2ANBA

Crystal structure of oligomeric e.coli guanylate kinase in complex with gmp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
206
structure length
206
Chain Sequence
AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
publication title Calorimetric and crystallographic analysis of the oligomeric structure of Escherichia coli GMP kinase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 65
structure length 206
sequence length 206
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 2anbA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2anbA01
1ETUA 1KI6A 1Z6GA 4HAZA 4IW3B 2ZE6A 4O2LA 4DUGD 4IRUB 3DKVA 521PA 2IUSA 1E32A 3BFXA 1OE0A 4NYIR 3PJRA 4OQFA 3G5UA 5UKDA 1S0UA 2VSXA 1P7CA 3OF5A 3OIVA 4A0RA 4JBXA 3U7HB 4K46A 2AL7A 5SZKB 5EUMA 2FSGA 3LLMA 4US1R 1EWQA 4HAXA 3L8ZA 4H1VA 3CONA 5LB4A 5EZ5A 3WRYC 3DMNA 2WVJA 4C0LA 1TU4A 1O3YA 3SI7A 4M9ZA 2JCSA 4B43A 1IN8A 4HUTA 2HJGA 3RHFA 2Q9BA 1GZSA 2V4ZA 4FCVA 1AK2A 4BZXA 4GT1A 1ZCAA 3ZQJA 4HDCA 1KO7A 4QXAA 5EE5B 1P73A 2V7QA 1D9ZA 4TMKA 4V0NA 4C7OA 3QI2A 1TF7A 2CCGA 1ZUNB 4BUJA 2P3SA 4NCNA 1RYHA 2D7CA 1SGWA 4TSFA 3RRZA 4NPHA 4Q66C 3OESA 2NO9A 1W5TA 2BEJA 3FHOA 1N5JA 4V0ME 1KO1A 1R0YA 3TW4A 2YJTD 1XXHA 4MDFA 3F5FA 3IQWA 2ZYUX 4DLWA 1TPZA 3EA5A 2EYQA 3K9GA 5HKKD 4EUNA 4P31A 1CEEA 4PAQA 4JJZA 4KYUA 2VHUA 2FFHA 3CX7A 3SBDA 5EXTA 3LDAA 4Q1BA 3THWA 3WNDA 2FPMA 3PEYA 4JLBA 4YMSA 3HDTA 1X86B 2PX3A 3C16C 1ZNYA 2XGJA 4F7WA 5AUNB 1U0LA 2VF8A 1UF9A 1IY0A 1G7SA 3MCAA 1ZD9A 3RRNA 3PENA 2VSFA 4HB2A 1MO6A 4HZIA 4OK3A 1JXMA 1PUIA 3EC2A 2RGXA 2YKGA 4QM7A 3GCGA 5G3ZA 1RJ9A 3L8YA 1KI1A 5FFMA 5CITA 4MYTA 1XFAA 3C5HA 1P9WA 1D6JA 4M9SA 4M53A 4KFTA 5JWRA 1E2QA 1X3SA 4WXRA 1T4GA 1W36B 4EPWA 5EJEA 1ANKA 2PH1A 3BERA 5G53C 3X2SA 2G3YA 1XBTA 1NNEA 1ZP6A 1PJRA 5F9FA 2QM7A 3QUSA 1OF1A 4NL4H 4WZAE 1XTKA 2QP3A 3AUXA 1KI8A 2MSCB 3AVOA 1NVVQ 5IDVA 2FDCA 4IDOA 4CW7A 1IJFA 4Q00A 5KSZA 4PQRA 3SJBA 1E2HA 3OEED 5BYKA 1T3SA 4CT5A 1NMZA 3TVDA 3SQWA 2R6CA 2QG6A 4Y0AA 1Z08A 4Q1FA 5AJVB 3H84A 5L3RA 3CZPA 1T8UA 1ZUHA 3O8CA 3VU9A 1LFDB 2CL7X 2FGJA 4GMXA 3IBYA 2WBLC 3NC1C 4DUGA 4QFMA 2IS6A 1Z29A 1T0HB 2W6IA 1DO2A 3MWKA 3VR1A 2XJ9A 4B6FA 4A36A 3LW7A 1KHTA 3DEFA 1SVIA 3PFIA 5FI1B 3WHKA 4BGDA 1AQUA 4PAMA 3OFND 1TQDA 2IC5A 2WAYA 3BFVA 2HXSA 3FKSD 2CJWA 2IBMA 2J45A 1G5TA 4U7DA 1NJFA 4DB4A 3ADKA 4D6PA 4TLCA 2GBLC 3R9IA 4CIDA 3L2OB 4YMUA 3K70D 4YMWA 1IOZA 2BHRA 2QENA 2GZAA 4LJ4A 1KDRA 3AF3A 4Q1CA 1XRJA 3HU1A 4JL6A 3BFKA 3CH4B 4LBVA 1HT2E 4JT2A 2XTZA 1IN7A 1KI7A 2PJZA 4D81A 5HR5A 1XTIA 3L0SA 4LJ5A 1UDWA 2W0MA 1NVUQ 5LBIA 1OV4A 3DM9B 2I4IA 3RSLA 3K0SA 4DT1B 2BKEA 1KSFX 2WWGA 1YZUA 2QTFA 3V4RA 1GWNA 3KJIA 1BYUA 3SOPA 4PHGA 1HE1C 2CHGA 2YV5A 2F3TA 4LCBA 1W0KD 3IUYA 1CJKC 4KJZA 2ZRJA 2O8FB 3ZJYA 1GAJA 1OFUX 4DJTA 1G7RA 3THOA 4BFVA 1ZUIA 2IHBA 3QF4B 1G19A 2C99A 3PITA 4FINA 4C0SA 3LX5A 2B7CA 3GJ4A 2QAGC 1LW7A 5IK2A 1CKEA 1N3BA 1R5OA 5BW8A 5JI3E 4JBYA 4WA7A 3U61B 3B1YA 2HCBA 3IPXA 4JT4A 4NU0A 3GJ0A 4ESVA 2Z5FA 2QP4A 2WKPA 1RVDA 1KO5A 1G5RA 5J4VA 1NJGA 5FOXA 2VA8A 1E9EA 1MABB 2DWPA 4TLBA 1LY1A 1ZC3A 1OSNA 2DFLA 2FV8A 2YVUA 3NKVA 4M2LA 1E2GA 4AG6A 1W0JA 2C78A 4Q9IA 2GXAA 1TX4B 2RGGA 1PVOA 1IHUA 3EZFA 2IYYA 2ODNA 3P4XA 3A37A 1OJLA 1ZCBA 3OIUA 3Q7QA 3B9PA 1E94E 3UK6A 3Q5DA 2AWNA 2ZE5A 3LX8A 4OHWA 2WJVA 4YXWA 3U7EB 3LBIA 2UZ3A 3EASA 1Z0JA 3FVQA 4DLSA 3OE7A 4RFSB 3KUDA 3UATA 4ACAA 5M04A 2PX0A 5H1YA 2XOKA 3UMFA 2XOKD 2WWFA 1XEXB 5FPTA 4DLYA 1TF5A 1AS3A 4GSYA 2BMEA 1GRNA 2W2XA 1M7GA 2DR3A 4A2WA 2BBSA 2IXFA 3CPEA 1R8QA 2N1BA 4GP6A 5FTLA 1X6VA 2UZIR 4HDOB 1NVWQ 2CLDX 1M7HA 4YMVA 3PUWA 2UKDA 1UFQA 1S9DA 5BN5A 3N70A 5EQTA 4IOLA 3EWAA 4LOAA 4PR0A 4IHQA 2ZRCA 2AXNA 5EE9A 1II8B 4ARZA 2CNWA 1VHLA 4LWZA 1DPFA 2G83A 2FSIA 4G5QA 4OQMA 1XP8A 3PR1A 4ITRC 4P4SB 1JAHA 1YZNA 3P4YA 1G7CA 2IT1A 2Q3HA 3CW2A 5EE3A 4I1UA 5FOVA 2QAGA 1KI4A 1F2UA 2VYFA 5FL7A 3VHXA 4HUQA 5CIQA 5FL7D 3AGQA 2PBRA 4BZQA 1OB2A 5GVRA 4C0HA 4ACBA 5JCZA 2GXQA 2W0SA 3IILA 1E9SA 2O5VA 3VKWA 2OSBA 1HT1E 1G3UA 3ASZA 2I1QA 5CDFE 3WMFA 1G5PA 1R0XA 1K8RA 1U98A 1P2UA 1SKQA 2BJVA 3R8FA 1R6BX 4MRRA 4UNNA 4US0R 1GM5A 3AF0A 3LWNA 4B74A 4H1UA 1UM8A 3GLHB 4JVNA 4W5JA 2O8EB 3A1SA 1JR3A 2WOJA 3MWJA 4I99A 3VR6A 1G8FA 2HT6A 4POAA 1JJ7A 2DFNA 1ZNZA 3KKMA 1E2LA 4UXIA 2QY9A 2C98A 1E2JA 1CR2A 2AFHE 2ZJ2A 3ND9A 4K81B 1P6XA 4WVFA 4A0FA 4YMTA 1G8HA 3HU2A 3EAQA 2OCPA 2O8EA 2KI5A 3NXSA 1Q22A 4B35A 1Q3HA 4EJSA 4Q4HB 4Q47A 5JJIA 1DAHA 1R4AA 4RZXA 4GI7A 2ATVA 1EX6A 4AKIA 2JLZA 1JR6A 4Q1EA 3VR4A 4M9XA 1BS1A 4MGIR 4PQFA 2ZI6A 3DOEA 1HEIA 3SC3A 2JLYA 1NLZA 5G3YA 2BMJA 2CK3A 2CVFA 4MUBA 1G291 4TMWA 4F38A 2J1LA 2HDNB 4B71A 4UNSA 1VMAA 4R2IA 2OBNA 4MDEA 1P9RA 4P4SA 3K9HA 5AR1A 1GVNB 4PC2A 1S2MA 4QGAA 1ZC4A 1IXRC 1FUUA 2ZRDA 1GL6A 2J0UA 4GOKA 2ERYA 4LYHA 3DMDA 4M1MA 2ZE8A 2ZIAA 2BMFA 2ZRNA 2OILA 5KDLA 3FHCB 1KK2A 1AKEA 2P6NA 5FBVB 1P75A 1WF3A 4PO1A 4KHZA 5KYKA 4DLXA 3ONWA 5KOYA 1M2OB 1M7BA 1FX0A 1RRPA 2IXEA 4LGMA 1VECA 5HZKA 2FZ4A 1RE0A 2GESA 3TE6A 1M6NA 1JR3D 2IWHA 4E5UA 2BBOA 3FWYA 3NBFA 1E1RA 4ZIRB 1W46A 4N1AA 4J0QA 1N0WA 5JSZB 2OM2A 4ZI3A 3AVUA 3T34A 3LRPA 4DZZA 2H57A 3Q9LA 2H8KA 4OI4A 1FOEB 4HAUA 1Z83A 2X2FA 3AV0B 3Q3JB 4HDQB 1N2CE 4Z1MD 3LVQE 4XSHA 5GADl 2MSEB 1TNDA 2AX4A 5C4MA 2EFGA 2JLQA 1XCMA 5TMPA 4UQOA 1GOTA 4BLSA 3ZD6A 2WPDD 5HCIA 4CRWB 4QBHA 5K8IA 1UBEA 1XTRA 5F2EA 1UKZA 2BBTA 1ZMXA 1COWA 4OQLA 2IYQA 2CEAA 3C4JA 4LPSA 4FI3C 2X2EA 3B13B 3ZYCA 3BRWD 1GNRA 2WWHA 4BQSA 1DOAA 4B33A 3LBNA 3C8UA 1G6OA 4B3XA 4KODA 4PPFA 1XTSA 4KV9A 3CR8A 4YXWD 3PUXA 1VG9B 2FMXA 2R6DA 2JLUA 4V0LA 3A1WA 3BWDD 3N5CA 2E1RA 4HYYA 2YWFA 3DZ8A 1Z0IA 4WIAA 1F60A 4A8JA 5CIWA 2J7KA 4M1KA 4RD4A 1E98A 4OL0A 3VHLB 1KI2A 5D3MB 5J4LA 4MA4A 3K0FA 5JZVA 1HURA 5TXGA 5DIFA 2QAJA 3U7GA 4QJ4A 1AM4D 1NBME 4HAWA 5KU1A 2O0KA 1TL7C 2ZSDA 3AM1A 4MGZR 1P61B 2GAAA 3KXLA 4DLZA 3CF6R 3SJAA 2GJ8A 2LCFA 4II7A 4YC7A 1R2QA 2A5JA 2CHQA 2KE5A 4TYNA 3FOZA 4NYMR 3KJEA 1Z0KA 4C0JA 5FOTA 2ZSAA 1Z06A 1E1RD 4JVSB 1RIFA 4PTLA 2XITA 4YDSA 1X8KA 2ZRKA 1AJEA 4ZI2A 1E0JA 1T3LA 2J87A 3ZGXA 3I8XA 1CIPA 2GHIA 1EK0A 1RRFA 1JR3E 1G3MA 1LS1A 1U8ZA 3I1FA 1P4SA 3QKSA 4RCYA 3PEWA 2YC2C 4MKHA 3W5JA 1KIMA 4PO8A 2RHDA 3HYTA 4DDUA 1PUJA 4MGYR 4BFYA 4AY2A 1CTQA 4M4SA 2CJWB 1E79A 4IDHA 1BYIA 2FH5B 5C46F 4URXR 1F3OA 1W44A 1NI3A 4S35A 2GDJA 4G5RA 2IYVA 1KZ7B 3TBKA 4OK5A 1SXJB 3SE0A 2BIFA 1CBUA 2J59A 2ZI9A 2JLVA 2B92A 1JEEA 4IDNA 2O52A 3CH5A 4B44A 3HPRA 4GOJA 3GLIE 4DCUA 4M0LA 4JLPA 3EPHA 2IL1A 4BLRA 1U99A 2I1VB 1VCOA 2W6JD 5CM9C 1Y63A 4IKEA 1Q1ZA 2AKYA 3MWYW 4KXFB 1E2DA 1Q44A 1YZTA 3K70C 2D06A 4PZZA 2YWGA 5D3QA 1KMHA 4O2RA 2HYDA 4G01B 1WQ1R 3TNFA 2J7PA 4NYMQ 4DKXA 4ZDKA 1OH7A 3TH5A 2ZYVX 2KJQA 2Q9CA 1E2NA 4ILEA 2F55A 3WY9A 4TL9A 3TLXA 2BBWA 3MWLA 3QENA 4LHVA 1JB1A 3SQXA 2R9VA 2D4HA 2ANCA 2C95A 4IXMA 4OHVA 4DDVA 3TUZC 3P26A 3WRXC 2JLRA 5FPYA 4LJ6A 3IHWA 4NTZA 5FBRB 1FP6A 4TZ6A 2AK2A 1E69A 5F9HA 1Q21A 4DSNA 1Q12A 2H16A 2Q0HA 5DN6D 1Q20A 2G88A 2FN4A 2O8CA 1AGRA 4UKDA 1OYYA 1XU4A 2DWOA 3G0HA 3QXCA 2C77A 1KZGB 3SEAA 1AS2A 4LHZA 3AF4A 1ZNXA 1JALA 5AUPB 2V1XA 1W5SA 2H1LA 4X8LA 4LPKA 4OQXA 3NHAA 4B75A 1BO6A 4Q9KA 2CNWD 5KUTA 3LH5A 4W7SA 3ZDQA 2WWYA 2WJHA 5FL3A 2ZSFA 3QBVA 4FN5A 3TAHA 3IQXA 3KQNA 1AA9A 1XMIA 2RGBA 4MYHA 1W4RA 4B3DA 1A2KC 1KAOA 1D2EA 2VP6A 4KYIB 3ZVMA 1E0AA 3DZDA 4KI0A 4DLUA 1G7TA 2GZHA 4TLEA 4A1FA 3ETLA 4D80A 5FTJA 3SYKA 3I62A 1S3GA 4C4PA 2ZE7A 1Z0DA 3F0TA 5C18A 2BKUA 1G8GA 4DEYA 1G21E 2JA1A 2NOAA 3AKYA 3GPLA 2ZJYA 2GCNA 3QEOA 1TF2A 2HEIA 2NO1A 2V6IA 3DOFA 4P4TA 1N5KA 4Q1AA 1UKEA 3OE7D 2HLDA 2PLRA 1H8HA 2GWHA 4EIWA 2OBLA 5DYIA 2NPIA 1COWD 2FPLA 3KQLA 3K8YA 3B9QA 4JYCA 3ZH9B 1FTSA 1CR0A 3K0CC 3AGPA 3IO5A 4MKFA 4URVR 5GJVC 5HTKA 4RD2A 3O8RA 4CEHA 5J5CA 1NL3A 1J8MF 1KJYA 2RH5A 3C5CA 4NE2A 3NBYC 4ZDWA 4HAVA 1YR6A 3UKDA 3AH8A 5DSZA 3VR5A 4G1UC 5HE9A 3IO3A 2RHMA 2PCLA 1J7KA 3R9WA 3AF1A 1GKUB 2C2HA 1W1WA 1NLYA 1NRJB 4JZKA 4RSGA 2ORWA 2ZRBA 2O8DA 3PEVA 4CEJB 2JASA 3AKEA 2O0JA 4V0OA 1EFRD 3NEJA 4A8JB 2V9PA 4PC7A 1M74A 4W5WA 5A0FA 2XSZD 2ZU6A 5EP2A 1AS0A 3HYRA 1RW4A 5E7JA 1KK3A 1G3IA 1MOZA 1NG9A 3NDBB 3ZZUA 2G9NA 4LHYA 4ZCMA 1WBBA 1XDBA 3GD7A 1CF4A 4C30A 4D0GA 4LBZA 2PEZA 2QZ4A 2R6AA 3CKLA 2XB2A 1P3JA 2WIAA 2DY1A 3AUYA 3TSOA 1OXXK 3GEHA 1ZW6A 2HCJB 3C14C 2OXCA 2PMDA 3AP1A 3FB4A 2GEDA 1CULC 3H1TA 1J99A 2GKSA 5DN6A 2GK6A 2CLCX 4PO9A 3TSWA 1PLKA 1KMQA 2ZUDA 4N0DA 1MV5A 2VRWA 3MAAC 2WPDA 5JWHA 3A4NA 1KMHB 1XWIA 4MRPA 4IEIA 4TYQA 1E9BA 3ICQB 1IXZA 2R44A 3FMOB 3QE0A 1OB5A 3JVUA 1V5WA 4XIGS 4F93B 2JDIA 1G1MA 1B0UA 3SN6A 1SVWA 2X1VA 5JMTA 3L0OA 3V9PA 2RGDA 1XEWY 1D8TA 2VL7A 4Q02A 4R9UC 2REBA 5KSPA 4WW0A 5BN3A 1UADA 2W58A 4Q4LA 4HLDA 3A8TA 3O8BA 2P65A 1L8QA 3T15A 3UXMA 4NZYA 2GA8A 4KFUA 2MMGA 5CDFA 1CJUC 2PLFA 4OI2A 1W47A 3L0IB 3IIJA 5BQ5A 2QUZA 2ATXA 4AYTA 1GNQA 2K5UA 2VHJA 1YQTA 3RS0A 1DAFA 3ZLJA 1XJQA 3B8HA 4D0NA 2WM9B 1KDPA 3CPHA 1N6IA 3WNBA 1DBSA 2R2AA 1GITA 5TB5A 3U4QB 4B6EA 2PJRA 3QKSB 1VKJA 5JS7A 1HYQA 4HZUA 5JEDA 1P2TA 2XNDA 1RZ3A 1R10A 1W7AA 3NBXX 1N0UA 2JLXA 1HQCA 5JLJA 1W36C 2Z83A 4Q4JA 1ZM7A 2DBYA 4PANA 4OI1A 1UAAA 1N6LA 2O8FA 2XTNA 2A9KA 3B6EA 3PXGA 2W83A 2QMEA 5TARA 2ZRGA 3HJNA 4LUCA 2YOHA 5BXQC 1RFLA 4E07A 1Z22A 4QJ5A 4EPRA 2ONJA 1E2FA 1OIVA 1I4DD 1NP6A 1S1MA 1CR4A 4LYFA 2HF8A 2VP0A 3EPJA 4AURA 4G0NA 1G4AE 2NPFA 2CXXA 5TV2A 2PCJA 4DDWA 4Q7LA 1GUAA 5K8UA 4OYHA 4HZUB 4JLVA 1JECA 1FMLA 5BN4A 1C9KA 2GXSA 4F4IA 2RCNA 1OFTA 4HLCA 2LWIA 3WNCA 1YR9A 2N46A 2XZPA 2J0QA 3IGFA 3PG5A 5DYGA 4LV5B 3DM5A 5TVKA 8OHMA 3B2EA 3ASYA 4CDGA 1YZLA 2CDNA 2Z43A 3G82C 3O47A 1XNJA 4MGKR 4C2TA 3SBEA 4F4JA 3AVYA 1R5NA 4B2IA 4BFWA 2ZJ8A 3EXAA 2E87A 4TT3D 2R8RA 2A5GA 5GJCA 4TT3A 4X8HA 1IY1A 4M1WA 5LB2A 3RRYA 2QAGB 3LXRA 1VDZA 3TRFA 4IOKA 4Q4AA 4AWXA 4B47A 1N5LA 1T9HA 2HF9A 2EFDB 2FGKA 2PL3A 1ZU4A 2V54A 5EE0A 3RWMB 1VG8A 2YINC 4L15A 3KZ1E 5JSZA 3VMFA 3RSOA 4ARZB 3SR0A 421PA 2CE7A 1X1RA 4BEBA 1KK1A 4BPBA 4CEIB 4XVRA 1Q0UA 4B3CA 5FUYA 1WE2A 4TN1A 4JKYA 1XEWX 3RS3A 3OZXA 2Q9AA 3W5IA 2BMDA 3RLFA 5A4JA 1IAQA 2VIIA 4BLOA 1QHGA 4XWOA 2DFKB 3I5XA 1SVOA 1VYTA 3BIFA 1GRQA 3TAUA 1GKYA 4WZBE 1UDXA 2H92A 2FFQA 121PA 3QNUA 3ZVRA 4D25A 2DYKA 4WOPA 1WRBA 1FUKA 1Z63A 1QG2A 1CRPA 1EFHA 1TQ2A 5FPSA 1NY5A 3KQHA 3VQTA 3BS4A 1MKYA 4RFSA 5L3QB 1TEXA 4Q4AB 4TWZA 4AIIA 2G77B 1IONA 5DLQC 2BV3A 3LD9A 3WP1B 3QEJA 1ZM2A 3X1XA 1WB9A 2EFHB 5TDHA 4URYR 3FYHA 4XJXA 4BRUA 1SQ5A 4JS0A 1IM2A 2IXGA 5H8WA 3CRVA 1KOFA 4I1OA 4DLVA 1TTTA 1I2MA 2QPAA 1SVMA 3IBGA 3O8DA 1L2TA 4JLDA 3NG1A 1P9NA 1YHNA 1QDEA 3WXMA 3TQFA 2Z0MA 3U3JA 2QPOA 4AK9A 2A7QA 2NG1A 2VP2A 2P6RA 2J5XA 1ESNA 1GSIA 4EJSC 5DH9A 1OIXA 2BM1A 3QPWA 4EJSB 3T1VA 3LW8A 2ZR0A 3FGNA 2RB4A 2FA9A 1WCV1 2PZEA 4LHXA 4URWR 3P27A 3QIAA 2VLIA 4L16A 4A82A 2J46A 1P2VA 5P21A 4I4LA 4ZV4A 4OHXA 2FJUA 3CNOA 2IWRA 4CEHB 4A6XA 4PPQA 1VIAA 1XD8A 5SZJA 1R7RA 4QNMA 3E1SA 2XZOA 1P5ZB 1GNPA 1NF3A 1S96A 3HPQA 5HPYB 621PA 2OFWA 4PAOA 3U2QA 4AC9A 2V6JA 4ON9A 1A7JA 1VYVA 2Q21A 3EX7C 1ZAKA 5FTMA 2UVQA 4M1TA 1E0KA 2NZ8A 2G0NA 1EX7A 1G16A 4A8JC 1SVLA 5JRJA 4A0GA 4RD1A 2HXYA 3VNVA 1ODFA 1SXJC 3LVRE 4FCTA 1U0HC 2OAQ1 1DAIA 1W36D 5AUQA 2CHVA 1OXTA 4OQNA 3WBJA 4L8GA 4TTRA 3UWKA 4JLKA 1CJTC 4IXNA 1HH4A 3EIQA 4TTPA 1NN3A 2ZJOA 1E99A 3ND8A 4QL3A 4BFXA 4M21A 3OHMA 2W00A 2JJ1A 2A5DA 1G4UR 3FFAA 4G5GA 1QHHB 2ZYWX 1J90A 4PHHA 5H68A 4QNRA 4BLQA 821PA 3I61A 1E9CA 1YRBA 3AP2A 5LDDC 2YC4C 1R0WA 3K0FB 2D62A 1Z2AA 4MYUA 4BZPA 2NZJA 3RWOA 1Z47A 3BC1A 3EG5A 4DSTA 3N2IA 1X8LA 4KCGA 2A30A 1EG7A 3QY0A 3M1IA 5AWFC 2C03A 5EP3A 1KY3A 4NCJA 3AVVA 4KBFA 1JNYA 2F1RA 1JQJC 2BJWA 1XB2A 5HCNA 3M0EA 221PA 1E9DA 4KLZA 5IHPA 4MKIA 3CO5A 2PEYA 2OUKA 1Z6XA 1A4RA 2GETA 4ZCLA 3J81k 1VPLA 3B82A 1PLLA 2PZFA 1Q3TA 3GEEA 4TLAA 3GJXC 2R62A 4HEJA 3QXJA 4PC6A 2J7PD 1YZGA 4HSEA 2GTPA 4LHWA 4GL2A 1WDTA 1S3SA 4B73A 4G3XA 4XSGA 4LJ8A 1LVGA 2WSMA 2HLDD 1MH1A 4W9MC 3A58B 4B34A 1KJWA 2EWVA 4A92A 4E22A 2W2TA 5JHHB 1KO4A 2I3BA 3BB4A 4TQUS 5FOUA 5JRZA 1NMYA 1R8SA 1T0JB 1NSTA 3SFZA 3U60B 4BFZA 4M9QA 2AWOA 4PC3A 2IEYA 2VSOA 3CF0A 2CCKA 4TTQA 4V03A 3BB3A 1ZD8A 2QI9C 1E9FA 2YWHA 4TQAA 5BYJA 1TAGA 2P67A 4LDJA 3QF4A 1F5NA 2O8DB 2DHRA 3C41J 3A4LA 2IYWA 3CRQA 4G5OA 2J0UB 2G1KA 4PX9A 4DXAA 1QHHA 1UKYA 3CUEF 4RZ2A 3T5DA 2F9MA 1SULA 3TMKA 1NMXA 4X8MA 2JIZA 4TMZA 1L4YA 1OXVA 2ZRAA 4QHYA 1N6NA 2SHKA 5J4KA 3MFYA 4QGHA 1HE8B 3OIWA 2GVDC 2REXB 5JCPA 2VH5R 4PHTA 2FZLA 3ADBA 1DAGA 3ZD7A 2YOFA 3AQ4A 1CJVC 1Z5ZA 2FFBA 2HV8A 3EZ2A 2MSDB 2QRNA 2WMOB 1ZU5A 1U94A 2ZAOA 1G3QA 1D2NA 3RS4A 2RGNC 1CS4C 3TSZA 2OFOA 4B76A 2NMVA 3TW8B 2WJYA 1E2KA 2Z4RA 4X8OA 2ZETA 3RRMA 4LY6A 2IYXA 2JJ1D 4RCZA 1IN5A 2B7BA 2WSSA 4OI0A 5CK4A 2IUUA 2IW3A 2CL6X 2V55B 3BORA 3CM0A 3Q7PA 4WBSA 2ZU0C 4JKIA 4B2LA 2IF0A 4GZLA 4YDHB 2ZRFA 4BEJA 3C15C 4LZZA 5D3MA 4DCSA 4NONA 3LA6A 1IN4A 2GEVA 4XWKA 3CPJB 1E4VA 3U5ZB 4A6PA 3U6KA 1CP2A 2BCGY 2JLSA 3GLHA 3IHLA 1GKIA 2VPPA 3TIFA 4D4LA 2FG5A 3KKQA 5DI9A 1ZM4A 1FQJA 2GF0A 1ZM3A 2Z6VA 3KB2A 4LX0A 2EFEB 3L43A 3B60A 5DHFA 1J8YF 4JLNA 2QE7A 2O8CB 3RVBA 3BH0A 3OEHA 5KPJA 4HAYA 1N0VC 2C96A 2XEXA 4CT4B 4Z8YA 1U81A 3GJ6A 4RFVA 4H9GA 1EFRA 4ZCIA 5L3QA 4C2UA 1OH8A 3HP1A 1WP9A 3PEUA 4GBMA 4P3YA 2ZS8A 2LKDA 4EAQA 3LLUA 5FOSA 4BRWA 5FTNA 1YJ5A 2FU5C 1E1QD 5FTKA 2X77A 3BOSA 1P2SA 4ZIRA 2WWXA 3TVTA 1UKVY 2AHOA 3MUFA 3K9LA 4Q18A 2JAQA 2QPTA 4S2EA 3RC8A 5SZIA 1QHYA 3SYNA 3U3MA 4ZDJA 2RKOA 3KXKA 1OXUA 3PUZA 3W90A 1DTSA 2WKRA 1U9IC 2QL6A 1N5IA 3GJ3A 5C1BA 1F48A 2D2FA 3EIEA 1W4BA 5KO2A 4AKGA 3NH6A 4MQBA 2QMOA 2BDTA 3WMGA 1F6BA 1JQLB 1JBKA 4L5BA 4EPVA 1XD2B 3AEZA 5J4YA 4CEIA 1G20E 4Q7KA 2VF7A 1QHIA 3THWB 3OAAD 1MO3A 1MRSA 3MSXA 1ZM9A 1KDOA 1YZKA 4FCWA 2OESA 3KJGA 4D0LB 4CYMA 3CNNA 3A6PC 2C04A 4TL7A 3F3YA 1Y3AA 3FMFA 2C9YA 5L3SA 5C2JB 4JLJA 4Z1MA 3CB4A 1XMSA 2ZRMA 5CK5A 5FBQB 4Z8XA 4U5XA 1E96A 1IXSB 4O25A 4KITB 1P72A 3FFBA 1DG1G 1XZPA 2EYUA 3OEHD 1E2PA 1TEVA 5EP1A 4DCTA 4TSFD 3KB1A 1R0ZA 4ZPXA 4Q4HA 4HB0A 3ZZTA 3M6AA 4OKSA 4I1SA 1KKMA 3VTKA 2VHQA 1G8PA 3FE2A 4I81A 1XZQA 1RKBA 1DO0A 1SVKA 1DVRA 4DC9A 3DVLA 2WAXA 5KHOC 1NY6A 4MITA 1QBKC 1GG2A 1U2RA 3OEEA 3QBTA 5AJWA 3H4MA 1YVDA 5DI3A 1U8AA 1KNQA 3EC1A 4DEXA 5E95A 3HR8A 3H2YA 1K5DA 2PMKA 4Q7JB 2KBEA 5E4FA 1US8A 3FKQA 4NH0A 4IJMA 4A0HA 1A1VA 4EPYA 2JLWA 2GF9A 1CJMA 1P60A 2XAUA 4JVMA 1JJVA 1P62B 3SFVA 4IVQA 4Q4JB 1E3MA 4EFMA 2DFTA 1U9IA 3U3RA 4BFSA 4GPTA 4XD7D 1Z2CA 3FTQA 3K53A 4YLGA 1PV4A 2QTHA 2FE4A 4HUQB 4NCKA 5EUQB 3I4LA 3VR3A 4KO8A 1E9AA 2J41A 4KFRA 2R6GA 2NTYC 2WV9A 3A1TA 1F2UB 1DEKA 4QC2A 2QMUA 2BOVA 2OHFA 4B48A 1Q1EA 3W3AA 2PT7A 2DCUA 3VR2A 2WIBA 3DPUA 1T91A 3EW9A 1I2DA 3V4FA 4QG7A 2XX3A 1II8A 3HWSA 2GJAA 3JVVA 2ZUCA 1S9HA 2IYTA 1EFTA 1F2TA 3T61A 1I4TD 1U0JA 2NO7A 3X1ZA 4BECA 2CVHA 3QG5A 2RAPA 1W48A 4QKQA 2FPKA 4HI0E 3W34A 1C4OA 4KSBA 2VO1A 3OAAA 5EE1A 4A15A 2L0XA 4OHYA 3E2IA 1Z07A 1SVSA 1E2EA 2B21A 2WTUA 5IT5A 3OFNA 5CB8A 5ELXA 4AG5A 3GJ5A 4R7ZA 1J70A 3DDCA 1XTQA 3THXB 3REFA 2D3WA 2IYRA 4F92B 3WP0A 2V3CC 4NCHA 3PVSA 3CIOA 4P0TA 2P6UA 3D6TB 2EU8A 3CRRA 3I3SR 4DLTA 721PA 3T1OA 1LF5A 1NG1A 1E6CA 3X1DA 3SS8A 2AK3A 4QBGB 2DB3A 3EZ9A 3KDSE 2OLKA 1GL9B 1SHZA 3A36A 2H18A 3SJZA 3C7KA 3ZS8A 5KDDA 1RPZA 5EZ6B 4RKEA 5JBQA 3K1JA 4EFLA 2HYIC 1OHHD 4I1VA 2BCJQ 4L9WA 1QRAA 3PQCA 4JL8A 4FWIB 1AZTA 4ZKEA 5TY0A 4BWYA 4UNQA 1KO8A 5DNYB 3Q72A 3WYAA 1MO5A 1ZD1A 4R98A 1BKDR 3IIMA 1TQ6A 5EXXA 2ZAMA 1KAGA 4XVQA 1RYFA 4O3MA 3A1VA 5IK2D 4FXPA 4JYBA 1X8JA 4PZLA 1OFIA 5FUVA 3CF2A 3D31A 5JS8A 3PV0A 1FFHA 1YKSA 3KFVA 3NIBA 4IDQA 2ZJ5A 1GTVA 4QM6A 1II9A 5F98A 2WICA 2O0HA 4EDHA 2GCPA 1FQKA 4CEJA 4LI0A 1QG4A 3MMPA 4OHZA 2QM8A 3AVPA 1WA5A 1QHXA 3D8BA 3E70C 5HZHA 4URUR 2F1HA 2FEMA 5C4GB 3TKLA 2YNMA 2XXAB 4W5HA 4JLAA 2AFIE 4RY2A 1XJCA 3R7WA 4UJ5A 4DT1A 5FPKA 2PZGA 1OXSC 3LAWA 1D9XA 1SKYB 3EZ6A 4XD7A 1FNNA 2XSZA 2QTVB 4IEEA 2QGZA 2GEUA 3SHFA 3AKCA 1A5TA 3TK1A 4EFNA 3QXSA 5AJZA 5KSOA 3UPUA 1XPRA 3U44B 2B6HA 6Q21A 5J4HA 1H8EA 3K09C 2QU8A 2DPXA 2GRJA 4OBEA 2ZI7A 3GEIA 3AVQA 4FMCB 4PQYA 3THXA 1DELA 2CL0X 2TMKA 3V00A 3RS2A 2OCAA 3NHBA 3QJYA 3UANA 1W4AA 1BH2A 2GXUA 1AQYA 4AI6A 1OKKD 4ASUA 3LQRA 3N2EA 4ZO4A 3B1VA 3Q8XB 5FH9A 2AXPA 4V0MA 5A5GA 3ZS9A 2ZSEA 2YZ2A 2P2LA 1ONBA 2ODWA 4F91B 3AKDA 1H8HD 2KB0A 4E03A 2Y8EA 3KFXA 3ADDA 2CBZA 1TMKA 2XNDD 4HB3A 3FHTA 4TQ9A 1QHNA 3CWZA 3SDZA 1NKSA 2BC9A 1FW6A 2JGNA 3MG9A 5JI2E 1KGDA 2EW1A 2BWJA 2QQ0A 3LNCA 2ANBA 2F9LA 3NH9A 4HLQB 1OHHA 1LB1B 1KYIA 4LV8B 2VTKA 5L8VA 5CJ2A 1Q1BA 2ZRLA 1IJEA 2GBLA 2JJ2D 2V1UA 2W2VA 4NMMA 4KVAA 2F3RA 2IS1A 4FIDA 1YR7A 4FMBB 4IVRA 4QGGA 4BE7B 4US2R 1EESA 1VCMA 4JMPA 1OPXA 4KBGA 2NGRA 2IEZA 3GLIB 2ZQ5A 3KKNA 5GJBA 3T12A 4RD3A 3K70B 1O87A 2ZI3A 2GJKA 1YRAA 2C9CA 2WMNB 5J40A 5KTYA 1PZNA 3VNUA 1BMFD 4C0KA 2QBYA 1SXJE 2ZR7A 3QVVA 2OLJA 4R2HA 4DLRA 3QKRB 2OXRA 2NO6A 1NIJA 3ICEA 1KY2A 3GFOA 1VIYA 3K09A 2J9RA 3T1QA 2V7QD 5AJYA 3ECCA 4KLNA 4TLDA 2VP5A 4TYWA 1W49A 4FMDF 4B3BA 1CXZA 4NKRA 2B8TA 4G5SA 3GJ7A 3PCRB 3CLVA 3TUIC 1E4YA 1XMJA 4ABYA 2AKAB 1KSJA 1UBFA 1GFIA 3QQ5A 4RD6A 2G6BA 4KFSA 3WYFA 3GLGA 1D5CA 3SU8A 4DSUA 5L3SB 5HKKA 3UG6A 1XPUA 4IFEA 2REOA 4DIDA 5FBLB 2DWQA 2BEKA 4FMDB 2ECKA 2IYSA 3IIKA 1HA3A 3RS7A 3AVTA 1SXJA 3R9XA 4Q48A 4ZDIA 3AB3A 4P32A 4EPXA 2VEDA 3S1AA 1FNMA 5E7MA 2OG2A 5E3HA 5AUOB 3QKUA 2QQEA 4NP6A 4C7OB 3I92A 3TGPA 4EPTA 4N3NA 4OJKA 1ZYUA 3AF2A 4PXAA 2ZXUA 3QXXA 2GNOA 5G41A 2OCBA 3KL4A 4D4KA 2IS2A 5CLLA 1DAEA 1T8TA 3CWQA 1EFCA 1NKTA 4PZYA 5CYPA 3X1YA 5B58C 1FTNA 3QG1A 4DSOA 4AKEA 5IF9A 1JI0A 3FKSA 1R5BA 1LTQA 5JJKA 3EA0A 2WJJA 4WXPA 1Z8FA 4Q9JA 3QVUA 4MRVA 1S8FA 4M1OA 3U6BA 3E5HA 4C0AC 4D4MA 2A3RA 5DGXA 1N6OA 4Q21A 1HQYE 3LFUA 4C0BA 1XCPA 4WZ6A 2QP9X 1Z28A 2IHYA 2JJ2A 1VCIA 2OE2A 5FI0B 1KJZA 3MJRA 3TUJC 4A2PA 1VYUA 4Z51A 4NCIA 1HTWA 3M4YA 1HY3A 3CRMA 1KI6B 1NIPA 3SYLA 3UMRA 1XCGB 1QHSA 2O8BB 1K5GA 1DAMA 1XF9A 1QVRA 2JEOA 4EQ6A 1HUQA 1GDDA 1KI3A 5LD2B 2WOOA 4P4UA 4GZMA 2ZRHA 3K0EA 1YU9A 4ERNA 2KWIA 4FW9A 3EZ7A 3THYB 5E7IA 1AGPA 1DADA 1Z0FA 2MMCA 4UXHA 3ZQ6A 3DKPA 4EKDA 1XTJA 1CRQA 2ODBA 4EQ6B 1C1YA 5FR1A 4QJ3A 3GFTA 1N6PA 4BASA 1EXMA 1Z6TA 2WZQA 5F3WB 4TYYA 2OT3B 3GP8A 2OZEA 2ASEA 1FP7A 2ZR9A 3UMSA 2IF2A 1E79D 1K6MA 1RC8A 4OK6A 4BLTA 1VHTA 1XEFA 4LSGA 4XVUA 3P20A 1WXQA 2A78A 3WHLA 4RJLA 1UBGA 2CLSA 3RYTC 3RAPR 3W8NA 1ZVQA 1UEJA 5GJWC 3ZIAD 1GIAA 2YYZA 5DO9A 4D4JA 5B57C 1ZIPA 2P5SA 1HV8A 2CMKA 5FR2A 3VX3A 2HT1A 2Q6TA 2IYZA 3OIYA 1FZQA 3D7MA 4IOMA 3TR5A 2IK8A 1RJ9B 5J47A 5H70A 4GDFA 3FDIA 2QROA 1G3RA 1LV7A 3IDQA 4PFSA 2QT0A 1FX0B 3W8RA 4QHTA 2IA5A 2IS4A 4WAUA 2FFAA 4TZ0A 4UNPA 4AYWA 3IEUA 5JHGB 4DB2A 2IYLD 5B2ZA 1T3HA 1Z0AA 2H17A 1KKLA 2XXAA 1XD9A 3QXHA 2FWRA 4JVLA 1WBDA 3RNLA 2ZJZA 4PHFA 3R20A 1NBMA 1YR8A 2VQSA 2WJIA 3EWSA 4QBIA 5AK0A 1QF9A 2ERXA 1DE0A 2ZRPA 4DHEA 1N6RA 4OJQA 2YHSA 1MO4A 3I32A 2JDID 5B64A 2FSHA 1H65A 1YE8A 2ZROA 2GJ9A 4NYIQ 4GRAA 5KDOA 3U7FB 1XXHE 3GLGB 3LO5A 1E1QA 1NVXQ 3NTUA 2F1JA 3KTAB 1KTVA 1AIPA 1NVVR 5KNDA 4V0KA 3BK7A 4C3ZA 1E0SA 2GCOB 2WKQA 5CJPA 5G40A 3DO6A 3NDPA 2WWWA 3EPKA 1JPJA 2QORA 2WSSD 4U02A 3FMIA 2ZTSA 4LV6A 1IN6A 1W0JD 2P5TB 1DARA 2R65A 3PIRA 4QGFA 1EFUA 1DG3A 1TUIA 1XX6A 2EWWA 3BE4A 4NBSA 3KQKA 4MRSA 3AP3A 2GAOA 3KUCA 4BFTA 2BM0A 2OCYC 3GLFB 2Q3FA 1OW3B 4LBWA 4PPNA 2OO7A 2FOLA 3CR7A 3D3QA 4LK2A 2GK7A 3F8TA 3ZZ0A 3GLIA 4GP7A 2NO0A 1JXOA 1ELOA 3THYA 3WMEA 3BXZA 3W3ZB 2QA5A 1VTKA 3ADCA 3K9NA 2XB4A 4AD8A 3KXIA 2V8OA 2XTMA 5JEEA 3RANA 4L9SA 2KBFA 3HU3A 2F1IA 2J3EA 2QRZA 4LRWA 1V43A 4C9BA 4E09A 3EPLA 2IX3A 4MH0R 3FPAA 2FX3A 1KK0A 5JJLA 4GFDA 5L3VA 4R71A 1U90A 1T5IA 1XPOA 3I72A 4A4DA 1CLUA 2ZRIA 3LV8A 2ORIA 2OV2A 3X1WA 4PSVA 2AN9A 4MYCA 1OT3A 1FL9A 3PUVA 2PT5A 2G0TA 2ZM5A 2XNSA 2EQBA 5EP4A 1MRNA 2B8WA 1AZSC 2QSYA 2WWIA 1E2IA 3ZVNA 2A5YB 2QSZA 3GQBA 4PPGA 2RGEA 4LYAA 3DL0A 5KNCA 1S4QA 2F43B 1JAIA 4P33A 4F4CA 2RGCA 1N25A 3BAFA 5FBWB 4TMTA 3CX6A 4IOJA 5KPDA 5IRCD 3CBQA 1NBMD 2J0VA 2QNRA 4D26A 3P32A 3JZMA 1OKKA 4ASUD 4M8NE 2QEQA 3TJZA 3ZIAA 5KSYA 4B3GA 1VCNA 4HLUC 4Y0VA 3CZQA 5BWMA 2C5LA 2FSFA 1XEXA 1E2MA 1BOFA 3KJHA 1US8B 2JIZD 4AKHA 4UJ3A 3BH6A 3DHWC 3P1JA 4FWTA 1LS6A 3B1WA 1NN5A 1NSFA 1XJ0A 3SHWA 3UG7A 4XH9B 4ZKDA 1LF0A 3TR0A 4RZ3A 3W6PA 2D7DA 4BLPA 1PLJA 4LBYA 1N6KA 2FEOA 3VFDA 2GZDA 2C9OA 3GLFA 1T5LA 1LNZA 3R7WB 2ZREA 4LC1A 4Z54A 3LBHA 3I5YA 1KNXA 1NN0A 2WJGA 3I8SA 1Z6AA 3LXXA 3QKTA 4DIEA 2N42A 1SXJD 2ZS9A 3FMPB 2QE7D 3KKPA 1FMJA 4QHSA 1KDTA 2QT1A 4XWAA 1KSGA 1GP2A 1A2BA 1W0KA 3B1XA 5FUWA 3QPVA 3K0AB 5CLQA 2VHCA 1MABA 1QVAA 3B85A 2Q3MA 3K0AA 4Q9HA 2ZI4A 1UBCA 4JBWA 3L82B 3W6NA 4QRHA 1CR1A 3H0KA 3IPYA 4Q19A 2VHTA 5LD2C 1JPNA 1GL7A 3MJHA 2QGNA 3L0PA 3VKHA 3IEVA 1XMVA 1ZNWA 2CK3D 1SHKA 1RRGA 2YOGA 4MRNA 3TQCA 1W2GA 4M1YA 4BFUA 2ZS7A 5CYOA 2JJ8A 2G1JA 1NLFA 3IKJA 1BMFA 2KSQA 4LYJA 3AVWA 1J2JA 4JSYA 3ZVLA 2GILA 1N6HA 3NWJA 3RABA 5CM8B 3VAAA 3PUYA 2C8VA 1T6NA 4IFBA 3U3OA 2AD1A 3QOFA 2IYUA 2RGNA 4TMVA 4CF7A 2ZVPX 2W6ID 1G17A 4LC0A 1AKYA 5DHAA 1BIFA 4TL6A 1M1YE 3RC3A 2ZJBA 2EFCB 4PC1A 1RRCA 4JL5A 4DRZA 2LKCA 4Q01A 1OLOA 3BGWA 4L4UA 2A5FA 3B78A 1I4LD 1KI9A 3GLHE 3MD0A 4PSKA 3RDPA 4LJYA 4HLUA 4UNRA 2ODEA 5DISB 1G18A 2ZI5A 2W6JA 2ZPTX 1E9RA 1FPMA 2OFXA 1M34E 4GNKA 4CVNA 3QSYA 4MKGA 3T06B 4YQFA 3NEYA 1OH6A 3BD9A 3SJCA 4QOSA 1IBRA 2F6RA 4HB4A 1G41A 2RMKA 1EGAA 2D74A 4UXJA 3B1ZA 3I73A 4V02A 1TADA 3CRW1 4RZUA 1Q1QA 1B23P 1A82A 3EIHA 4MUAA 2CE2X 3BBPA 3GMTA 3LQQA 1QZXA 4JLMA 3W9YA 4JJKA 4FD2A 4GMDA 4JLOA 1VG1A 2A2ZA 5K8TA 1X1SA 5HE8A 1KSHA 4QBFA 3VU9B 4M1SA 4DBLC 4TYPA 5FUXA 4Q1DA 4JIMA 5CB6A 4XOIA 2VP9A 3NC0C 3A4MA 5B30A 1G64A 4M22A 3KKOA 4O0MA 3AVXA 3B5JA 2IUTA 1TU3A 4D2IA 4YONB 1JEDA 4LJAA 3U3KA 1TQ4A 4B3FX 4RVCA 3U44A 5AJXA 2VP4A 4KSCA 2NIPA 1OH5A 4HATA 4ESHA 2FF7A 4KAXA 4CGZA 1G8YA 1M8PA 4DDTA 4CZ2A 4U00A 2HJVA 3WBKA 1II0A 1ZJ6A 3UWOA 2CCJA 2E9SA 1TUEA 3MRSA 4NYJR 4DCNA 4RD0A 1W2HA 2GJSA 5JWOA 4Q9LA 1DAKA 4A9AA 3K0CA 2OBMA 1MT0A 2QMHA 1ZBDA 4TL8A 4Q7MB 3Q5EA 2Z4SA 2XJ4A 3UIEA 1G6HA 1GRRA 4Q03A 4LJ9A 4PSAA 4FMCF 4IVPA 3A1UA 2GCOA 5DI3B 1ZRHA 5JECA 3T35A 1ZINA 3KTAA 4RKFA 1OYWA 3BB1A 3T5GA 3BJIC 3HR7A 3CX8A 3GFPA 4URZR 1EWRA 2H7VA 4B32A 3QPUA 5FPHA 2OAP1 3U4QA 1L4UA 1MR3F 3T1TA 3MLEA 2J0SA 2ZANA 3GLFE 2XZLA 2RGAA 1OIWA 3NVAA 3VKGA 4XTCS 3LY5A 4DWJA 3SNHA 5LPNA 5JFGA 3S1AB 4KVGA 3GJ8A 3R8CA 2NQ2C 3CNLA 5EXPA 5DE3A 3KX2A 3QF7A 1D2MA 4TMXA 3REGA 5GVSA 1Q57A 4NHOA 2ZEJA 1ZIOA 1AN0A 2F7SA 3BH7A 3SZRA 2ONKA 1NN1A 2BVNA 4B2PA 2VBCA 1IY2A 2ZUBA 1SZPA 1XXHB 3MGCA 4K8OA 1UPTA 3GLGE 1G9XA 1ESMA 3NBZC 1OFHA 2P0EA 1H8ED 2ZITA 1WMSA 4Q5IA 1S1CA 4LJ7A 4A2QA 2JATA 1XD2A 4C0QC 4NDZA 1SKYE 2WHXA 4JSTA 1UJ2A 2ORVA 3EARA 2GVZC 1GILA 3W6OA 2EVWX 3H86A 1L7VC 3WYGA 1U8YA 2X8AA 4AYXA 1IQPA 2H5EA 2YWEA 5EXSA 3QKRA 2F43A 2FNAA 3JZAA 2QBYB 1F2TB 5ANRB 1Z6YA 2QN6A 2ZYTX 4IDPA 4DCVA 1Z3IX 4N0EA 5K8LA 5KNBA 3KQUA 4NYJQ 5FOWA 3Q85A 3B7GA 2OEPA 3VX4A 5SZHB 4XTRA 2ZSBA 2ZVQX 1W4CA 1YZQA 2R6FA 1CU1A 2ZJAA 2AD5A 4KU4A 1UEIA 4GOXA 1DS6A 4DVGA 2AR7A 2X19A 3RS5A 2HUPA 2D2EA 4D82A 2O8BA 1VG0B
chains in the Genus database with same CATH superfamily
4P7FA 1G9TA 1KI6A 1L9XA 5AM4A 4IW3B 4HAZA 2PXCA 2IHNA 1Q19A 3DTNA 2IUSA 5IZ4A 3OICA 2PSJA 2RB5A 3BFXA 3CLSD 4TKZA 4Z2AA 3L0CA 5C80A 4A0RA 2RG7A 4JBXA 3RR2A 1M8JA 5SZKB 2FSGA 4JDPA 4PSCA 1FJGB 4HAXA 2ZBQA 5LB4A 1CDZA 1NUAA 4N3BA 1F4LA 5AW1A 4WDRA 4J0KA 4C0LA 3LE8A 1GTL1 5EN4A 4JB3A 1TU4A 3ZV4A 1WSDA 2IXDA 5B53A 2Z1NA 1VI2A 4DTCA 3NQ41 3RHFA 2DR2A 1TYBE 4LE2A 1AK2A 3IULA 1Y80A 1Y5IA 4GT1A 5DCUA 4BZXA 2GZSA 1WY5A 4MDYA 1O6FA 1V1MB 3NWPA 2O0MA 1HDCA 1P73A 3GGCA 3W8DA 1Q7BA 4ZVMA 5KS2A 1QAOA 3IV9A 1U9ZA 3RSFA 1W5AA 3OBBA 3U3XA 1AXRA 2ZWMA 3S55A 4BUJA 13PKA 2P3SA 5CHYA 1RYHA 4H16A 4P4GA 1JFFA 5BSRA 5K3AA 5J2TF 1NW7A 4V0ME 1YHZA 4RXMA 5LR6A 1ZLYA 3MPUA 2IPNA 1R0YA 2V0NA 1IHOA 2YJTD 3INNA 4YFYA 3HBNA 3S2IA 2VDLB 3TW4A 4C4TA 3FPFA 2JJMA 4FW8A 4MDFA 1T2AA 3C7CB 3T3EA 1BSVA 1HEUA 1SG0A 1U11A 3DYVA 3EA5A 2A1TR 5HGJA 2WJ4A 5JV5A 2EXXA 1CDOA 5A6VA 4M0DA 2XYPA 4TROA 4G37A 3O8QA 4P31A 4PAQA 3GAZA 5A4AA 3DYIA 1FFGA 3CX7A 3SBDA 2OLEA 3GFVA 2Q5IA 2YJNA 4U2KA 1GPMA 2RH8A 4X20A 1V8FA 4YMLA 3QLVA 3HDTA 5IHXA 3C16C 3HACA 2XGJA 4B83A 3L79A 2I03A 3SS9X 3T4UA 3USES 1HG0A 3FWNA 4WXMA 1J1ZA 2LGJA 1IY0A 4N82A 4RULA 1F2DA 1FBNA 3T7SA 3H5NA 4EI7A 1ZD9A 1X1DA 3RRNA 3PENA 1C9MA 2VSFA 4JYPA 4DV1B 1PUIA 1OZGA 4KR6A 2PKXA 2RGXA 2CW5A 3B6JA 1NBAA 3S2UA 2FPWA 1L7XA 1QZUA 3GCGA 2RONA 1NMQA 1BXGB 2ZB4A 1RJ9A 1N5RA 2PMFA 3AX6A 1KI1A 4QAQA 5DW3A 1S2OA 5T3YA 2ZBGA 4YR7A 1ZITA 3NU1A 5JWRA 4E2ZA 1E2QA 3WGHA 4GVPA 2B1IA 1M9NA 1SU7A 4WXRA 1JKJA 3ESDA 4P83A 1W36B 2FR1A 1FB5A 4WEQA 3D0KA 3ROMA 4FQ5A 1IFXA 4EPWA 1H2EA 3OZRA 4B7ZA 3GZ4A 2PH1A 3GUZA 3O1IC 4HK4A 1YB5A 1XBTA 1NNEA 4J7UA 4OLAA 1PJRA 1XYGA 2NU6B 4LA4A 4NL4H 4YO8A 5GY7A 1RD4A 1QAMA 2QP3A 3GU3A 1CWUA 1TD9A 3BK1A 4Q1VA 3UEOA 5HZMA 5EGNA 3O4GA 2FDCA 1CP3A 4CW7A 2Y1GA 3WGQA 1I1QB 4HCJA 4KQ9A 4DSAA 3C6QA 3C3BA 1GZ3A 1I6LA 1X38A 1NULA 1M6VA 2O3SA 2D2VA 2GYUA 3DO8A 4P34A 2FVYA 1N75A 4YGXB 3SVTA 1K3UB 4FFBA 1FDTA 1T3SA 4QPJC 3KVOA 3MYRA 4F6RB 4DR5B 4EYKA 2QG6A 2C9DA 3E2PA 1GCAA 3HZZA 2KLHA 4KB5A 2ETVA 3OD5A 3VR5D 3ZNPA 3DVRX 3CZPA 1YC2A 2B83A 2COUA 3M82A 4FFRA 5ALLA 3TL2A 3IBYA 1UJ5A 3TOZA 2NZ2A 2CNKA 4XYMA 1EIZA 3GWZA 2HPVA 3IDZA 4LF8B 3P9ZA 1DO2A 3HCPA 2XJ9A 3MJEA 1OFVA 4GPAA 4J0JA 2P7HA 1XN1A 1ZH2A 4X62B 1MC8A 1VLMA 1NTOA 1GL3A 2WUEA 1TQDA 3COWA 3ID6C 3OSZA 4DFDA 2VNAA 3BFVA 1BRTA 2YHUA 3FKSD 1WUHS 3SYRA 3LT5A 2CT8A 1OILA 5FLKA 1CHDA 2JGIA 4ZYZA 3GFBA 2M32A 3C1AA 1I36A 1SKMA 2HK7A 4W5RA 1PD1A 2DULA 3HG7A 3WDKA 1JDUA 3I04A 3F6EX 4Q1CA 5F64A 1XRJA 4WESA 3PNBA 4GGOA 3BFKA 2IY7A 4GOOD 4HHEA 3WWYA 3GUYA 2Q1WA 4I1IA 4JT2A 1A9TA 2PJZA 4GM4A 4DMFA 5HR5A 3NHRA 3UH1A 1XTIA 1PG5A 4I9FA 3NZEA 3T0IA 2W0MA 1NVUQ 5LBIA 1OV4A 4LQDA 1PS9A 2I4IA 4MI1A 1NUQA 2O06A 5FPQA 2WWGA 3LPNA 3M9XA 3D1JA 2H54A 2R8EA 4TKMA 1G8KA 2BDUA 2WMYA 4UBOA 4F71A 2F3TA 2BFEA 4J2TA 4BQNA 1YGPA 1UT8A 4M99A 4CCYB 1MPTA 3WIVA 3ZJYA 1SKAA 1GAJA 1WIWA 2Q3BA 4DJTA 2AKEA 1YB2A 3ZE8A 2C99A 1VJCA 3ZLVA 3VZSA 4EHAA 1YFLA 1N3BA 1GA1A 1GXSB 3DA8A 4NRDA 2K7FA 5IAGA 2I1WA 1GFSA 1JAYA 3IPXA 2NYAA 1IIRA 2NUPA 4NOMA 5ELLA 4N7MA 4BKOA 3B6ZA 5FHQA 3LDGA 2P90A 3AFGA 2JFOA 1RVDA 8AT1A 1AH2A 3G8YA 4B3MB 2ZGVA 3DP9A 3BMNB 2Q4OA 1PI3A 3P2OA 2Y77A 4OFZA 4Q7QA 2NU9B 4Y6PA 5I9MA 5BWLA 3O6VA 3THYB 1OSNA 1VJRA 3NKVA 4DW8A 3WB2A 3EEYA 3T54A 2C78A 2D5IA 1TX4B 1CQIB 2RGGA 1IHUA 3SFTA 3SEQA 3AR7A 2VWQA 2ODNA 4K9NA 2FQWA 4HFJA 1ZCBA 1YZYA 4MXDA 3EY9A 3LRTA 4QUDA 1XTVA 4OHWA 3WB1A 1SXHA 1UPCA 1ZQ1A 4NESA 3NB0A 1MAUA 4JJFA 4MHSA 4UU7A 2ZWOA 4DR2B 4DLSA 3L05A 1S7GA 1IVNA 5IN5A 1E7SA 4D45A 3GBVA 5H1YA 4WMLA 3GD5A 4JJ7A 2XOKD 4H7PA 3AZQA 4OMDA 1XEXB 3QYJA 2KX7A 1TF5A 5J1SB 1MRZA 3ORSA 3R3YA 3GFGA 5F5NA 1M7GA 1CSEE 2PA3A 3L7NA 4H7FA 1FW8A 5KTMA 4RTSA 3CPEA 2RC5A 1ULUA 4GP6A 1H6BA 1X6VA 2FR8C 5DM1A 2OGWA 5ILQA 2FQQA 4FZ3A 1OX6A 1Q6YA 2HJHA 4C29A 1M7HA 3F49S 3CVXA 4N6GA 1IZYA 3UJ3X 3VH4A 1GG8A 1WPRA 2UKDA 2WFZA 1XK6A 2IYNA 1JIQA 4IOLA 3EWAA 4PR0A 1YDEA 4BLUA 3RB8A 1VFNA 1VGQA 2B4RO 3SK0A 2HWYA 3L7LA 3PR1A 3SFVA 3RAJA 1JAHA 3OJEA 3P4YA 1JYSA 3U3ZA 3JQAA 3CR3C 4Y7DA 3B3JA 5FOVA 3KPUA 3H3XA 4DCCA 5JO0A 2VYFA 4JB0A 2DPLA 3IAUA 5F9MA 3EEOA 3VHXA 3LF1A 1H69A 4HUQA 1E0DA 3AGQA 2PBRA 1LI5A 5JCZA 2FRVA 2W2NA 3IILA 3SLRA 3OQMA 1SXGA 2O5VA 3H6HA 3VKWA 4EENA 2IIPA 2OSBA 4GNRA 4I50A 3W6UA 3TMAA 4H6WA 4QDUA 3DKKA 2FG6C 3IEXA 4KE7A 4R1LA 1PGOA 2AEJA 1G5PA 2WF7A 2A8YA 5CFNA 2I7CA 4DA6A 3RVPA 1P4GA 3ZNNA 1PNVA 1S6YA 3R8FA 1ZQ9A 3I9V1 1EU1A 4RK4A 4B74A 2UUBB 5HNKA 4E12A 4WKCA 4H1UA 2DC1A 2Q2OA 5BV0A 4MI3A 2YN4A 3MWJA 4I99A 4Y6GB 2IP4A 4POAA 4DV0B 4P0PB 5JO9A 3AILA 1E2LA 4UXIA 4WVFA 1E2JA 2AFHE 2XBMA 4PRKA 1P6XA 3I34X 4XX0A 1AQJA 2P2SA 3HU2A 1WHTB 1NTRA 2WA2A 3DAFA 5LMUB 1ZI6A 3HB4X 3HBMA 2A14A 5TMDA 4EVIA 1QH8A 4Q47A 4RK7A 2GEKA 3NO4A 2OYRA 1DAHA 4MQEA 1RWPA 4RZXA 2A9FA 4JGBA 1EX6A 3NXKA 1ENOA 2CXUA 4YACA 1Y8ZA 3AXTA 3GBSA 1OC4A 5LXTF 1E3JA 1EHIA 5BN1A 1M2HA 1JDSA 3E61A 3EMBA 4PQFA 2ZI6A 3DOEA 3EEIA 4ZU6X 2AMFA 4HNQA 3KT8A 3OCUA 1XZAA 5A4DA 4V3CA 2WE8A 4MUBA 2LBPA 1PWZA 6GPBA 3BTVA 3EGEA 1FEZA 3FCEA 4NZ9A 1NUTA 2HDNB 2QJWA 4ADSG 1KEEB 1UMBB 2OBNA 4R2JA 1FP4B 4DBVO 4MDEA 1RXCA 4F3TA 2YZKA 1PL8A 2VZLA 4JI5B 3V8QA 5C37A 1A5AB 3EPPA 5G02A 3P0RA 4UU1A 3EWNA 1R6XA 1FUUA 1SC6A 3K30A 4CHGA 4JP3A 4EW6A 4F84A 2WZDA 5L4SA 3KVNA 2ZRNA 2Q7DA 2OILA 1MORA 1BHJA 1P1FA 3FM9A 1KK2A 4QT4A 5B4UA 2ZM6B 2P6NA 5AHRA 1NZDA 4ZC1A 4PO1A 3ONWA 4BNNA 5CR9A 2DTXA 1N2ZA 4R7GA 5AOVA 2IXEA 5THXA 3P52A 1JWAB 2FZ4A 1LQTA 2FUCA 2HRQA 3SHOA 2B4YA 4PZDA 1JR3D 5DULA 3U39A 3VR6D 2DTDA 3AHIA 1TB4A 3ER9A 1C1DB 4LVNA 1W46A 4N1AA 1XA3A 5G0VA 3JQQA 1N0WA 4EQZA 5JSZB 3ZUPA 1X2BA 3EFOB 4UUOA 3T34A 5EIEA 4DR3B 2P91A 1SUSA 2IP1A 3AV0B 1N2CE 3Q3JB 4HDQB 4I1RA 4D9JA 4F2WA 4Z1MD 2ILTA 3G0CA 3L7YA 1DT3A 5SY9A 3VZQA 8MHTA 4KE6A 3EEFA 1NXSA 2EFGA 5CH5A 3QEBZ 5C1OA 3NORA 4EZEA 3KZNA 2QMZA 3T7DA 3TG8A 1Q0SA 1MEJA 3KLPX 3KQOA 1B15A 4BLSA 3ZD6A 2WPDD 3GVHA 3GUUA 4QBHA 4ZOAA 1XTRA 3V33A 3I9FA 3ENNA 4HDKA 5AW7A 4IG4A 1H2BA 1K4KA 3BE5A 4KQMA 4OQLA 5EMNA 4YMUA 2C3UA 3B13B 4Z4GA 3MTEA 3QUCA 1T3GA 1MX5A 2O2CA 3C1TA 5PNTA 4BQSA 3HV0A 2Q5OA 3C3JA 1ITZA 1G6OA 2V96A 2VHZA 1H66A 4PPFA 1FXUA 3R5KA 1XTSA 4W82A 1GPKA 1P44A 4ZI7F 3FRJA 2R6DA 2JLUA 2XF8A 3M6MD 4DC0A 2E5FA 3HCRA 1GTSA 4Q0MA 1Y5LA 3BUSA 4Y6RA 4ZYTA 2PVPA 1F60A 4WIAA 4YCJA 2J7KA 3FF1A 3KKZA 4B8WA 3QFFA 1E98A 5D3MB 4IS2A 1L7OA 1XZHA 4ZJUA 5TXGA 1F06A 3CSDA 4TV8F 4ZO7A 3AEQA 5KU1A 3AWDA 2O0KA 5BWNA 5IS2A 3LTNC 2HTEA 2ZSDA 3FOBA 4MGZR 4N12A 3AI2A 1P61B 2GAAA 3DLCA 3KXLA 3CF6R 4ALMA 4DLZA 4ARCA 2JBHA 2I91A 3BWEA 4MINA 5GMOA 3WWZA 3C7AA 3KR0A 1Q7RA 4NYMR 3LGSA 1GQYA 2PFKA 1JSRA 2XD4A 3S2FA 4C0JA 1HETA 1CIJA 1E1RD 2VP3A 1CVLA 3FA2A 4XLLA 3M5PA 3V7UA 4AJJA 1U63A 2DEUA 3S6JA 5EYPA 1JQAA 2FZWA 1QQTA 2VG8A 3HBLA 4I5EA 5L7WA 4M0EA 1QF7A 1MW9X 3NHMA 3QKSA 1U8ZA 3I1FA 2J3IA 2YC2C 3O94A 3T9CA 2HCFA 1IVYA 4XDHA 1G38A 5ECWA 1DIRA 4BC0A 3JQ9C 2XAAA 1FFSA 1DBVO 3LHKA 4AY2A 4MGYR 4BFYA 4FCCA 3TYXA 4HGRA 3O9VA 2NTNA 1HZZC 1V16B 3V6LA 2ADMA 1F12A 1YQUA 4JENA 3PSAA 3KYDA 1USUA 3ZWXA 1BVRA 2PKRA 1NI3A 3BG5A 5E3IA 4QQNA 4DQKA 2XXBA 3R5TA 4W1PA 4AQYB 3TBKA 2NU8B 3VTZA 5EHGA 2D1YA 1AC5A 2CXHA 4B7CA 2EWMA 3R6WA 4TGLA 3OZTA 5JAIA 2X3YA 4N7RA 1U3UA 3JTEA 1CBUA 2Z95A 4OU5A 4QT0A 1RLJA 2QTWB 2JLVA 2B92A 1JEEA 3CH5A 4B9EA 4PX2A 4E21A 4MRMB 4OXRA 3GLIE 2HU5A 1L5QA 3V8EA 3TE7A 3IXMA 1U8UA 1JHXA 1K3TA 1WXIA 2P4QA 4JLPA 4ZT4A 4BNZA 4LRQA 2DSNA 5JW6A 3QBJA 2OQ2A 4L57A 5CM9C 4EITA 4GR5A 1Y63A 4BKRA 1W4LA 5HKOA 1L7EA 5ICGA 3MWYW 1JHQA 3R5XA 5BR8B 4I4TB 4KXFB 1NDHA 4FYJA 4B9AA 3KJXA 4Q3EA 1TT5A 4EVSA 1Q44A 3BXEA 5K3OA 3VKUA 3K70C 2D06A 2IE8A 4PZZA 2YWGA 3OHSX 4NU8X 1KVRA 3S7ZA 2YXLA 3CHYA 3KXDA 5B7GA 4HDKB 1VHJA 4KDRA 2OZKA 1V5FA 4FB4A 5L4LA 2MOKA 2DU8A 4CF4A 1OH7A 3LHSA 1C7JA 1VDMA 2ZYVX 4OAPA 1KXJA 4MVJP 1I32A 3T8YA 2F55A 1CQWA 5IUNC 4TL9A 3T0FA 3MWLA 4PLWA 3KQHA 1RS0A 4HKTA 4BQFA 1EIWA 4OHKA 4X3OA 1RBQA 4MKXA 4R05A 3L6CA 1ADBA 4GM1A 3VMMA 1DHRA 1YACA 1NURA 4JI8B 3VSEA 2JLRA 4M83A 4R0NA 1THTA 1ZN2A 3M4ZA 3IHWA 3PGXA 5FBRB 1FP6A 2C1ZA 3JTMA 3JD3A 5FPYA 4TZ6A 2R1VB 1C30A 1LQ2A 3DW1X 4KYVA 5F9HA 3J7AC 2CXNA 2VWHA 4WLNA 1RZRA 1Q12A 1T2FA 3OLVA 3AUAA 2RHJA 4Q9NA 2Q0HA 1I3KA 1Q20A 2JBAA 3DULA 3IVGA 3NBMA 4IGFA 2G88A 5DN6D 5CB4B 3WYNA 5IMSA 4EZBA 1SCJA 1QC5B 3SEAA 1HFEL 1Y3IA 3ZQUA 1I6WA 1TLFA 2ZCVA 4ZCRA 2OCGA 3IPAA 1LK5A 2V1XA 2QR5A 1NFRA 4E32A 2DHEA 5ALNA 1P2DA 5G4LA 3S28A 1PEKE 2RH9B 4A8TA 3T3DA 4D02A 1NNSA 2XYRA 4DV5B 1ZH4A 4L1KA 1FVFA 5EVCA 2ID8A 3OJLA 3LH5A 5DLPA 3CZAA 1RIIA 3HN2A 4CNQA 1YZ3A 4WEOA 4FN5A 1LGYA 3IQXA 2JVKA 1AA9A 1T5OA 2XKJE 3TAHA 3TN7A 4NK5A 1XDGA 4G2TA 1W4RA 3OT4A 4DNFA 2AFIB 3F6BX 3WJ7A 5G1NA 4KI0A 4Q7EA 3NUZA 4DLUA 3CXUA 1U8FO 2GZHA 1OU0A 1MAAA 5FTJA 4BN5A 3SYKA 2NU8A 1S3GA 3WFIA 3N0WA 1TZCA 1HE4A 1Z0DA 4AB1A 4L51A 3UY4A 5GWXA 1Z3CA 2BKUA 4Y2UA 1PE0A 3PD7A 5FA5A 3EF3A 1V8BA 2GHRA 4NLLA 3E48A 3BMCB 3AKYA 1TUBB 3LTEA 3UICA 1J2YA 2HEIA 4G0PA 2V6IA 3DOFA 4MARA 2W4MA 4AF7A 2C5GA 3WLOA 2OBLA 2XUOA 5JQGA 1CE8B 2ZSJA 1AT1A 2NPIA 2EKLA 3RIEA 3K8YA 4I5IA 1WHTA 1J0EA 2X5NA 1A98A 3CZMA 3EOAI 4R1SA 3TQIA 3VHRA 4D97A 1AMOA 5LNK1 2W42A 3IO5A 4H0NA 3AO0B 2IOFK 3ONDA 4O29A 2PFSA 1MXFA 1S3IA 5IBRA 3RYFA 3VHQA 4KPUB 3NPAA 1NL3A 3TLBA 2RH5A 1UPXA 4ZDWA 4S1VA 3CTMA 4Q6WA 4IIXA 1Q7GA 1CZOA 3OY7A 4CMEA 5EFZA 1F7UA 4TWRA 5H83A 4YPFA 3PHGA 4WJKB 1ZS9A 4RPLA 4DXHA 1T0BA 2C2HA 1T36B 1W1WA 2V65A 2YWDA 1WX1A 4NU6A 1CJCA 5GP1A 3SIPA 4UTPA 4YMHA 2ORWA 1NVMB 3RHZA 1MJGM 3PEVA 4CEJB 3AKEA 2O0JA 2MSWA 3VPHA 1EVZA 2DXIA 3R40A 1SC4A 2F1OA 4HL6A 4PC7A 2ZT7A 4IICA 2H7CA 4PICA 1PWXA 4DG9A 4E5SA 1XE3A 3PXUA 1H05A 3G5AA 2JHAA 4NSNA 1LSSA 5E7JA 1LK7A 4J4TA 4KPEC 4WVLA 5A2GA 2Q49A 4RV9A 1O0BA 3TLEA 1IK6A 2FPXA 1H2FA 1XDBA 1HDIA 4C30A 3JWGA 1GNTA 4D0GA 1XCLA 5DYYA 3AERB 4C3UA 3EJ6A 5JBNA 2XB2A 2JFHA 4CIBA 5J1TB 2PIDA 3UUWA 1HFWA 3IXLA 4ZVKA 3TZBA 3DR5A 3COVA 5KHLB 1OROA 1ZW6A 3A06A 3C14C 5EJFA 5CA1B 3JZDA 5AHKA 1PEDA 1V47A 2CLCX 3C6ZA 4PO9A 3QYAA 1TVKA 5ER9A 3TSWA 4AICA 1P3Y1 2FQYA 1QZTA 2ZUDA 4XYBA 2C4HA 4OQDA 3TMYA 3NV7A 5KCMA 3EGOA 3UJ8A 5JWHA 3CW8X 4DQUA 4IEIA 4EG4A 1J22A 3FB1A 2CV1A 2JLCA 3NM6B 4MLZA 1EZZA 4MR9B 2O2IA 2P2NA 3EFHA 2RHOA 1V5WA 1Z4NA 3JVUA 4XM0A 4EVQA 3NIDB 2YY6A 4XIGS 2UU9B 2ONCA 2JDIA 2WIGA 4R16A 4TXMA 2C20A 2X1VA 1Z68A 2Y66A 3MTQA 1ZJZA 2ZB8A 1IMJA 1XEWY 4BMVA 4C2AA 3DT6A 5KYWB 4EOGA 1DJMA 1H4VB 4ND5A 1L5RA 1UADA 3WLHA 3A8TA 1Z0UA 4AO8A 3T15A 1BVYF 3UXMA 4E94A 2RCYA 3A04A 3A0UA 2MMGA 3AC0A 1E4EA 4LZLA 4OI2A 3WHIA 2NUTB 5EJ9A 1P1IA 1R00A 3BD8A 5IYZB 2OCLA 4CMHA 3ZLBA 3SQNA 4HDRB 1X7ZA 1RZVA 4MPRA 2CHUA 5F2NA 1KDVA 1O6ZA 2XQVA 1T9KA 4AYTA 3C6MA 4OLJA 4AP9A 4ARAA 1DKPA 2K5UA 1FQWA 1YQTA 2BFFB 4A7PA 4CIYA 3ZLJA 3L49A 2QWXA 5DLEA 2NU9A 3E27A 2WM9B 2Q0XA 3GOHA 1DBSA 5G0WA 4C7KA 5ALVA 5KYUB 4MA5A 5EXEA 3U4QB 4B6EA 2JCXA 2GAJA 5JS7A 1VKJA 5DYTA 2OV1A 4HZUA 3WAJA 4I7EA 3SZOA 3U19A 4KDCA 1HXHA 2WYVA 1Y8CA 2NW6A 5DM2A 2RGRA 4UCFA 1BXRA 3ZWNA 4GBJA 4N3CA 4EGJA 5AW4A 1FYFA 2OVBA 3UMMA 2JLXA 4L8YA 1W36C 4Q4JA 4UTZA 2XTAA 3L0BA 1XRNA 5LWHA 3MCVA 3NP7A 1GLNA 4Y30A 1SQ6A 2GYYA 1A96A 1UBOS 2GLTA 3B6EA 3PXGA 2BSAA 4REQB 2QMEA 4JUAA 4DMUB 2ZRGA 1T6YA 1GQSA 4QJ5A 1ACLA 5F4ZA 1U7ZA 1GGJA 3IUSA 2ONJA 2WILA 5JVDA 3KQQA 1I9CA 1CR4A 3BTOA 1YQ9A 3LVFO 1AG9A 2HF8A 3EPJA 4B6JA 1RKUA 3BULA 2TMYA 1EJ0A 5LYYA 4CQMB 3B3QA 1U3WA 4DIKA 3L92A 3NP9A 1OZ0A 3AW8A 3L8MA 3FKJA 3FPGA 4YEDA 1GUAA 1DKMA 1OXMA 1RAHA 4FPXA 1K8QA 3FUVA 1RWKA 4HZUB 3G6KA 3VU1A 4BQQA 1C9KA 4H27A 5BN4A 1U7PA 4F4IA 5LDGA 2V7EA 1OFTA 4GPZA 4HLCA 3C3MA 3EIFA 4RA9A 3DDSA 4AFNA 1YR9A 1N57A 2N46A 3IGFA 2AN4A 1RJFA 4BMSA 5DYGA 3U4AA 4UBLA 2NP6A 1XTPA 1KFEB 4CDGA 3I0NA 1GPYA 5KYXB 1QMPA 2CDNA 2Z43A 1O77A 1JQ3A 3O47A 2OXEA 1F9AA 1NUPA 4Z5XA 5I7WA 4NCXA 2ZJ8A 3PFFA 4FNMA 4KWEA 1L8LA 2F00A 2AI2A 2IHUA 3K35A 4TT3D 3VHXB 2A5GA 4BAZA 5KNBH 1FSFA 4X8HA 2YXEA 1W9MA 4FX2A 3PSHA 4M1WA 3O4HA 2ZB3A 3KU1A 4QFBA 1YXMA 3ENKA 1VDZA 3CPSA 3TRFA 3Q8WA 1E3DA 1T9HA 4UEKA 3TQOA 5JDCA 4G1VA 1LTHR 2HF9A 2XA2A 3W2GA 3O2SB 2I6TA 5HBRA 4IL5A 1W29A 3LPCA 4IO1A 421PA 3RSSA 1ADCA 2CE7A 3QSYA 1KK1A 4CEIB 3AG6A 4B09A 1MU0A 2PR7A 4B3CA 4CJXA 4S1NA 1EI9A 1EM8A 3RH0A 4CCWA 1WLYA 1WE2A 1GGFA 4TN1A 2WAOA 1D09A 3RS3A 1VLZA 5CB0A 2H3EA 5DXJA 1XF1A 2BMDA 3RLFA 1JU4A 1IAQA 1K6JA 1SU4A 4BLOA 1UZMA 4RIEA 1J8VA 1VL8A 5LQNA 1Z26A 3AM4A 1JHUA 2PMCA 2JIPA 1SVOA 1VYTA 3B6KA 3QP9A 2JARA 2QU7A 4J7CA 4OIFA 3TAUA 2VPIA 1ZMRA 1GKYA 4WZBE 5EQJB 2OY0A 5LKRA 3A32A 2FFQA 3OFSA 1WHSB 3QNUA 3G2NA 4R2WA 5FPPA 4Z49A 1O6GA 1D7AA 1D6NA 2X6QA 3JQ9A 1FUKA 1HK7A 1GNVA 1CRPA 1PG0A 5JQGF 4LXGA 2OV4A 4WGGA 5DXFA 4DABA 4QUGA 1MHTA 2QG9A 4XE5A 2JVJA 2TRSB 3DCYA 4RMNA 4WKGA 1PFKA 4LFCB 4HH1A 5JY6A 3DZKA 2Y0BA 2W9XA 1C8VB 3ERCA 3KPJA 4HLNA 3E3LA 4U2GA 1ACMA 4XPIA 3FOEC 3IALA 2EFHB 1THMA 1WXEA 1M5TA 1H1LA 3G7NA 4YRLA 5EEHA 3OBIA 1MIOA 2GSDA 3QVSA 4N6OA 1BS9A 3CRVA 3AEKB 2R1UA 1G55A 2Y4NA 3K4QA 4IUBS 3BX1A 2PQ0A 3IBGA 4QJBA 4Y1GA 4FK8A 4NXNB 1N1GA 1C0LA 2YN0A 2ZLBA 3U3JA 1P91A 4R81A 3HDVA 5JC1A 1RQNA 4K2HA 2J5XA 1ESNA 4C05A 4EJSC 4P35A 1RR6A 2LV8A 3SSNA 3E9EA 3QPWA 5BN4B 4EJSB 4NMWA 3MINA 1Z34A 2ZR0A 5BURA 1GKLA 4N3GA 1QQ7A 3GW8A 1RM0A 3U16A 4OLBA 4K9QA 3P27A 3QIAA 4NBNA 2VLIA 4L16A 1P2VA 1T0PA 1WNTA 1Y6RA 4I4LA 2JI6A 4H59A 2H63A 5AVKA 2YV1A 1DRUA 2FJUA 3CNOA 4OHXA 3WLMA 1M2FA 4JI3B 1O95A 1IEWA 4A6XA 1YA4A 2VXOA 4K86A 4BO5A 5CA1A 1K86A 5SZJA 1ONNA 4N01A 3WS7A 1VLLA 2W6NA 4RAOA 3I58A 1GNPA 2VHYA 1S96A 1U02A 1JA9A 2JCGA 1LRKA 2G36A 1FDSA 3MEQA 4MIEA 4AS3A 3AEXA 2OFWA 1L4NA 3UT5A 4BUZA 3OP4A 621PA 2JFVA 3KJQA 4HUJA 2E4UA 1IWOA 3M5CA 4R68A 2VUHB 4KGDA 3U2QA 2V6JA 4AXBA 1VYVA 1NA5A 2Q21A 1T9DA 1ZAKA 4IHJB 4WN9B 5NLLA 1QUEA 2CHEA 2RI0A 4NJEB 2H2HA 2EG5A 2G0NA 2R7MA 2Q5CA 4A8JC 3K6SA 1SVLA 1KEUA 3K2BA 4RD1A 2PGOA 4CMEC 1YGYA 3A1EA 2ZUEA 1U0HC 1BWSA 4U0KA 2OAQ1 4N03A 1OBCA 4URHA 2ACVA 4ZJZA 1G8MA 4BO9A 4QOHA 4QGBA 5E4JA 3SEFA 3QUQA 4JU9A 4H2DA 4JFAA 2I0FA 4RXTA 3AY7A 2VRCD 1U3DA 2ZVJA 5I5GA 1NN3A 4QL3A 2G17A 3ND8A 4AROA 4M21A 1A77A 2RIPA 4BMOB 1QRRA 1CRZA 5B2FA 4MJLA 5BQFA 4G5GA 2ZYWX 3C6XA 1EGQA 821PA 5AVXA 2GN2A 4QNRA 3I61A 2GPSA 2I29A 1EUQA 1E3SA 2QVLA 2UYGA 5DDIP 1E4EB 1Y4SA 1ZUD1 2D62A 3IUQA 3WGJA 4TVSA 1U2EA 4PYIA 5CH8A 4B3XA 2Q3DA 5L53A 1Z45A 3WA7A 3OC0A 2TS1A 3BXOA 3EISA 1CDDA 3RVMA 4ZANA 3IHKA 4PY2A 2GUWA 1JFRA 1HNNA 5IXYA 2Y27A 1Z5UA 4OYLA 5ENZA 2F1RA 3R3HA 4MS3A 4XRGA 2R6ZA 2P5YA 1CQJA 5BMOA 1N2JA 4KLZA 1S8NA 1MNAA 3ZHSA 2VDVE 4FONA 2QXTA 4G85A 4UASA 1IXYA 5K6AC 1FDIA 1NF9A 3VYTB 3B82A 4BXOB 1W30A 5CW1A 3GEEA 5JNWA 1M2NA 4IILA 1MX9A 2H00A 3V42A 3R44A 2PS0A 2J7PD 2VDPB 3I2KA 4HSEA 1F8GA 1M1XB 1H6AA 2V5AA 4D9KA 3I4FA 4B3BA 1Y82A 4G3XA 2IYOA 2WK1A 2I78A 3LECA 4ND4A 1X9HA 1WL8A 2GLXA 2HLDD 4H15A 1ISIA 1QG0A 2O1EA 4WECA 3V4ZA 4W9MC 1KJWA 5F2KA 2OMKA 3NCHA 4A92A 2W2TA 4JNCA 1PJAA 5JHHB 4RS4A 3AONB 1YIOA 2HX1A 2I3BA 5AW6A 3T7EA 2ZULA 3BB4A 2C59A 5FOUA 3R8XA 3HXOA 3ZGZA 3MGKA 1DFIA 4A2CA 4F5DA 2DWCA 3NS7A 3SFZA 1PTJA 1T13A 3ZPXA 1U80A 2AWOA 4MVJM 1AXGA 2W5UA 1CZKA 1OBOA 3KEGA 2CCKA 4CIWA 5HGXA 4AZ3B 2P9FA 4FBMA 2YWHA 1E9FA 4MRMA 3FFWA 4AW9A 1UT6A 2Q5EA 3D7NA 4FKBA 2CD7A 3OCXA 2BUBA 5SY4A 2VHVA 1XLWA 2O8DB 2WYUA 5DMXA 1FFBA 3DBRB 3HCNA 5IDWA 4NENA 3OG9A 2IYWA 3DV0A 3V48A 2F8TA 3LCMA 1T36A 4A5SA 2XBUA 3NYWA 3DJYA 5HJ7A 1QMGA 3JZIA 1QHHA 2C7PA 4MCIA 3T3HA 4MJXA 4AJKA 3ACCA 5D6OA 1M8FA 2JIZA 2XWPA 4TMZA 3KYDB 2ZRAA 1K88A 3LM8A 4A8PA 2SHKA 2C5SA 4MV4A 3DXFA 4GC9A 4QGHA 3RFFA 1PDOA 1P8JA 3DEHA 3OIWA 2O6HA 3O8QB 4BNFA 2P0YA 2BW0A 4V0RA 3TM5A 1T9GS 3DZFA 4K28A 2ZJFA 5C8DA 5AI4A 1DAGA 3A4TA 5ALWA 3ZD7A 1CJVC 1Z5ZA 2FFBA 2HV8A 3EZ2A 2CV2A 2XMQA 4C2BA 4KVZA 4YRGA 1NNLA 2QRNA 5FAKA 2GD1O 3FDFA 1NVBA 1Y9DA 2V4UA 2WMOB 2YZNA 3D6FA 2H1CA 2RE8A 4U8HA 3LIIA 5LM3A 3VU3A 5DZSA 1KVQA 2OFOA 1G66A 4RPIA 3RSHA 3KPWA 5AYVA 1EGMB 3U17A 1NC1A 4ENQA 1OOEA 2NMVA 2WHPB 5A06A 2PL5A 4IZ6A 5LA6B 2ZETA 2RHWA 3CZCA 2G04A 3SF0A 2IYXA 2QD2A 2UXCB 5K2MA 1FU4A 2JJ1D 4RCZA 4A16A 2B7BA 5K03A 4DDMA 5CK4A 1SBQA 5DEOA 1SHJA 3R7BA 3DAHA 3CM0A 2VYVD 1QLJA 4B2LA 1DC8A 4KRGA 1ULHA 3TCXB 2IF0A 1V25A 3EJWA 1U5CA 1NQTA 4YDHB 1KYYA 2ZIFA 4LZZA 4MO2A 4U63A 4BV3A 4QD3A 3UJHA 3TCNA 3CPJB 2RD2A 4PWYA 2AG8A 3ANSA 4HRVA 1CP2A 4F8EA 4OBWA 2JLSA 2OQRA 3IHLA 1T1GA 3R24A 5KYNA 7ABPA 3TIFA 1W94A 2N1MA 1DHTA 3G88A 4ROTA 2MU1A 3KKQA 3DEYX 4J07A 1ZM4A 2R6HA 3KPVA 1T9GR 1U65A 3HJRA 1L7DA 3SYMA 3JQBA 1XDZA 3KB2A 3S70A 4WBNB 3L43A 5J23A 4OQ4A 1RU3A 2L19A 3OA2A 3RFVA 1QDLB 2A9QA 1MCZA 4YRQA 3BXFA 3FGOA 5IZCA 1V5EA 3W9SA 2OYCA 4HDSA 1QFZA 1XDDA 1PR1A 2YIDA 2X40A 1C0KA 3TS1A 4HDNA 3L4JA 1H2WA 2OD9A 1U81A 3GJ6A 4JV5B 1EFRA 2YWJA 4LF7B 5IT4A 4KLRA 4E51A 1BMTA 1U2DA 3HP1A 1WP9A 3MTBA 1JLSA 2PL1A 3LY8A 1UWKA 3LLUA 4ROSA 5L3ZA 4E7OA 3PWKA 5BNWA 1SOVA 2FU5C 5K01A 2WHEA 4RHYA 3GRAA 5FTKA 1V2HE 5C8VA 3TVTA 1UKVY 2R7LA 5JXWA 3K9LA 4Q18A 4M89A 4S2EA 5JXGA 5SZIA 5MGBA 3FBWA 3SYNA 3ILHA 4U9IS 2IEIA 2C0QA 1ECCA 5KVAA 3G0BA 4HQNA 4XEUA 4DNXA 1Z4JA 4ZAFA 4DIBA 5KNCH 1DOHA 1V1JA 3DFFA 4ZO6A 1L1RA 2V58A 1TM5E 1TT5B 1X87A 4CU2A 1F48A 3BRWA 4O08A 2JI4A 5KO2A 2HRCA 1LBEA 2DLDA 3Q9UA 4NNJA 2QMOA 1GGMA 3OX2A 3WMGA 1C2YA 4L5BA 1K89A 4TWBA 5J4YA 2BGGA 1SA0A 3H5VA 1G20E 4UHEA 4LJRA 4N41A 5K4HA 2G06A 6REQA 2MYPA 2UUPA 4HY3A 4AJNA 3THWB 3OAAD 1MO3A 3PNVA 1QPZA 1RAGA 5FLYA 1U6IA 2V5UA 5E2BA 4MWBA 4D4GA 3RS9A 3P19A 3P97A 1KDOA 3SM9A 4FCWA 1DO8A 2ORED 1JE0A 4HNTA 2YZMA 2EG9A 2ZBRA 3GPDG 3CNNA 2PXXA 9LDBA 2C04A 2QM3A 4TL7A 3CF4A 2D8MA 1GU7A 4INAA 3UK1A 5HTOA 4JXXA 4DMRA 1JKMA 1Y3AA 3FCSB 3JR3A 3IOMA 3CNQS 4CG3A 5PGMA 2D6FA 1VOTA 2XB6A 4Z1MA 3CB4A 3ZGYA 2ZRMA 1A7UA 4U5XA 1G5HA 1E96A 1XZLA 1AY0A 1IXSB 1AF4A 2AG1A 1AUOA 2B99A 2HIMA 2Y9PB 1V16A 1P72A 3GP3A 1ZHHA 3H4IA 4NJMA 4TUYF 3SC6A 3OEHD 3K1ZA </