A 4URUR 1A9QA 3ZVLA 4I55F 4QPDA 1RPJA 3PD0A 4GR9A 4MQ6A 2B7BA 4O2LA 4EG8A 2X5NA 1EP3B 1ZNZA 3Q8MA 2F43A 3LUKA 1K08A 2VYNA 1QYVA 3ECAA 5FBZA 2ORWA 3ANSA 4CT0A 3AKEA 1YD7A 4ZI7A 2RC5A 3LC7O 2EX1A 4NI5A 1Z63A 3LL7A 1W73A 2IYXA 2OLJA 3DZBA 3HO6A 4LNAA 4B7ZA 1CERA 1KZYC 4IKEA 4JU8A 2BCJQ 1EA5A 1G8HA 4KN5A 3UK7A 5CIYA 1A95A 4LZWA 3ZXUB 5B2EA 3BJEA 3SDBA 2HY7A 1FMTA 2I1VB 4D8VA 4CM4A 3WGYA 2CNWD 1ZESA 3I23A 1XZLA 2WV9A 4RY9A 4WOCA 2QU7A 3U17A 3W06A 1ZBDA 3TFWA 3QKTA 2B8NA 2BGIA 3KS9A 4ZHQB 2D3TA 4LOHA 2ZWPA 3FAZA 5IJAA 4BRUA 4QYIB 3U4HA 1YTLA 2Y67A 5DXJA 3S3TA 3O4HA 5FTJA 1TK3A 4KG7A 2D2VA 1YJCA 3EPJA 3HBJA 2JZCA 2UUPA 3HJTA 4JY7A 3BPSA 2Z56A 2XW6A 1JEJA 1QYWA 2V98A 2F9LA 3JAKA 2QWXA 2GD2A 4EH1A 4FOSA 3FPJA 4J7CA 5CHYA 7ABPA 4YXFA 4LPKA 1MV5A 1E9DA 4LRTB 4R41A 3A4NA 1N2JA 3ZWDA 2H00A 2OP1A 4U9IS 4J4HA 2PGIA 3DP7A 1PJZA 1XNQB 1L4FA 3ACBA 4F11A 2ZJOA 3R23A 4R8KA 5BOSA 4I4TA 2YZKA 3H2ZA 5KVCA 1VSQA 2O2SA 1OLXB 3KB2A 2QD1A 1JDZA 1F0PA 1VJRA 2NSYA 4Q1AA 4NU5A 3FBTA 4L3VA 2R6JA 4YMWA 5DCUA 3VYVA 1NKTA 3ONNA 1HZZA 4OYYA 3SCZA 4L5IA 4EY4A 1PQ4A 1OXKB 3GDFA 1EESA 5EUMA 1VJ1A 5LBIA 5K0CA 3RRYA 3BFJA 4FMDF 3H9CA 1UPTA 3PDWA 1GGHA 3C41J 3DMYA 3O8BA 3BE8A 3VISA 4A23A 5BR4A 1RQPA 5EXSA 3ZDCA 2MDTA 2Q3DA 4MUHA 1SA0B 2R8XA 3FFBA 5BYAA 1YB1A 2NPFA 3GZJA 4V39A 1OWPA 1N8NA 1MRZA 3Q1KA 3Q2IA 5K6AA 1JT9A 2DULA 3QH4A 1DP4A 2BHLA 1QGUB 2XWBF 3M5PA 2PKXA 3IBSA 4ZEWA 4MW5A 5KWIA 3ESZA 1NXSA 1JEAA 2FMFA 2XJ4A 4RUKA 4PYJA 5EKTA 1W46A 3GMDA 2YZ7A 3KSZO 6LDHA 5DHAA 4OHCA 4RADA 2C7VA 2H1HA 3OQPA 4QUKA 4NYMQ 2EOAA 5AKZA 4E31A 2LD4A 5FADA 3ZWNA 1RVV1 4BP3A 1NLFA 3PD7A 1EK5A 1EGMB 3UF0A 5KYTA 1KNXA 4HBZA 3LPCA 1J20A 4CODB 3A11A 4ROSA 3PCTA 3DVQX 5CB6A 2QL6A 4YRLA 1J9ZA 3RADC 2IXTA 3W9SA 3R9XA 1GGNA 1W0CA 4E5UA 2YWEA 1B74A 4Y6PA 5CFPA 4IJWA 3HVJA 2C2YA 1GRNA 2I67A 4DNXA 1QKKA 3JTEA 4WOBA 4BMPB 3H3FA 4UZEA 4ZANA 5A1TA 1BD4A 3V8PA 5BPHA 4M8LA 1CUSA 4XWAA 3TSAA 3K7EA 5HR5A 3FPAA 4KZPA 4ZOBA 5EQTA 5IP5A 4EHDA 1MUUA 2JKYA 4H08A 2GOYA 3AHJA 1W36D 2H31A 4MOWA 5FOWA 1RAGA 3K73O 1TQ4A 1C7JA 4OUDA 1WDMA 3QYJA 4ZA2A 2IE8A 3ENVA 5T4FA 3SZOA 2FWRA 4PO8A 1H4VB 1OFHA 3JPWA 4KXFB 5TPWA 2HW8A 2Z2JA 2PZEA 2ZYRA 2YIJA 4GS5A 3V4PB 2A1UA 4BEBA 5KTOA 3LM8A 2ZWIA 4JI7B 4H6PA 1UFOA 4QT0A 3WGVA 5H80A 3CR8A 4EKEA 1CY0A 1ZW6A 3BSWA 4MVJH 4QO7A 2OXFA 3DFFA 1VZ2A 3NBUA 5ED0A 2AZTA 3EULA 3FZQA 4GGPA 2VUSA 4YEDA 3S2YA 4QPZA 2C4MA 4I3FA 3IDQA 3X2FA 1KZ1A 2BJHA 2CD9A 2J5QA 2YV3A 3QTTA 1WXHA 4PPFA 1OFTA 1EXWA 2QVXX 4NNPA 3RTEA 5JW6A 2V7QA 3T9FA 3WGKA 2F43B 4GI7A 4I08A 5EWMA 2BM1A 1XTRA 2PQ2A 2VK8A 4EG5A 5JQWA 2Q1TA 3GW8A 4EG0A 3EQ2A 4EITA 3HP1A 1U4SA 2I33A 1A5ZA 2VKTA 3MRXA 4GYYA 3TCKA 2IYPA 4IX9A 3ZE0B 4R9NA 1TJ5A 3FDZA 3T7RA 2VOJA 2ADMA 4W6QA 4YRBA 2E87A 4BKPA 1TYDE 3VR6D 2GILA 4D7AA 4R31A 1NX9A 5FF9A 5I9SA 2BELA 4GBED 3SZRA 1V1RB 1FDOA 4TQ9A 4C05A 2O05A 4YDRA 4EBBA 1JMYA 1JE1A 2R7MA 4J2HA 3HS3A 2GBLC 3E23A 4LKRA 1E4EA 2CF5A 5FRDA 1LPMA 4QUEA 3HI6A 3NDJA 1YQDA 3FNIA 4MINA 3K2EA 4RHXA 2PD3A 4CCYB 4L27A 3UMVA 4Y6LA 3CO5A 1VYVA 3R6LA 2B92A 5BYJA 1SBHA 3DL2A 4G2NA 4EL0A 5I4CA 4MV8A 2DCUA 4NSNA 4ALNA 4D45A 3S5UA 2O0KA 3M6UA 1RM0A 2W6CX 3NOOA 4BO4A 4N8SA 4M9SA 1CUXA 4YAOA 4EDHA 1HG1A 2J87A 4CFYA 4G8CA 1BXGA 3BL5A 1Z37A 3QBEA 3JY6A 1JKMA 3MCZA 4IH1A 3ZXYA 3BMNA 3IT0A 4W5JA 3EEOA 4QNMA 1J4AA 1LC0A 5D1HA 3H2JA 3I4CA 3DBRB 5KVAA 1T3LA 5FI3A 5AIBA 3IE1A 3RAEC 4PYQA 5A02A 1HKUA 1S3IA 3EZ6A 1YKGA 4QSHA 2XQVA 4FFMA 1E7WA 2ENUA 4O1MA 4PYIA 1Z2AA 1NFFA 4NOLA 1FLAA 2ZSEA 4EKDA 5TGDA 1XAIA 1TLTA 3CKMA 4PYOA 1H1LA 3LSYA 4OP3A 5AJVB 1GCIA 1RJGA 2X15A 5F51A 3TO5A 4WRRA 3P27A 2EP5A 3UJ9A 1QFSA 1A9OA 4CI0B 3STXA 5KX5B 2I29A 1SB8A 5ARCA 1SK8A 3ONFA 3JARB 1CUGA 3NAGA 4M0LA 3G3EA 3TYXA 1NTRA 1L5NA 2OB2A 1MEJA 3KP1A 1N3BA 3HJUA 5CX1A 2PSEA 3ANXA 3I72A 5ERGB 1Y6JA 3AIKA 3K5PA 1DZ3A 2HJWA 4AL4A 4OREX 3ERCA 1K5GA 4LGYA 4W5WA 3DLHA 1ATIA 3HACA 1NFQA 2NZWA 2NZ2A 5F78A 1NM5A 3P52A 2F7SA 4UPDA 5DBFA 1OH8A 4EG1A 4EVIA 1KFCB 3OX3A 4BQSA 5CDSA 2XA1A 3DZJA 3QU9A 1TM5E 3TLXA 3RLFA 2EBUA 1QP7A 2X9VA 4CMHA 2HSJA 4JJEA 4UNIA 3FZYA 3RK0A 2JANA 8OHMA 5JMTA 5IUNC 5ALQA 1TCAA 3SM9A 2OXCA 3EFOA 4M9CA 4AG6A 4IL5A 1JFTA 5F2OA 3DDHA 4Y98A 3W8NA 1LX7A 5F5XA 4X7BA 3R5FA 3PFBA 4ALLA 3CIOA 2FMIA 4PS1A 3I6MA 1Z4JA 4LC0A 4O2AF 5LA6A 2J5BA 3T7EA 1W19A 5LL6P 4OM7A 4K26A 5KAMA 4EYKA 5MDHA 1S7GA 4DN6A