2AWNA

Crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
372
structure length
330
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALEVINQRVNQVAEVLAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
publication title ATP hydrolysis is required to reset the ATP-binding cassette dimer into the resting-state conformation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 77
structure length 330
sequence length 372
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2awnA03
2.40.50.940 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2awnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2awnA01
3U6BA 1Z06A 2SHKA 4RCZA 1E7ZA 2R6FA 3T1YL 4TT3D 1BMFA 1VG1A 3AF4A 4WOPA 4GOJA 4GMDA 2GVDC 4GRAA 5AUOB 1PH8A 4IEIA 1G6OA 1DG1G 3BIFA 1Q57A 2GZAA 4DR6L 4OX9L 2V54A 4QHYA 2IUSA 2VYFA 4XWAA 3U7EB 1TX4B 4DV4Q 1Q82C 2ZI4A 3LBHA 1NG9A 3JZMA 1SVKA 3CO5A 3GLFB 1OB2A 1XPOA 5JEDA 1CTQA 4ERNA 2ZANA 1DPFA 4MDFA 4HB0A 2PI2A 4LV6A 3CW2C 3RWOA 2XTIA 1XXHA 2G83A 4IOLA 4TL6A 1XJ0A 4A3CH 3MWYW 4DLWA 4JT2A 4BFUA 4V0NA 3RN5A 1CSQA 3CAMA 4P71A 5LMUL 3RAPR 4MYUA 5EAYA 4BBRH 1HUQA 3VNVA 5DI3A 5FTMA 2ID0A 1P8LA 1GL6A 3QKSB 4CEJB 4V02A 2J9RA 4DR1Q 5JECA 3KF6A 1U90A 5IYDG 2K5HA 1TQDA 4B6FA 4BZQA 3BJUA 3T1TA 1EG7A 2RGNC 4JSTA 4XWOA 4QJ3A 1M74A 3CCMA 4ACBA 1NLYA 4EJSB 3GLIA 4BFWA 1VQOA 4EQ6A 4JMPA 2WB1G 3H0GH 1XB2A 5IWAQ 3RDPA 1S72A 2FSFA 3CNLA 4POGA 4DLVA 2JE6I 3KQUA 2NMVA 2QGZA 3EZ9A 3KXIA 3T5GA 3OE7D 1AM4D 3SS8A 5DHFA 2ODWA 5HPYB 1X65A 1JMCA 2ZRBA 5JCZA 4RD0A 3S1NH 1AK2A 3GEEA 3CCUA 1D5CA 4FINA 4TMKA 1WYDA 3X1ZA 1RPZA 1HZ9A 4JV5L 4LC0A 4A3FG 3KTAA 4V0MA 1LVGA 3F3YA 3TRFA 1VQNA 5FLMG 2CJWA 2A78A 3VMFA 4BUJA 1C7YA 4M9SA 3GLGA 2OLKA 2JLWA 1HV8A 3DZ8A 4M4SA 1Z47A 3SU8A 1NBMA 3MWLA 1VQCA 4DV1L 4A3IG 1XPRA 2FEMA 3P27A 5BN5A 1XCMA 2J0SA 2V7QD 2JDIA 3T34A 1EFCA 1UBCA 1GNQA 3KUCA 3NBHB 3D7MA 1NNEA 1OIXA 3U5ZB 1Q1EA 1KO7A 3QF7A 1W1WA 2NTYC 1NKTA 3ZH9B 2C99A 4DCVA 2Z0MA 3UXMA 3GLIE 2Z6KA 2ZM6Q 4F4CA 4GOPA 3KQKA 3HOZG 2W0SA 4PAOA 4QM7A 1TF2A 2AD5A 4HLDA 4Q4HB 2B3GA 1Z0FA 4BFZA 5BW8A 4Z8XA 4CIDA 4NXNL 1E24A 4DIDA 1TXYA 5F98A 3R9WA 4DR7L 2ZS7A 4EAQA 1I3QH 2QENA 1BKBA 4L9WA 1K0RA 4Y52H 1T0HB 4MKFA 1P6XA 2QT0A 1WBBA 1H8EA 4A3LH 1UKVY 3OESA 4A6PA 5GADC 2R92H 1A63A 4P73A 3TEHB 3B9PA 4JLBA 4AQYQ 1ZM9A 1GITA 2UUCL 4LF4L 4HLUC 2VL6A 3DEFA 3GLHB 5GVRA 2CE2X 2QSZA 2NVQH 4LHZA 1NMXA 1JJ2A 2JA7G 1MRSA 2ZXUA 3BB4A 5J5CA 3KQHA 4IPCA 3CZQA 4QJFA 5FUYA 2IHBA 2O52A 2FFQA 3A4MA 4UNNA 1C1YA 2EIFA 2GN5A 1XFAA 2N1BA 4QRHA 3F5FA 5A0FA 4MTNA 4B35A 1DOAA 4C0KA 3MCAA 3I4MH 1D8LA 3BFXA 4MKGA 2O0KA 3RS4A 1Z29A 4Q4JB 2PZGA 1PH9A 2BJVA 4I1VA 1JJVA 2DY1A 1OYYA 2CMKA 3EC2A 2IS2A 1RYFA 1BH2A 2XAUA 2AK2A 2BDTA 2VUMG 1KMHA 2JCSA 1SKYE 4WAUA 2WAQG 4EPXA 2ERXA 1XTDA 4NDZA 4EJSA 4YHHL 4RZ3A 3GLIB 1HR0W 4PPGA 4DSOA 3VQTA 1DO0A 2PL3A 2FX3A 2BV3A 4HIMA 2ZRAA 4G0NA 3K7UC 2ZR0A 2VP0A 1MV5A 4QNRA 4PR0A 1CF4A 2Z4RA 1TU3A 4A1FA 2GRJA 2YTXA 5FLXc 4B34A 1G8YA 1KK1A 3FHWA 1TF7A 5EZ5A 3TGPA 4TYPA 2GAAA 5SZJA 3WNCA 2JLQA 2D74A 1DELA 1CIPA 1W7AA 1DAEA 2RHSB 4M1TA 2MFIA 2F3RA 4LF9Q 3JC66 4KHPL 2CK3A 3A5ZB 3NKVA 3WP0A 2WOJA 3LXRA 1AZSC 1G5RA 2CBZA 1NF3A 5FR1A 3VR6A 5K8TA 5LDDC 1VYTA 2OEPA 5L3RA 4JI1L 2ZRNA 1G291 1I4LD 4A3MH 1VQMA 2CCKA 4A36A 1B70B 1X56A 4RD4A 1KAWA 2A5FA 4UNQA 3ZLJA 3CMEA 3UDXA 1AGPA 4B3ML 2BC9A 1FNMA 2O8FA 3TIFA 5A4JA 3U44B 4K8OA 1XMIA 2J1LA 2B7CA 2J59A 3A1SA 4Q01A 1R5BA 3MEFA 2I0QA 1KAGA 3LX5A 4C0LA 3LDAA 5DYGA 2HIVA 5HY6A 2PZEA 1YZLA 1AQYA 1R8QA 1WA5A 2WVJA 3AUXA 4A4DA 2ATXA 3G0HA 4ZIRA 4OK3A 2GXSA 3JVVA 3SE0A 3E5HA 4PAMA 1NMZA 4UXJA 4DB4A 5LMNW 3FKSA 4GNXB 4Q03A 4PQFA 1G7TA 1EFUA 2RCNA 1TUEA 3S17H 3SEAA 4EPYA 1ZD9A 3OFNA 5KNBA 1FQKA 3UMRA 1E98A 2OG2A 2WIAA 4WBSA 1Y1VG 1MT0A 2J87A 2KI5A 1VQHA 3AF3A 1ZUNB 2ASBA 2ZI6A 2BCGY 2ZJRA 1P62B 2D3WA 4O2LA 5TXGA 5C46F 5GJWC 4DEYA 1X9NA 3I3SR 2B8WA 3WRXC 3BS4A 3W5IA 2VUMH 1TAGA 2F43A 2BBOA 1CR0A 2OESA 3DM9B 3H1TA 4LPKA 3STBD 4P33A 1N25A 5K8UA 2YKGA 2IS1A 4B3XA 1QZGA 3HDTA 2RGBA 1RL2A 1KNXA 5JEAJ 5ELOA 2C2HA 4PX9A 3Q8XB 3SYLA 1E9AA 4NHOA 4F38A 2ZE5A 4MYCA 1Z2AA 4HB4A 2W0MA 4A8JA 2A8VA 4XVUA 1E22A 1VCNA 3EG5A 4PPQA 1N5LA 1CJTC 1JR3A 2TMKA 4A15A 2R7DA 4DVGA 3K0FA 1SVWA 2BA1A 4P75A 3MWKA 4OQLA 3ZD6A 5KSPA 1M8PA 2EQSA 5H1SE 3LLUA 4V0KA 3FPAA 2PMDA 2XXAB 3U3OA 1DAIA 4AIMA 4KI0A 3T1OA 2VH5R 3L0PA 5H8WA 3O8RA 2VBCA 3L7ZC 2ZTCA 5J47A 1NLFA 3BERA 3MJHA 3CCQA 5AJVB 3KJIA 4DLXA 1VIAA 1ZM2A 4YC7A 1I50H 4R4IA 3RS3A 2HUPA 4NKRA 2F3TA 3I73A 4PPNA 5IK2A 1D8TA 1Q1QA 1NN1A 5IWAL 1E1RD 3KF8B 4NH0A 1YU9A 2E2HH 2J0VA 4R4QA 2IYSA 4CT4B 4LJ8A 1T9HA 1EFWA 2R9VA 4LF6Q 1XXHE 4QL3A 3WMEA 1HT2E 3W3AA 3HOXH 2RHDA 4BXXH 2UXDQ 4QXAA 1ZM4A 1IBKL 1SHKA 3H84A 1IM2A 3BZCA 3W5JA 4UNPA 2GETA 4GMXA 2XJ9A 1HT1E 2OCYC 2AFIE 3KFVA 4OJQA 2CNWA 3GTPH 2OTLA 1T8TA 5LMNQ 1WXQA 2GJ9A 4I99A 4C9BA 1QHHA 1W4AA 2Y0SG 2MNAA 1RJ9A 2K5UA 4A8JB 3VR2A 2H8KA 3I56A 1CJUC 2BEKA 3J81j 4A3KG 4GOKA 4RZXA 4LJAA 3EARA 2ODNA 1K73C 4NBSA 2O0HA 4UXIA 2WSSD 5EP3A 1W4CA 2QM8A 3J7ZC 2YWHA 2ZRFA 4DV2Q 3AEZA 3L43A 4X66Q 3T1YQ 4NYJQ 5J40A 2PT7A 3RC3A 4B47A 2JEAI 5HKKA 4MUBA 2ZSEA 4TLAA 4PC1A 2WM9B 4JJZA 3CF2A 2FFBA 1Z5ZA 1XTJA 1LFDB 4A4IA 4O25A 4LSGA 4DR6Q 5FI1B 4B75A 2PMKA 4D25A 3UANA 3WP1B 1QHHB 1T3LA 1FJGL 4IVPA 3M4OH 1KI8A 2R93G 4DKAC 4URUR 1VQEA 3S1QH 2ZRKA 2Q2HA 1OLOA 3R9IA 3BB3A 3JZAA 4DSTA 2VP5A 3NC0C 3CIOA 4AQYL 1G6PA 1QHXA 1I2DA 1SVOA 1XMSA 2XNDA 3I8XA 4LV8B 3BZKA 4YMWA 2OCAA 3DZDA 1TF5A 4IDQA 2ODBA 3ULJA 2GWHA 1OXXK 4KBFA 4TL9A 3EPKA 1JPNA 3KL4A 2YV5A 2MMCA 4LF9L 2PMZE 2HQLA 2N46A 3QPWA 3QSYA 3BH0A 2Z6VA 2QP9X 1YZNA 3TAUA 1KO1A 2NG1A 3DLLA 2NO1A 1X86B 3NHBA 5FOXA 4C0BA 2OXCA 1A4RA 2RMKA 1E0SA 2Z43A 3GLHA 3LY5A 4YONB 3HOUG 1UF9A 1U8YA 2QORA 2OE2A 1GFIA 2C96A 4PC7A 4M8NE 4RD2A 3CRMA 2W6IA 2BMDA 3V9PA 1KJWA 5JI3E 3QXCA 1IZ6A 5IT5A 1KI6B 4C3HH 3FDIA 1SXJE 4RFVA 4MGKR 2OV2A 1JQJC 3EN2A 4M1MA 2XOKA 3TH5A 5KSZA 1B8AA 1Q44A 5M3FH 2D0OA 4Y0AA 1HE1C 2Z6KC 4U02A 4ZDJA 1ASYA 2NN6I 1Q86C 3HOYH 2OFWA 1DAHA 1TQ4A 1ZINA 4AH6A 4JBKA 3AP2A 3BK7A 1CKNB 5L3QB 4LGMA 1DBSA 2WB1E 2NPFA 4LFBL 1W5TA 2EFEB 2AHOB 3MJRA 2JGNA 2LWIA 1M34E 3ER0A 2Q6TA 4ZCIA 4GPTA 4B76A 5C44H 1E2KA 3LH5A 5D3MB 2GA8A 1JQLB 4FIDA 3G5UA 1G64A 3GLGB 1E2FA 1RRPA 3ZVNA 1BYUA 1HZAA 4MGYR 2H1LA 3E9IA 3KJPA 4K0KL 1G3IA 2GJSA 4X65L 2XGJA 2OCPA 3I1FA 2J45A 2A3RA 2ZE6A 4WA7A 3KXKA 4LYAA 3CD6A 4AY2A 3WBKA 4KAXA 4WZAE 5FBLB 3UWKA 2CL6X 4IRUB 3ERSX 4JYBA 4PANA 4LF5Q 3HOWH 1UFQA 4JVMA 2O8DB 4BWYA 3HKZE 3M6AA 3OFND 1W5SA 1E2LA 4GOPB 2JEBI 2IUTA 2IWRA 1TUIA 4OK5A 5JRJA 4ZCLA 1LYLA 4ZKDA 2IF0A 2R7ZG 1XMOL 3AVTA 4DCNA 3K8YA 3QXSA 2VQFL 2DFKB 1XWIA 1NVVQ 3HR8A 2JATA 5AR1A 3GTOH 3FVQA 3W90A 1EQRA 2NO9A 3C5HA 3VR4A 1S4QA 2LKCA 4MDEA 1OFTA 2EWWA 1R5NA 2PBRA 3I4OA 1YJ9A 2D62A 1XTIA 2ZJZA 3SYNA 5KU1A 1E9FA 2Q2UA 4JLOA 3C16C 4Q4AA 1IBMQ 2IYZA 3EIEA 1UE1A 3K0AB 3E2IA 1GM5A 2QPTA 3I4MG 4B3RQ 1J2JA 1FTNA 1ODFA 2DWOA 2P2LA 3QVUA 2YOHA 5P21A 2ZJAA 1KIXA 5K36G 5CK5A 4JJKA 2K4KA 3UKDA 1KSJA 1GDDA 2YOGA 4V0OA 2BH2A 3T12A 1BYIA 4GNXA 1ZP6A 3HR7A 1N2CE 1CR2A 1NRJB 2E9SA 3VFDA 1EESA 5BYKA 3I92A 3ZVLA 4BY1G 4KHZA 5IYBH 1R6BX 4GKKQ 1XMVA 2AK3A 3GTGH 2X2EA 3BE4A 1SE8A 2VF7A 3RNLA 1CRPA 4FXPA 5FL3A 1EFRD 4NP6A 1EFRA 4BA2I 3AV0B 1ZC3A 1OW3B 3CX7A 4EUNA 1E2JA 1YHAA 2BH8A 3PIOA 2F1JA 2RGNA 2R92G 3L8ZA 2HT1A 3PO3H 4RD6A 4G5SA 1ZBDA 5KDLA 1X8JA 3OAAA 1AS3A 3EIHA 2OZEA 4GN5A 1YZQA 2J7KA 2XB4A 4DCUA 1KTVA 4KSCA 1Q22A 2P6NA 1GVNB 4BLPA 4DK6C 1Z6AA 2E2IH 2F1HA 3S1RH 3A1WA 5FOTA 4L5QA 4OHYA 1DS6A 4Q1CA 1CXZA 3A4LA 2E87A 2ZR7A 3AB3A 2W58A 2V7QA 4LF7Q 2OFOA 4IVQA 5DGXA 4JOIA 4BRWA 2BMFA 4AKGA 3J7A5 4L4UA 4M9QA 4NTZA 1CULC 3REFA 2O8CA 1P2VA 4IJLA 1IN5A 2JQOA 1R10A 4F4IA 2G6BA 1TQ6A 1IY2A 3PF4A 1R7RA 1Z28A 3GJXC 1HA3A 5EE5B 3VDYA 4B3SL 4B3BA 4OWTB 2FDCA 2V1XA 1VTKA 2OILA 4QOSA 4CT5A 2JLYA 3OEHA 4JBMA 1TWAH 2IEYA 1E32A 1KO5A 4LJ5A 5HTKA 5JZVA 4K46A 2NVYH 3QKRA 4RVCA 3QOFA 1L1OB 5C44G 1DAMA 2CCGA 4NU0A 4QGHA 4C2UA 1S9DA 4A3FH 4PZ7A 4DV3L 2GZHA 4F93B 2Q3HA 1KYIA 2VP6A 3Q85A 5J4YA 1LV7A 1MH1A 1NVVR 4YQFA 5KDDA 3RRZA 3EA0A 2E8GA 1E2MA 1FUKA 4XSGA 2FFAA 2QAGA 3LFUA 2RGGA 2OO7A 1QG4A 4KV9A 4PHHA 1TWFH 1SMXA 1U8AA 2GXQA 2GCNA 3TR0A 4EPVA 1TTTA 1SROA 3GJ5A 1SULA 5JWRA 5J3BA 2OSBA 1PH2A 4Q48A 2A5YB 4JI7L 2BHRA 3ADKA 1ZM7A 3X1DA 5E7IA 3T1VA 4BXXG 1KRTA 4NONA 3WMGA 2MSEB 2VHTA 5IYDH 1IBRA 4PQRA 1OPXA 1VQ8A 4GL2A 2CKZB 4GP7A 4TQAA 3K7AH 1J90A 1KI1A 1VS0A 4HB2A 1Q8KA 3HJNA 2QE7A 4RD3A 1XD9A 2ONKA 5C3EH 1EXMA 1C9OA 1XBTA 2ZI5A 2F1RA 1IXSB 4KVAA 1J99A 4IOJA 2VP4A 4W9MC 5F2EA 2VF8A 1ZW6A 4DR2L 2IS6A 2FPMA 5M5WH 4NYMQ 1CBUA 2OBNA 3FMFA 1I2MA 2ZE7A 2ZJQA 2VO1A 3R20A 2DFLA 3K9LA 2FSGA 2JJQA 1OFHA 1OFIA 5DH9A 5FUWA 3U60B 1QUQB 1OH6A 2V1UA 3CPHA 4NCIA 2OXRA 2V9PA 3UMFA 4JL6A 1NMYA 3LV8A 4DR4Q 4PC2A 3Q8DA 1L4UA 3A4NA 4U5XA 1HE8B 2AXPA 5B64A 2FGJA 1E3PA 4DV7L 4O0MA 4HAVA 2HIXA 1L7VC 4OWXB 4V0ME 3G71A 1G8GA 3HU1A 2WJYA 3AKYA 1KI6A 4LFAL 4MRRA 2R93H 2YWGA 1U99A 4TL8A 2ZJOA 5H68A 1LTLA 1IXZA 4BA1I 4OO1I 2UUAQ 1XMJA 4TYWA 4TMTA 4NCJA 4LUVA 4B2IA 5L3VA 4K81B 4TT3A 5E95A 3WBJA 2FSIA 3NG1A 1VIYA 1ZIOA 1KK3A 1UPTA 3Q7QA 2MMGA 4GNKA 3WHKA 1S1CA 3VX4A 5DI9A 1G18A 3KQNA 3I4NH 1RKBA 2VTKA 1WBDA 2I5LX 2Z4SA 1VQBA 4NCNA 3VR1A 3O8DA 3WYAA 2W83A 4UPAA 3ULPA 1S2MA 3AVOA 5G40A 4GLAC 1UEIA 3I2ZA 2CLCX 2OQKA 3NVAA 2ERYA 3IO3A 3J81k 3PEVA 2ZQ5A 3LRPA 4OQXA 4H9GA 4IVRA 4QFMA 1KK0A 3R7WB 4MYHA 3PF5A 3RSLA 3GFPA 3LGJA 2W6JA 1A0IA 1IJFA 2WKPA 2PI2E 1NBWA 1JAIA 2Q0HA 4JS0A 4D4MA 3RS5A 5KPJA 1IBLQ 2HHHQ 3W1GA 1S9HA 4DB2A 2XXAA 2RHQB 3LNCA 4LFAQ 2O8DA 1ZD8A 2QROA 2RGDA 4JCVE 4UY8C 3OYYA 4GNXC 2Q21A 4JI4L 1DADA 2DWPA 1XEXA 5CM8B 1WOCA 1N32L 2WPDD 4YCWA 4GFDA 4JOIC 3CH5A 1CJVC 2JEOA 5FPTA 3EBEA 3IILA 1E0JA 1E1QD 1WFQA 1Z6YA 4QNMA 2UXCQ 1IAQA 3LX8A 3Q5DA 5HE9A 3M9BA 1P9RA 2NO0A 2V6IA 4PTLA 3SGIA 4Z1MA 4QIWE 4CEHB 1YIJA 4LRWA 3DKPA 2VPPA 1QHIA 3A37A 1NY4A 3AM1A 2WSSA 2PX0A 4QBGB 2ZRIA 4DR3Q 4TWZA 3I7FA 1GNRA 2C9OA 4KLNA 4Q7JB 2PNHA 1G19A 4JI3Q 1WMSA 1UBEA 4M1SA 4MRPA 3GP8A 4C2TA 1MO3A 4HZIA 5FJ8H 3RLNA 2JLRA 2IX0A 2PEZA 2C03A 3KKMA 5IK2D 1QUQA 3RR5A 3UE1A 4IFDG 4Q1DA 2NO6A 2NIPA 2H57A 2O8FB 3BH6A 1Z0JA 3LBNA 4LZZA 1E9CA 2G0TA 3NHAA 2C95A 4LHYA 2BIFA 2JA6G 2WHXA 1YZ6A 3CC7A 1C4OA 2B7BA 2OAP1 1G41A 1NL3A 2QQEA 3M0EA 4B2LA 4AYBG 1NJIC 2ZITA 4DV1Q 1YRBA 1SRUA 1MR3F 3EWAA 4LC1A 5AJZA 2REBA 3UG6A 2VQEL 1CP2A 3ICQB 1N0VC 2OHFA 2PCLA 4PSVA 2JLSA 2ZI3A 3NEJA 1QHYA 2KB0A 2R6DA 2R8RA 1IBML 3K9NA 2WOOA 4Q4AB 4RZUA 5FTKA 1NY6A 3GEIA 3W8RA 5CB6A 4EFNA 2ZJ8A 1G21E 4BBSG 4NCHA 2NZJA 4JI8L 1WCV1 1PZNA 3Q7PA 4PFSA 5AJ3L 5JSZA 1E94E 5HCIA 3PEWA 1XMOQ 1H65A 4JBWA 2E5LQ 4L5RC 2WPDA 3L82B 4Q5IA 2IL1A 4LY6A 2H5EA 2G3YA 4C3IH 2ZTSA 4I4LA 4HJAA 3ZQJA 2IS4A 4DDTA 2WV9A 1ZNWA 4WJ4A 5HR5A 5LB2A 5AJXA 1E9EA 4M22A 1GVPA 4R1JA 4OK6A 1B7YB 5CIWA 4YCUA 1W2BA 1F2TA 1FQJA 2ZUBA 1KZ7B 4BY7G 2BCJQ 2IEZA 3GJ0A 4HSEA 3SQWA 3RRNA 2F9LA 3TW8B 4GKJQ 1L1OA 1H8HD 2ZRJA 4YLGA 3MFYA 1Y14B 1LS6A 2WWWA 1PH7A 3KB1A 4AG5A 1AH9A 1N5KA 5B2ZA 8OHMA 2IHFA 4DUZQ 2ZI7A 3OEEA 4QGGA 3VR3A 3BU2A 2OWOA 3ZIAA 1V1QA 4JI5Q 1G4UR 4PHTA 1XTRA 2QMOA 3WNDA 2VLIA 1GKUB 3GTKH 2KHJA 2YINC 3ZZTA 4LDJA 4JI3L 3MWJA 3QQ5A 4U7DA 1NKSA 4Q66C 3WMFA 4O0AA 2ZPTX 3K0CC 4ILEA 4DNIA 3O8CA 1ZNYA 121PA 2HXYA 1W44A 5CIQA 4FCTA 3HOVH 2D2EA 4OI0A 3EAQA 3W6PA 1N6PA 3SI7A 5KYKA 1PLKA 1MABA 1UEBA 1UKZA 2BVNA 1BKDR 2CVFA 2WWGA 4C2MH 2QGQA 1M7GA 2HV8A 2JLXA 2YWEA 3GQBA 3PUWA 3LLMA 2JLUA 1X3EA 2IT1A 3T5DA 3KX2A 1UE6A 1XEWX 2ZROA 3Q9LA 3THOA 1VCMA 2G0NA 4Z1MD 3F2CA 1D9ZA 2KBNA 2WIBA 1ZRHA 2ZREA 3KB2A 3KXLA 4KBGA 1HH2P 3HU2A 4D80A 3AVUA 2QT1A 3K0FB 1V5WA 1GAJA 5FI0B 3DMDA 5BQ5A 1YITA 1KAOA 2C77A 2GK6A 4DLTA 1MABB 3IQWA 3QY0A 3CF5A 4XJXA 4JLVA 3W6OA 3CNOA 2GAOA 4HATA 5M5YH 3ZYCA 1EOVA 5LPNA 5HE8A 4KFTA 1UE5A 1L2FA 1KO4A 4PC6A 2ZVPX 4P4TA 4RMFA 5G53C 3AVVA 3KYHC 4X62L 3TR5A 2E1RA 1N34Q 1OB5A 1LS1A 3IIJA 4EPTA 4DUGD 3NH9A 1M7HA 1ZIPA 3W9YA 5DNYB 1VG9B 3I5YA 5GQOA 2IHYA 4I81A 2OT3B 1W2HA 3BRWD 1OJLA 3O8BA 3NBXX 3L0IB 4YDSA 3ADDA 1DEKA 4M21A 1E9BA 3IBGA 4GZLA 1VYUA 1OXUA 1WB9A 4XWKA 1Z63A 4CF7A 4YHHQ 1E1OA 3QPVA 4YWKA 2ZRCA 3OEHD 3BB1A 3B1ZA 5EUQB 4GS3A 2JJ1D 4FCVA 3RVBA 4YCVA 5K8IA 3PO3G 2OAQ1 4MQBA 1FW6A 3GD7A 4JC0A 4POFA 3X1XA 3GLFE 1IJEA 3DHWC 4KLKA 1U81A 2XNSA 2NOAA 3K0AA 4D4JA 3U50C 4PAQA 3LQRA 1W0KD 1DG3A 2C5LA 3I32A 3S1MH 1VYVA 721PA 1OV4A 4CEIB 1Q46A 4DPGA 4BY1H 4NXML 2QA5A 2D06A 1S3SA 3T1HQ 1OKKA 2FPLA 3IEVA 2UKDA 1E2DA 1G5PA 4OI2A 4JI0Q 4OHWA 2R6GA 5HZHA 3B1VA 2C35B 3TRZA 4L9SA 3LW8A 4N3NA 5BR8Q 4DV5L 1NSFA 2JIZA 2GKSA 1EFHA 1VQFA 3OAAD 4LHVA 4LFCQ 1OSNA 1WJJA 3UDGA 1Q81C 2LSSA 1FMLA 1UDXA 4NE2A 1M6NA 3CPJB 4FWIB 4H1UA 3PIPA 1ONBA 3PENA 4LBZA 1WE2A 4LBYA 3T15A 3PV0A 2YVUA 4AYWA 5AUPB 1PH3A 2V3CC 2X77A 1KDRA 2BM1A 2WBLC 4FW9A 4YMTA 1Z3IX 4AURA 4XOIA 1W3SA 1MO5A 1ZU4A 1AGRA 4OONA 2CJWB 5DISB 621PA 1PH1A 2ZTEA 3MAAC 3RANA 1BBWA 3LWNA 5IE8A 1OF1A 4CYMA 3ADCA 1UBFA 2L0XA 1U0HC 2JA8G 2Z0SA 2DBYA 2DFTA 1GRRA 4C7OB 4Q9IA 4B2PA 2IF2A 2IXFA 1RYHA 1G51A 4R98A 5EJEA 4LF8L 3ZS8A 2UXCL 5FTNA 1G8FA 4DT1B 2WAQE 3AFQA 3C8UA 4EQ6B 2JA8H 4BGDA 1G3MA 1G1MA 1V43A 1R5OA 5JWOA 3OIYA 3EZFA 1OT3A 2A30A 1FFHA 2B63G 4C0JA 3PUXA 3ZDQA 4TMXA 4JI4Q 1RE0A 1XEXB 2IXEA 4KYUA 2KWIA 3M3YH 4UP8A 2QP3A 5EUMA 2WICA 3LXXA 3FKIG 4EIWA 1Z0IA 1X6OA 5L3SA 5EP2A 2JA5G 3NBYC 1E9DA 1KY2A 3OEED 4NL4H 3ZIAD 5GVSA 4L15A 3GJ4A 1NBMD 5IP7H 1N5IA 5C1BA 1IN8A 1LM0A 4NYIQ 2IBMA 4A0HA 3AVPA 4ASUA 4B3SQ 4RFSB 1W4BA 2XJ4A 4MRVA 5EE1A 2WWYA 1D7QA 2DPXA 1JEEA 2I5MX 2YZ2A 1HNZQ 4C3ZA 3WY9A 1GSIA 1K5GA 3MRSA 2QSYA 2LCFA 2ZS8A 4IKEA 3C15C 1CKNA 1HZCA 2DYKA 3FOZA 2P3SA 2N78A 1Z0DA 5AUQA 1KSHA 4HJ7A 3KDFA 4Q1FA 3DO6A 2RGAA 4DSUA 3CB4A 1GNPA 1MRNA 2C98A 1VQIA 4Z8YA 1QF9A 1XRJA 2WJGA 3SOPA 3B6YA 1GD7A 3LW7A 4Q7LA 2GBLA 4HUQA 1FX0A 4OWWB 2O8EB 3FP9A 4ACAA 1HNWL 1AA9A 4DUGA 5FUVA 1CKMA 4A9AA 5C4MA 3CXCA 1U98A 3DM3A 4YY3L 1G8HA 4QL5A 1I4TD 2HF9A 4PO8A 4MGIR 1RRFA 4PSAA 5EXPA 2JAQA 2J5XA 1BBUA 1M90C 1FL9A 3M4PA 4DV4L 1IL2A 2HCBA 2YTVA 5JJIA 1CLUA 1IHUA 1SQ5A 4HEJA 4EFMA 4G01B 3ETLA 3TBKA 3B85A 2CEAA 2JK8A 1NJFA 2K5NA 1ZAKA 1UEJA 4J0QA 3TE6A 1HZBA 3VTKA 1J7KA 3D3QA 4A3EH 2HT6A 4KSBA 5CK4A 2F52A 4IXMA 1RFLA 2IYUA 3W3ZB 3PVSA 2MSDB 5JWHA 3U7HB 1Z07A 1NMFA 4J15A 4PZZA 4TYYA 2RGEA 1VECA 5M3MG 4BY7H 2HEIA 4LHWA 5TDHA 2GCPA 2JLVA 4IOMA 4PO9A 5EQTA 1BO6A 4L5SA 1GUAA 2EYQA 3QJYA 1YNXA 2ZRPA 4C7OA 3L0OA 1HNXQ 1SXJC 4LF6L 1KMHB 1T8UA 2GCOB 2WZQA 4HDCA 2VSXA 4MUAA 3SFZA 3U61B 2WWXA 1XU4A 5J4HA 2HCJB 3S1AA 3SC3A 3ECCA 1W0JD 1VQAA 4ZKEA 2VZAA 3S15H 3IHWA 3AKDA 3AGQA 4QM6A 5H70A 2DCUA 3KTAB 2FG5A 2KSQA 5FBQB 2QAJA 4HLQB 4MKHA 5DYIA 2ES2A 1ZVQA 1E99A 1MKYA 2X1VA 4LJ9A 1COWD 4F4JA 2JIZD 5KOYA 2CDNA 3Q72A 2BA0A 2WP8J 1F6BA 3FMIA 4Q7MB 4F7WA 2VEDA 1II9A 4XSHA 4TLCA 1W36C 5GAHC 2GEUA 3K53A 3P20A 1XNRQ 3ADBA 4R4CA 4PXAA 1E79D 1VG8A 2HJVA 1YVDA 3A1VA 2VS1A 2QPOA 421PA 1B23P 3C14C 4R4TA 4NXMQ 2XNDD 5KPDA 2OTJA 2ZSAA 2A5JA 4QJ4A 3I72A 4A2WA 2GZDA 1KDPA 2J0UB 3H15A 1VG0B 4AYTA 1EX7A 1KI9A 1TL7C 2VQFQ 3EZ2A 4S2EA 4X64L 2JJ2D 4WIAA 4B43A 5DE3A 1H95A 4JSYA 1N6RA 4C3JH 3VHLB 1DTSA 1KO8A 1O7IA 5GJVC 3W34A 1TEVA 5HKKD 3S24A 5FFMA 3SHFA 4XVRA 4JI2Q 1P5ZB 1A62A 5F3WB 2VHQA 3GJ3A 1KSGA 2HLDD 4PZYA 4YXWA 1KI2A 4QHSA 1YRAA 2ORVA 4OI1A 5J4LA 2UXBL 3C4JA 3JVUA 1COWA 1KNQA 2A19A 5CYOA 1RZ3A 1RRGA 3CP0A 1SHZA 1SVIA 5LMUQ 1O3YA 1F5NA 1GL9B 2I4IA 3HKSA 3OHMA 2MQHA 4JVLA 4IEEA 2XZOA 4A3DH 4QGFA 2ATWA 5AK0A 4HZUA 3A1UA 1UE7A 3QVVA 2ZM6L 2XGTA 2NVXH 4A3GH 3R8CA 3SJCA 2O8BB 5KNCA 1ZUIA 4TMWA 3IRBA 1G4AE 4AC9A 5GROA 1N6LA 4UKDA 4M53A 5FL7D 1KXLA 3NH6A 4I1SA 4H1VA 2ZETA 2EXDA 2YNMA 4KU4A 3PG5A 2KBFA 2GVBA 3PUVA 1T6NA 2ZI9A 4JLAA 3UWOA 3DDCA 2NZHA 5GAEC 4IO9A 1K8AC 2NVTH 3AQ4A 1Y1WH 1AN0A 1SXJA 4HIKA 1XMQQ 2EFGA 4QBIA 4BASA 1N33Q 1P4SA 3CONA 5B57C 4O2DA 3GMTA 2JA6H 2ZS9A 4Q1EA 1E79A 1HQYE 3SNHA 3TUIC 4IPHA 1X54A 3NBZC 3ONWA 2VW9A 2CHQA 3GFOA 1E3MA 2CK3D 3VNUA 3QXXA 3IKJA 1KGDA 1PUJA 5DLQC 4C0QC 1G3UA 2QTVB 2V55B 4IFBA 1K5DA 4L5BA 2YJTD 1TADA 2BKUA 4B73A 5LD2B 1VQ6A 3QBTA 4W5HA 3AVWA 1KI4A 1P2UA 2JJ8A 4D6PA 5HZKA 2VHJA 4M1YA 1TWGH 5E7NA 3FFBA 2AFHE 2BBWA 1PYBA 2IYQA 3PSIA 5BYJA 3U7GA 1LUZA 2ZSFA 1CRQA 1Z2CA 5C4XG 2Q9AA 3AF1A 2QQ0A 4URWR 4A3DG 4E03A 3EW9A 1U8ZA 2ZVQX 2ZSBA 4XVQA 1M1YE 5KSYA 5L3SB 3KF6B 2WSMA 1IXRA 3THYA 3A58B 4HDQB 4LF5L 3AP1A 4QY7A 2FN4A 1US8B 1ESNA 1FL0A 1LB1B 3AVQA 1ZUHA 5LBIA 3WHLA 4AYBE 5E3HA 2RF4A 4UQOA 3RHFA 2AKWB 2ASEA 4IFDI 2QBYB 1HY3A 3KKOA 4GT1A 1HEIA 4E5UA 3F8TA 3CZPA 5CYPA 3REGA 1PLJA 2OCEA 3GTJH 5DHAA 1P72A 4A75A 3BH7A 1DAGA 3KJHA 1CEEA 1JR6A 1VHTA 2UUAL 1J5EQ 3UMSA 5E4FA 4Q1BA 2UUBQ 2PX3A 2OM2A 2PQAA 4NPHA 3VX3A 5E7MA 3UPUA 1VCIA 2QMEA 4IDPA 1ZM3A 1Y3AA 3HU3A 2RB4A 3WYFA 4A0RA 2BBTA 3FHOA 1XJCA 2Y0SE 3PQCA 4A92A 4A3JH 2YU9H 3QKSA 4ON9A 5FPHA 3AKCA 1NY5A 2FPKA 2XOKD 3NC1C 1KZGB 4HJ9A 3IIMA 3ND9A 3W1BA 1X1RA 1XJVA 3OW2A 2KJQA 1SKYB 2RHMA 4BLOA 3TREA 1E2HA 1UKYA 2BJWA 3ZQ6A 5DN6D 4TMZA 4L8GA 3EIVA 4US1R 5FL7A 3N2EA 1NBME 1IN4A 3QXHA 4UJ3A 3UG7A 5C4GB 4KCGA 4DR2Q 4F92B 5F9HA 3RLFA 2FZLA 4TLEA 5JCPA 3K09A 1VQGA 4HI0E 3I61A 2WJHA 4JLJA 3B1WA 1Z6XA 2JA9A 2VHUA 3I8SA 4D0NA 1S3GA 5IT9c 1NN3A 2QP4A 3Q5EA 5TARA 3A5UA 1E2EA 2EQBA 2QE7D 2I1VB 4FMCB 3CPEA 3FTQA 4PHGA 4D81A 4A93H 3JAMi 1OKKD 2FE4A 3CC4A 1XZQA 3VHXA 5IHPA 3CKLA 1DARA 2B21A 3IQXA 5JHHB 3RLOA 3R8FA 2V4ZA 4JIMA 4LK2A 2REOA 4X8OA 3P1JA 2GCOA 2NO7A 2IX3A 1HNZL 1N34L 4US2R 3B8HA 4WZ6A 3G4SA 3MLEA 1ZNXA 4JVNA 1RW4A 3KKQA 1JR3E 2P6RA 1WQ1R 3BD9A 4X6AH 2CCJA 1N6OA 2AMCB 3FKIH 1N32Q 3RYTC 5L8VA 4I1OA 1JECA 5BXQC 2UZ3A 4ALPA 4CRWB 4AK9A 2ZJBA 3CRQA 2DWQA 2Q9CA 3TUZC 4JI8Q 3THYB 3GDEA 4Q9KA 3E70C 1NVXQ 2ZJPA 3M7NA 1LNZA 4YWLA 3J80i 2WAYA 3CCSA 2WAXA 1PHJA 4D4KA 4CEHA 1MO4A 3L0SA 1XP8A 2OUKA 4BLRA 4A3IH 1X3GA 3NEYA 4GDFA 4Q21A 3U3KA 4A6XA 3AFPA 1SVLA 5IY0A 2KCMA 1XMQL 3CWQA 4BFTA 2IYTA 4DCSA 1RC8A 2XZLA 3ULLA 1OH7A 1OHHD 5EP1A 1XTQA 4TYQA 1W4RA 4LF7L 4DR1L 4G5RA 1D6JA 2GDJA 1AZTA 4QHTA 4YMSA 4G5QA 5IF9A 4OL0A 2R65A 2A1AA 4JG2A 1M1KC 3S2DH 1II8B 1VQ5A 3ASZA 1S0UA 2GEDA 4GOPC 2IA5A 4LBVA 2ZAMA 2HYDA 4DV6L 4FMDB 4EFLA 3H0GG 4PZ6A 1T3SA 4MITA 4AYXA 2WKRA 1WRBA 4JI6Q 3WYGA 4YXWD 1E6CA 3RABA 6Q21A 4M1WA 2VP2A 3TVDA 4ARZB 1P2TA 4DT1A 1MJEA 4HB3A 3CNNA 4JKYA 3SJAA 1XXHB 4DRZA 2WTUA 2DFNA 4OI4A 4PPFA 3TLXA 4BEJA 4LFCL 4C0SA 3QE0A 1IOZA 4A3MG 2EFHB 4IW3B 4JLDA 3GJ8A 3THWB 2D0PA 2JA7H 4HUQB 3FMOB 5KTYA 3K9GA 4AG6A 2D7CA 4P4SB 4KVGA 4V0LA 3RRMA 2CHGA 1N0WA 2O8BA 4LUCA 4A3CG 1E4YA 3J80c 3EWSA 1QHSA 3Q3JB 4X64Q 3SDZA 2OFXA 3WXMA 1QVAA 3U2QA 5GJBA 3QEJA 4DSNA 3RNUA 1VQ4A 1KDOA 3W6NA 5EE9A 4LI0A 4BEBA 4CGZA 2BOVA 4BRUA 4D0GA 2YC4C 3P4XA 1QVCA 1KDTA 2VHCA 3F0TA 4JBYA 4QG7A 3SBEA 2J3EA 1EWIA 1WF3A 4W7SA 1H8HA 2FU5C 4DV2L 2WKQA 5E7JA 4FN5A 1ZD1A 1OXVA 5FUXA 5IP9G 1EGAA 1NP6A 2GTPA 2ZUCA 3RN2A 1FP6A 4KXFB 4ZDKA 4LF8Q 2A7QA 1QDEA 4EPWA 5AJWA 5M5XH 4HIDA 5CITA 4B32A 1JBKA 1K6MA 1PUIA 1TNDA 3FYHA 4MA4A 1Q0UA 1WDTA 2UUCQ 4WXPA 3U4QB 2H17A 2ANBA 3VR5A 3I62A 3U44A 2X2FA 4TTRA 1FX0B 1A2KC 1VHLA 3IUYA 3KQLA 4FWTA 3JAMc 5C4XH 1LF5A 4JI7Q 3QENA 4LWZA 4P3YA 3PCOB 1NG1A 3N5CA 3U58A 1N0UA 1FVIA 3BGWA 4B3CA 1HQCA 2FMXA 3IGFA 5FPSA 2FA9A 1F60A 4IJMA 2IYLD 1I94Q 3KJGA 4ZI3A 2MO0A 1GG2A 5C4JH 1LW7A 3OIWA 1XNQL 5FTJA 3NENA 2FJUA 4FD2A 3TQYA 5CDFE 3ASYA 3MG9A 2IC5A 4B3DA 1EQQA 2CQOA 2UXBQ 2RH5A 2YC2C 3VAAA 1NIJA 1KY3A 1W47A 4KLZA 4ZCMA 4B3GA 4H02A 5JLJA 5JFGA 1OH5A 2QRZA 1HYQA 4GKKL 2XITA 3LVQE 2QN6A 1NI3A 5C18A 3NDBB 4OYHA 5CLLA 3AYHB 1JXMA 2C9YA 4OBEA 3KKPA 1O87A 3B1YA 4JL8A 5C2JB 3RC8A 1E0KA 2VQSA 3B5JA 3GFTA 3V00A 2B92A 3IPXA 1II0A 4WZBE 2ECKA 1Y1WG 1II8A 1PJRA 1XNJA 4A3LG 3G6EA 3AEVA 2R7FA 2FEOA 3BOSA 1GRQA 1KMQA 3TVTA 4QBHA 5AWFC 2F4VQ 3EZ6A 1YR7A 4UP7A 4A0GA 4ZI2A 2F7SA 1LY1A 3F2DA 3OIVA 1G8PA 3BXZA 3V4RA 2PQAB 1Z08A 2GXAA 1TWHH 4KFRA 2EVWX 1ZCAA 2B8TA 3TS2A 3HYTA 3PEUA 4GLXA 3CCEA 3M4YA 4JI1Q 2K14A 4BBRG 4IOKA 2FH5B 1G9XA 2IW3A 5L3QA 3RS0A 1YI2A 5TV2A 1MKHA 4LUZA 2IYYA 2QEQA 4N1AA 5CDFA 4E07A 3U7FB 4ZDIA 4EX5A 1GO3E 5LD2C 1I94L 3CLVA 5CB8A 1QBKC 2ORIA 1YJ5A 4D0LB 3HOYG 2UU9Q 1OIWA 4YDHB 3GCGA 4RG1A 3MSXA 1S8FA 1YZKA 1JAHA 2ZEJA 3BORA 1YVCA 1FGUA 2QI9C 5EXTA 3STBC 1F2TB 2ZRLA 1EYGA 3W8NA 5H1YA 2YTYA 4UP9A 4OHZA 3BAFA 3GLGE 4JLPA 4MNOA 4HLUA 2YOFA 5IYBG 3QIAA 5CJPA 2WJJA 1P9NA 4U00A 2Y8EA 4K0KQ 2DB3A 2QTHA 5DO9A 1JB7A 2CLSA 1E2PA 1HH4A 1OIVA 4R71A 2F4VL 5IDVA 4JBXA 4YWMA 5J4KA 3NTUA 3WRYC 1QZXA 1D2MA 1R0YA 4IPDA 2BBSA 3T1HL 1KJYA 4MZ9A 4IFEA 4NPSA 3PXGA 4POAA 2UZIR 4RJLA 4PMWA 1S96A 4LW1A 3U3MA 1N9WA 1Q21A 1YZUA 2ZU6A 3PO2G 1XTKA 3CBQA 4NYJR 4BPBA 4Z51A 2PJRA 4DLUA 4PSKA 1GL7A 5SZIA 1YJWA 4FDBA 1TEXA 4ESVA 1OFUX 1L2TA 3IIKA 1AE3A 1AJEA 4OQNA 3THXB 1YZTA 2JA5H 1U94A 2KE5A 2W2TA 1QHGA 4M9XA 1KD1C 2QMHA 3CC2A 1XNQQ 2QUZA 3TSZA 2J7PA 4C0HA 4B3TQ 2IYVA 3BJIC 2QM7A 3J81c 1Z0AA 1KL9A 2C04A 3HKZG 1W46A 3U4VA 2FNAA 4LWCA 4HAYA 4A82A 3OIUA 1N6KA 1E96A 4PZ8A 2Q2IA 4XIGS 2E2JH 1ZU5A 2DR3A 2GJAA 2PLRA 2VNUD 1DVRA 2XSZA 3PFIA 4Q19A 4RSGA 2V6JA 3TKLA 3VU9B 3FFAA 3F2BA 3THXA 4X65Q 1SFOH 4LHXA 4LYFA 1YBYA 5IRCD 1TU4A 1YJNA 1VQ9A 2AN9A 1MO6A 4A93G 1YQTA 5IYCH 1R0ZA 4BLSA 2UVQA 4GZMA 1NN0A 1AKYA 1W49A 4KFSA 1S40A 1L4YA 3B6EA 4NYIR 4MKIA 4QC2A 1VQ7A 4F91B 1D9XA 1NJGA 3CW2A 1KQSA 2W2VA 4A3EG 2IXGA 2RGXA 1BIFA 2W2XA 4IXNA 4LJ4A 4HLCA 4OQFA 4IFDJ 2H5XA 2GF0A 3K0XA 2L15A 5AJ3Q 2BEJA 4R2HA 4ZO4A 1DAFA 2K50A 5F9FA 2C8VA 4OX9Q 1NIPA 3RZOH 2QTFA 1JALA 1E1RA 4QGAA 3KOJA 5G41A 3R7WA 1JR3D 4A76A 2QBYA 3AH8A 3ICEA 5ANRB 5JEEA 2FWRA 3FWYA 4UXHA 2J7PD 4DLRA 5C0XJ 4JVSB 4DV3Q 5CLQA 4LCBA 3X1YA 4AKHA 3PR1A 2DGYA 4GP6A 3A8TA 1SR3A 1V9PA 1EX6A 2YWFA 3ZGXA 2D2FA 1U9IC 1F2UA 3MUFA 3ZJYA 1KKLA 4QKQA 2CFMA 2QRNA 4ZV4A 1BVSA 4GI7A 1IBLL 2HHHL 1J70A 1NTGA 3KFXA 3LBIA 1Y1VH 4DDVA 3EPHA 1QVRA 2C78A 2GXUA 2Q3MA 2ZYTX 4JI6L 3D6TB 1I5FA 4HJ8A 1N5JA 3RRYA 1ELOA 3B9QA 3QEOA 2Q3FA 1KI3A 1U5KA 2W6JD 3EC1A 3R9XA 4BECA 1JI0A 4P72A 2IYWA 3RS2A 3GEHA 5FH9A 1DAKA 2ORWA 3KJOA 1KK2A 4EQ5A 3DPUA 3NDPA 1Q3HA 1Z0KA 1OH8A 4NZYA 1E2NA 5G3YA 4BLQA 1XPUA 2EYUA 4KO8A 3AF2A 3CCVA 1ZJ6A 2EFCB 2J46A 3E9HA 1WP9A 2QNRA 4DXAA 3ZD7A 3C41J 4X8HA 2JASA 1R0WA 4TMVA 2N3SA 2IYXA 1R2QA 1P2SA 2GHIA 5DLQE 2EFDB 3AUYA 4A2PA 4EJSC 1VPLA 4L16A 5JS8A 1P16A 1IXRC 3C5CA 3A74A 3UDIA 5TVKA 1VCOA 1N3BA 2XTNA 1W48A 5JRZA 2P5TB 4Q4JA 4B74A 2QAGC 1C9KA 4XTCS 1Q1ZA 1RIPA 1K9MC 4HUTA 1G7SA 1BS1A 3GLFA 4QGUA 2XB2A 1YHNA 1G3RA 3QG1A 3QBVA 1F48A 1K3RA 3EIQA 3I5XA 1T3HA 3A0JA 1ANKA 3GPLA 1N36Q 1A5TA 3VKGA 4GN3B 1XEFA 5G3ZA 3EASA 2ATVA 4B3MQ 2DUDA 3KLWA 1CUKA 4CDGA 4DDWA 2P6UA 4LV5B 1NN5A 3KZ1E 5GJCA 1KOFA 1KRSA 3M85A 3RZDH 1P61B 2WMOB 1U0JA 4JV5Q 4P0TA 3GJ7A 3H3VI 3TQCA 3PUYA 1FUUA 1J5EL 1NVUQ 1T5LA 2EU8A 3CPWA 3B7GA 4O2RA 3UATA 2G1JA 4FCWA 2UU9L 4IJHA 2QPAA 1QG2A 2F55A 521PA 2JDID 4M2LA 2K52A 1YHQA 5M04A 4X8MA 3T35A 4OQMA 2ZE8A 3AKEA 2P5SA 2P67A 5FOSA 4URYR 1GKIA 2CLDX 4WXRA 4BQSA 3IEUA 4M0LA 1YR6A 2C9CA 2ZAOA 1IQPA 5HGQA 4JKIA 3SBDA 1C0AA 2VRWA 1FTSA 3PEYA 1X55A 3EA5A 2O8CB 4RY2A 5ELNA 1N6IA 3ZS9A 3UK6A 5ELXA 221PA 4APVA 4LJ6A 1HNXL 1N36L 2JJ2A 1UM8A 1FJGQ 1JNYA 2JJ1A 4P74A 4LPSA 2X19A 4TZ0A 1KHTA 5JI2E 2ZIAA 4DUYQ 3CM0A 4DAYB 4ME3A 4N0EA 4DC9A 3CMAA 3ZJYC 1U9IA 2KBEA 3TK1A 1YZGA 4Q7KA 2UUBL 4DR4L 1A1VA 2BMEA 4KYIB 3CRW1 5CM9C 3CQZH 1FP7A 2R6AA 3DVLA 4BBSH 3H2YA 3IHLA 3H4MA 4EKDA 3HOZH 1CJMA 1E2IA 2J41A 4G3XA 4A3BH 4R7ZA 3EPLA 3PCRB 1Q1BA 3PITA 1CR4A 2JLZA 4PC3A 2CHVA 4JLKA 2ZM5A 1ZMXA 2NZOA 3E0EA 2BM0A 4HZUB 4IHQA 1GRNA 3GTMH 1JEDA 4P31A 5JMTA 1YEZA 3CH4B 4WW0A 5TY0A 2OBMA 3ZZUA 3WNBA 1CS4C 5HCNA 4QJ5A 1XX6A 1E2GA 3K09C 1YKSA 1HNWQ 2ZSDA 5JHGB 5KUTA 3RSOA 5CJ2A 4TLDA 1I6HH 1N6HA 1UJ2A 2NPIA 4IPGA 2J0UA 5FLMH 2ZJYA 1A7JA 2F1IA 1H8ED 4DR3L 1SXJB 3HWSA 4KODA 3S1AB 2AD1A 2R6CA 1PH6A 2N8NA 3TW4A 2AHOA 3PUZA 1JE5A 1CKEA 2ZUDA 4DR5Q 1IN7A 1NMGA 4X8LA 1XEWY 1VQPA 3NBFA 2B6HA 4C0AC 2CCZA 1OHHA 4DLZA 1KJZA 2WJVA 4HAZA 4D2IA 5JEAG 3KUDA 1IN6A 3CR7A 1SZPA 3L2OB 4DLYA 1OTCA 2XSZD 4GBMA 1Q7YC 4TN1A 2ONJA 4NB3A 5FBWB 1UAAA 1D2EA 1JJ7A 1KSFX 2HLDA 1PH4A 1N33L 3O47A 4BZPA 4E22A 3RWMB 1Q12A 1M7BA 2D7DA 2ANCA 3TQFA 1SGWA 3G82C 3EZ7A 4MGZR 5SZHB 1GTVA 5KNDA 4TYNA 3CPFA 1IY1A 4C30A 2JA1A 2FSHA 2RGCA 3TNFA 5KDOA 1VQKA 3FB4A 2LXJA 3M4QA 3GLHE 5B30A 1Z83A 4MH0R 3EXAA 1MJCA 3OE7A 3H0KA 3KDSE 1FOEB 3ND8A 5EE3A 1PA6A 4TLBA 4ZPXA 4LBWA 4HAXA 2VA8A 4OKSA 4CVNA 4EDHA 5EE0A 2QY9A 1E9RA 4M9ZA 4OXPA 2K5VA 1Z6TA 1NSTA 4DV0L 2OBLA 4O3MA 2VL7A 3EPJA 3QF4B 5JS7A 2VSOA 2FXQA 3LQQA 4UNSA 2IK8A 3TUJC 3LA6A 3VKHA 1UADA 5JJKA 2CL0X 4PO1A 2GK7A 1EIYB 1PV4A 4E09A 3TS0A 3BFVA 3HFZB 2FV8A 1S1MA 2AWOA 1BOFA 4M1KA 4NXNQ 1X6VA 5FPYA 3CX6A 1P3JA 4RKEA 3PJRA 3I4NG 3GJ6A 4JI0L 4HDOB 2KCTA 3CWZA 1RVDA 3DM5A 3LD9A 3L2PA 2QA4A 1YR9A 4XH9B 2FFHA 4HIOA 3SYKA 4W5JA 1RIFA 2CE7A 4A0FA 2AWNA 4LYHA 1WCMH 4JT4A 4S35A 5SZKB 3K0SA 3FMPB 4Q02A 1G17A 2VIIA 2AR7A 3NELA 2OQ0A 4DUYL 5TB5A 2G77B 1ASZA 2CNWD 821PA 1W36D 3MMPA 1I4DD 5IP7G 1OYWA 5JBQA 2DHRA 4TZ6A 1NE3A 1TQ2A 2EW1A 4B33A 4ASUD 1JPJA 4JYAL 4N0DA 4V03A 1VQDA 4URVR 2YYZA 2K75A 1US8A 3K0EA 4RD1A 2QGNA 4A3JG 1SVSA 1B0UA 2XEXA 2B63H 1RJ9B 2QU8A 3H3VH 2GF9A 4JLMA 3A6PC 2V8OA 4NMMA 3QG5A 3TMKA 4IDOA 2CWPA 3OZXA 3OTOQ 5FJ8G 2F9MA 3BFKA 3UDFA 1JJGA 2QMUA 1HR0L 3B60A 4QBFA 4UNRA 3PIRA 2X8AA 3ZVMA 2G9NA 3T61A 4Q00A 1SN8A 3SHWA 1UBGA 4MRNA 1XTSA 4OHVA 4HAWA 4Y0VA 5DSZA 2H16A 3RS7A 4OO1G 1P75A 1LTQA 3CCJA 4FMCF 3ZZ0A 5TMPA 1XF9A 2W00A 4BZXA 2XZPA 3X1WA 1AIPA 3KDFB 1Z6GA 3IDQA 1CU1A 2OCBA 4TTQA 4TSFD 5EP4A 5FOUA 2AKYA 1GP2A 4AKEA 4DV0Q 1F3OA 3T06B 4A2QA 1QVFA 1TWCH 4LX0A 4DK3C 2P65A 3X2SA 3G48A 2A2ZA 2GVZC 1JJCB 2WMNB 3GO5A 4B3TL 1D2NA 3CCLA 1IY0A 1HTWA 1Z8FA 1WCMG 4JYAQ 2ODEA 2H7VA 5KHOC 2ZTDA 1PFSA 4WJ3M 1PLLA 2I3BA 2O0JA 3K8AA 5C0XG 2PJZA 1SKQA 1OXTA 2E5LL 4B3RL 2A5DA 2I5HA 2MO1A 3B1XA 4Q9HA 1W0KA 3U6KA 4AKIA 1GKYA 2F43B 2ZR9A 5DIFA 2FOLA 1T5IA 3TAHA 4URZR 1MOZA 1YHBA 2QEXA 3NXSA 4A3KH 2ZRDA 4IDHA 5FTLA 1GILA 2NQ2C 4YY3Q 2N49A 2GESA 2GVAA 3UE0A 1P73A 2WWIA 4DZZA 4YMVA 3THWA 3HOUH 5C0XI 3SR0A 1G6HA 1XNRL 4P4SA 2YHSA 2B29A 4HAUA 4JLNA 2PT5A 3P4YA 1R4AA 3L8YA 1XCPA 5A5GA 1J6QA 4CW7A 5LMNL 4PG3A 4Y7NH 1SXJD 4DUZL 4LJ7A 1GKHA 4XTRA 3U3JA 5BWMA 2WWHA 4NCKA 4NYMR 4TSFA 4AI6A 3HOVG 3DOFA 1FPMA 4GN4B 1DE0A 1GIAA 4LUOA 4DR5L 3HPQA 4TQ9A 1NVWQ 1F2UB 3VKWA 5J4VA 1XDBA 5AUNB 3CF6R 2GBLC 2QL6A 1VQLA 1E69A 5GAGC 4PHFA 4Q1AA 2BKEA 2LXKA 3U3RA 1CSPA 4CEJA 2BMJA 1L1OC 1HURA 1T4GA 1ZC4A 4EPRA 4BLTA 1JT8A 4CZ2A 5DN6A 3U4QA 3QXJA 4G5OA 1G7CA 2MSCB 1GOTA 4RZ2A 3HP1A 5D3MA 1SLJA 3OTOL 4URXR 1A82A 2ZYUX 3K81C 1ZCBA 3J81i 2V1CC 2XTZA 1T0JB 1EIFA 4HJ5A 1G16A 3AGPA 3P32A 2CL7X 4DHEA 1EWRA 1G7RA 3CCRA 3CR8A 4X66L 1R9TH 4JZKA 3SN6A 1QZHA 3AQQA 1G5TA 1FZQA 1LF0A 3NWJA 1EFTA 1XD2B 1Q20A 4PQYA 4W5WA 3MD0A 2J0QA 2W6ID 2P0EA 2H18A 2PLFA 1N6NA 4ITRC 1E1TA 2ZRGA 5DI3B 3ZVRA 3KFUA 3MGCA 1OE0A 4LYJA 1VKJA 1ZNZA 3SJBA 4TTPA 4OJKA 4AD8A 1OXSC 2PCJA 2Q9BA 3IPYA 4ZIRB 2VQEQ 1XZPA 3LAWA 1X8LA 2UXDL 3HOXG 3I55A 2BWJA 1U0LA 4JYCA 4ARZA 3QKUA 4R2IA 4LF4Q 3BC1A 4LNQA 4A3BG 2HDNB 4KFUA 1XD2A 2VY3A 2ZJ5A 4Q47A 2EWVA 2R2AA 4M1OA 4RKFA 2R62A 1J8MF 1IONA 3M1IA 4BFVA 4DLSA 1CR1A 3NEMA 2Q2TA 1PVOA 2Z83A 3FKSD 4B6EA 4DKXA 4Q4HA 3B2EA 5EXXA 4LOAA 4R4OA 3K70C 3A1TA 3EX7C 1KI7A 2RKOA 1K8RA 3BWDD 4JI2L 4B3FX 1L8QA 3D0FA 4L5TA 1U2RA 1YR8A 2ZU0C 1Z9FA 3S2HH 1XJQA 5BR8L 4DV5Q 1ZYUA 2FGKA 1X3SA 4DDUA 3TJZA 2GJ8A 3V4FA 4BE7B 3IBYA 3K80C 4Q9LA 3FKQA 3PGZA 3U4ZA 1HJPA 5IYCG 1EK0A 4G1UC 1ESMA 3BBPA 1KKMA 2A9KA 1FMJA 1FNNA 2G88A 1N8RC 1E0AA 2G1KA 5JJLA 4LJYA 2R44A 4D82A 3D8BA 2F6RA 3QNUA 1GZSA 1XCGB 4QQBX 3DMNA 1DO2A 1E4VA 2CXXA 5KSOA 4WVFA 4CEIA 4DV7Q 2D4HA 4IDNA 4P4UA 2ZJ2A 5JSZB 3SZRA 1M2OB 3OF5A 1R0XA 5KO2A 2GNOA 4JL5A 2HJGA 2HYIC 4DBLC 3N70A 2IHEA 4Q9JA 1IYJB 1AKEA 1BMFD 4US0R 2ZRHA 1UDWA 3CX8A 4KJZA 4Q4LA 1ETUA 2HXSA 3VU9A 3TSWA 2IUUA 5FBVB 3AF0A 5LB4A 3C7KA 4ABYA 5M3FG 5FPKA 1X8KA 3FHCB 1Q3TA 2AXNA 1TMKA 5K8LA 1EWQA 1CKOA 4ZDWA 4KITB 3N2IA 1VMAA 4II7A 3S16H 4R9UC 2FZ4A 2H92A 1A8VA 1WI5A 1AS0A 3CF0A 3GTQH 1X3FA 4GOXA 4I1UA 4DV6Q 1QVGA 1X1SA 2ZYVX 3QF4A 3GTLH 4XD7D 4XD7A 2XX3A 3DKVA 4ESHA 2GJKA 2IYRA 2WWFA 4JI5L 3QKRB 5EXSA 1KIMA 1S3OA 5AJYA 3B13B 4FI3C 3A36A 3I4LA 4UJ5A 3S14H 4FMBB 2IY5B 5FR2A 3DOEA 4B48A 3HYRA 4GKJL 3D31A 4RCYA 3F1ZA 1UKEA 3AP3A 2QAGB 2ZYWX 5FBRB 4BFXA 3AVYA 1AE2A 4DEXA 4DCTA 4OHXA 4G5GA 1P60A 2FF7A 1QHNA 1XD8A 2I1QA 2VP9A 1W36B 3CUEF 2NGRA 5B58C 4TL7A 4A3GG 3QKTA 1CJKC 2PH1A 4P32A 2WJIA 3QPUA 1KC8C 3T1QA 1YE8A 5UKDA 4GLVB 4YMUA 1L0WA 3K0CA 3KKNA 2Z5FA 3K1JA 2CVHA 1E9SA 3FHTA 4AWXA 4LFBQ 3B82A 4D4LA 3K9HA 5GADl 4TVAB 2LKDA 2KHIA 3HPRA 1J8YF 1DGSA 2CWAA 2R7ZH 1JB1A 1RRCA 2QZ4A 5EZ6B 2ZRMA 3IO5A 2IWHA 4B71A 3SQXA 5IP9H 1T91A 2VSFA 4Q18A 4D26A 1KHIA 3MXNB 1E2QA 2N42A 2O5VA 3E1SA 1K83H 1PYSB 4FMDF 3CRVA 2WFWA 4JBJA 5FOVA 4BFSA 1K8GA 3HOWG 1NLZA 1W2GA 2PEYA 3SFVA 5M3MH 3K70B 1GWNA 1QRAA 2NZ8A 3TSOA 4A8JC 4HYYA 4DJTA 1EUJA 1SVMA 2KENA 1TPZA 2XTMA 3KJEA 4MRSA 1R8SA 3UIEA 3LO5A 3P26A 3DL0A 3FGNA 4AIIA 1AQUA 1VDZA 1A2BA 1VQJA 1G3QA 1UWVA 4DWJA 4GSYA 3AVXA 1Z22A 3B78A 4IOCA 1G20E 1W0JA 2GEVA 2F3IA 2QG6A 3FE2A 3LVRE 5FOWA 5C3EG 1IBKQ 2A5GA 1PH5A 4KHPQ 1P7CA 2RAPA 3SJZA 4Z54A 2O8EA 1Y63A 2IX1A 2NN6G 2REXB 2OLJA 3W5OA 4DR7Q 4TQUS 4X62Q 5BN3A 5BN4A 2HF8A 3WWVA 4B44A 3CRRA 2PZFA 4C4PA 3H86A 1AS2A 1MIUA 2AKAB 4PZLA 3K70D 2ALYB 5D3QA 4DIEA 3QI2A 2AL7A 2AX4A 3NIBA 4RFSA 1P9WA 1HR0Q 3PO2H 1E1QA 4IOAA 4DAMA 3QUSA 4BFYA 2GILA 1JXOA 4MYTA
chains in the Genus database with same CATH superfamily
4MUGA 2RE8A 2BUBA 2WU4A 5GONA 2SHKA 4PZPA 1IB6A 4WOPA 3T1YL 2MU1A 2N75A 5REQB 5JARA 4RACA 2EP5A 2DOKA 4GMDA 4GWLA 4KUEA 3FETA 4IEIA 4U9UA 5IKOA 2Z09A 4HEHA 4Q05A 3A8JE 1Q57A 5U9CA 2IPOA 3A27A 2G9RA 5IBRA 4BVEA 1RHUA 2ONZA 4QHYA 2VYFA 2PIDA 4XWAA 2WNHA 4IMRA 5TQ0A 4Z4CA 4C5AA 2FW1A 2J3LA 4TKVB 3CO5A 5JPNC 4L75A 3IMKA 3WLIA 3MZ5A 2JCVA 1SCNE 4HB0A 1A77A 4GR4A 4HX5A 2QLNA 5BORA 5I45A 4E31A 1DKQA 3ZK8A 3ILXA 2XTIA 4QAQA 5AM0A 1XXHA 1IM8A 3TD9A 3V97A 5G4KB 1QFYA 3HLKA 2B0CA 4IOLA 3C3XA 4G67A 3QU5A 1FR3A 3MWYW 4DLWA 4BFUA 1MJFA 5LMUL 3KAJA 2O7QA 3Q6MA 3N0TA 1HUQA 3RC2A 5CGQB 1Y1WB 1GSOA 5FTMA 5BSMA 1PJLA 1P8LA 3NOVA 3QKSB 3WAKA 4DR1Q 1EQUA 2GZ1A 1RAFA 2V6BA 2W4IA 5IYDG 4QDKA 2GCGA 3N39C 3BJUA 1USGA 5JVDA 4CG0A 4L50A 4YXFA 1QYDA 2DT8A 1Y6GA 3HR4A 2QLLA 3N0VA 1K0SA 1FS4A 2C1ZA 4R5HA 4NJOA 4QJ3A 4XWOA 1L5ZA 5CA1B 5KCZA 4ACBA 1KYTA 1NLYA 3COYA 3TSCA 4B8YA 3ZQ4A 2YHIA 4H6WA 2VA9A 3T9AA 4JMPA 2WB1G 3W06A 1JKJA 1XB2A 3IMCA 2FSFA 3CNLA 3O8LA 2B2TC 2O3UA 1K8MA 2QX9A 2BD0A 1AGNA 2VHWA 3JQAB 3HXMA 3QYPA 2UYQA 4H0LC 4K0RA 3ZWKA 5K6AC 2ZRBA 1ILQA 4OCZA 3GEEA 1L5HA 5FWAA 1D5CA 4FINA 1WYDA 4BNMA 2IZZA 2QJRA 4A3FG 4UVHA 3PA8A 2UZ0A 3F3YA 2DG2A 2ZBPA 3AO0B 4NESA 3M3HA 4DY4A 4MPPA 1PXUA 1RMYA 3PNMA 3VMFA 4G4SP 3AYXB 3IHTA 4IUYA 3WKCA 3GLGA 4HFNA 3W05A 5KJ1A 4L78A 1O9HA 2P8SA 5A2QL 2JAHA 3DZ8A 4D9HA 1NBMA 2PUEA 4TZTA 1VQCA 4DV1L 1SOAA 2P75A 4BB9A 2G28A 1T43A 1J7JA 1DLJA 1SR8A 2V7QD 3T34A 4GEGA 5AVVA 1NNEA 3D7MA 4CFZA 5AVUA 3U5ZB 4XB1A 4KY5A 1Q1EA 2BFOA 2OY0A 4BB6A 1Z2EA 3C3MA 2VZ8A 4OP2A 5HIMA 3AW9A 1MX5A 3GV0A 4M1QA 1Q1AA 4OL9A 4JJ8A 5HHTA 4GOPA 2I65A 2PVSA 1UT6A 3ROEA 4O4JA 1B15A 5G02A 3C1UA 3EGEA 2B3GA 1NURA 3HGBA 2P0YA 3ONDA 2QKYA 2HI0A 3HZOA 4DR7L 3OE4A 3KG2A 3NLLA 3WG9A 4B17A 4PV1C 1SELA 4ECEA 3DF7A 4IG4A 4P08A 4ZYVA 5CB4B 1T0HB 1VBNA 2W8BA 2BEWA 3G8BA 1C4XA 4LWQA 1P33A 4A5SA 4PYIA 1H8EA 4A3LH 1UKVY 5FBZA 4A6PA 1A63A 3ZPXA 4JLBA 5ITZB 3A3NA 2ZVDA 3V8QA 1GITA 4J3FA 4K5XA 2UUCL 1DTEA 1YDFA 2QRGA 2ONYA 3B6MA 3PQ4A 2VRNA 3BIOA 4HLUC 3J80L 1NLMA 5AOVA 5J5VA 2IDMA 2CE2X 1T25A 2NVQH 2PO4A 1MAAA 2QSZA 3ABZA 1FP4B 4KSYA 1NMXA 5DNEA 4B6JA 1JJ2A 5KJ6A 1U04A 5GM1A 2IEIA 5KQMA 1CUIA 4U673 3KQHA 3AFOA 4IPCA 4RGMA 1J2EA 3JPWA 3QTLA 4QJFA 3OLYA 4WFIA 2IHBA 1CZUA 2FFQA 3A4MA 1IU9A 1NDUA 2N1BA 1A7UA 3EDYA 1YQ9A 3N52A 2H29A 2YHBA 1TYZA 1D8LA 3C46A 3H2KA 4C7JA 2G0AA 1CUZA 2WAMA 1RCUA 3AUAA 3OTIA 3R7NA 5IMBA 2Q2NA 5HF6A 3LI2A 1ULTA 3E1GA 3O4JA 2OZKA 5CDHA 1G38A 1KMHA 1SC9A 5BMVF 2WAQG 1PCXA 3KZVA 1XTDA 3QBJA 1AK9A 1TY2A 1RS0A 2WUGA 3DXYA 1HR0W 4PS0A 4RZ3A 1A7KA 5EWMA 2YU9B 2EVBA 4MIKA 1WXXA 3VQTA 1K8YB 2ZRAA 2VP0A 3WMXA 1BXRA 4TM8A 4BV3A 2YYAA 2FQXA 1HFKA 2RK3A 2PDAA 2F03A 2YTXA 2VKTA 4X44A 4A1FA 4Z4GA 5ES4B 4XDXA 1WTWA 5CMLA 1TF7A 5AKIA 3TGPA 4FYXA 1J8IA 5KWEA 2CZQA 2JLQA 4LWOA 1DELA 1QYXA 4LW8A 3U19A 1W7AA 1DQYA 5A0TA 3QLVC 2XDQB 3FNBA 2MFIA 2C5AA 4GDMA 3C6ZA 4NXMB 1C7ZA 2GEKA 4BNLA 3DAPA 2CK3A 3KT0A 3RRJA 4AN4A 3HDQA 4N18A 1EFPB 1Z7GA 5CUQA 4X1YB 3LXRA 3RG2A 1GUWA 2X7HA 1PVDA 4K6DA 1Y8QB 4K1XA 1O1YA 5L3RA 1X9HA 2ACVA 2QRJA 2ZRNA 3FCAA 3ANYB 4GBED 4WY2A 1MDBA 4CHTB 1I1NA 1KZ9A 2P1ZA 2RA4A 1H2HA 1X87A 1B70B 3HO8A 4MUXA 4O1MA 4Z7JA 3OMGA 1U6KA 4HJRA 3U4CA 4CCWA 2WAOA 3C1TA 5K8UA 3CMEA 1PR0A 4F71A 1ONPA 3UHFA 5EJ4A 4IHKA 2EW8A 4RWZA 4CKCB 4C3JB 2J1LA 3WDNA 2B7CA 2J59A 3A1EA 1KMIY 3CH6A 3DCNA 3RVDA 1RPAA 5CV6A 1B6SA 1R16A 3G1TA 2OD9A 4MPDA 1L5GB 2WYHA 2C59A 1ZRMA 5CDSA 1JQYD 2OR3A 2HIVA 1SUSA 2PZEA 4A4DA 1LPOA 1QZZA 3GP3A 1G6ZA 4ZIRA 5CXSA 5EKKA 4Q6WA 4YR7A 3SE0A 3E3AA 3E5HA 1P1CA 4IQ8A 1TW2A 4UXJA 2ID9A 1BCSB 4HH0A 3EVTA 4D5GA 4J2OA 1EFUA 4LDQA 2MJLA 1GTZA 1YB6A 5KNBA 4GX2A 4V24A 5IODA 4V0BA 1OREA 1GUDA 3WL7A 1FQKA 3NAZA 3D8SA 4EUKA 1LI4A 1E98A 2OG2A 2ZSHA 4Y2GA 4PHCA 1MT0A 1UFOA 2KI5A 5HJ5A 1UJ5A 5E4YA 2NZVG 4FNMA 4YHHB 2PD4A 5BN1A 2ZI6A 3EZGA 4GGPA 4KG7A 2ZJRA 3ND7A 4L9AA 3T7CA 5TXGA 2VSNA 4RY0A 5D1NA 4AO7A 1X9NA 1JICA 2B8WA 3LA8A 4OIJA 2VWHA 1I9CA 4QXPA 1CI3M 3BS4A 3W5IA 1OLSB 2VDJA 3G0CA 5EWJB 4A0FA 5FQNA 5CGKA 5IULC 2CD7A 3H1TA 1PMRA 3STBD 2J07A 1IEQA 4XAQA 5DW0A 3UW1A 4ZAXA 1QZGA 3URKA 2GZRA 3RLIA 1M6HA 1UAPA 1DIBA 1JXOA 3MXUA 2RGBA 4PX9A 5JEAJ 4X90A 4DNPA 3Q8XB 3I05A 1E9AA 1EX9A 4L5IA 5A5VA 3JQQA 1XL0A 2PQ2A 2PRKA 2ZUVA 3OT4A 2A0KA 4N9QA 1DXHA 1Z2AA 2G7ZA 2A8VA 1DXQA 3RBXA 4XVUA 1E22A 4IRXA 2A86A 3DMGA 1Y4AE 1HX7A 1JR3A 2Y9MB 2TMKA 4G89A 3OOWA 3ADOA 3BDCA 2PFGA 2QTAA 2BA1A 4P75A 1GQYA 3LC0A 1QOHA 1YRQA 3ENKA 3E3MA 2EQSA 1GZ3A 3FFTA 3OPYI 3NHSA 2OLEA 3PYXA 1PJBA 4V0KA 3KF8A 4ABTA 2Z8YM 1JLSA 4AIMA 4KI0A 2ATIA 2J67A 3T1OA 1K98A 3D4BA 5H8WA 4RDIA 2GMWA 2F0OA 1QK3A 4NOJA 4WLFA 3RVPA 2BFCB 1FYDA 3T9FA 3NT5A 3WLLA 4DCGA 4W6QA 4E33A 5BMVB 5DNVA 3LKBA 3FPPA 5CH3A 5AJVB 3KJIA 3KXDA 4MR9A 2FJ2A 4IGIA 4LI3X 4DV3B 3IFDA 4YC7A 3GAFA 1FLVA 2HK6A 2TSYB 4BMYA 2VJMB 3RF7A 1KETA 3RS3A 4MP8A 2LDBA 2O6HA 2IELA 4WCFC 5T3YA 2RAFA 1JRLA 3MT7A 4JX9A 1NN1A 5EMHA 2B5WA 1Z4KA 1RNLA 4MQ6A 2HRQA 5IC6A 5I4CA 1YU9A 2BF4A 1L4GA 1J2UA 1KHHA 3GFGA 3P5SA 1KMMA 3N8KA 3OZRA 5CURA 4CT4B 2YXLA 1ZEJA 3GW8A 5AM3A 1PFBA 3HOXH 4BXXH 3MIZA 1S02A 1IVYA 4NW2A 1OI3A 2IOFA 4IIHA 1IM2A 1KIAA 1S8AA 5DM2A 3RWBA 1DIOB 3UFXB 3BZCA 3S9WA 3H9GA 3R4CA 1D2CA 1ZN8A 4UNPA 5EQDA 3RVKA 3W5JA 1YE3A 3FOCA 3T56B 4B31A 3B3FA 3LHDA 2IXDA 2K2WA 3RSSA 1A8SA 3KFVA 2CNWA 4KKUA 5LMNQ 1T8TA 1WXQA 1Y1PA 4PYRA 3WGQA 4A8JB 1RJ9A 2C8JA 2K5UA 1J4AA 3VR2A 2Q50A 5ALQA 1K1EA 2QYSA 3UBTA 1D3AA 2GYUA 3A11A 4GOKA 1N77A 3MS2A 5HG0A 2I34A 2O0HA 4F6RB 2QM8A 3AEZA 3V7WA 4Y0NA 4CNQA 3H91A 4B7AA 1QB5D 1Z2DA 4QUGA 2YV1A 2DHCA 2PR2A 1P2DA 2PT7A 3EFEA 4M3NA 3O84A 2JEAI 4MQ5A 3RC3A 3IPAA 3LMKA 1JQ3A 4B47A 4TLAA 3JR3A 1UXIA 1XKQA 2Q5OA 3CHYA 3CF2A 1Z5ZA 1XTJA 1AJEA 3GN1A 4FNGA 1IUKA 3LQKA 4DMKA 5JZBA 1EU1A 4UASA 4XWTA 3VNBA 3WP1B 5M2QA 1NCVA 3JASB 5I9OA 1RZVA 1TMYA 2MT9A 3R74A 5EOVA 2ZYHA 3GROA 3JZAA 3LUJA 1PZFA 2VP5A 3IL8A 5AHXA 4ZXPA 2H63A 3ZOKA 3S1MB 4NKLA 2JL1A 4YMWA 2OCAA 3DZDA 4X3SA 4DLLA 2I7DA 4NXNB 2ZSKA 2Q3JA 4JWKA 2C2ZA 1B0AA 2MMCA 1DXYA 2PMZE 2VYVA 4TPKA 2N46A 5ALTA 3QSYA 4ESOA 4C3JG 3WOVA 1V8DA 3BH0A 4OG2A 1YZNA 4U8HA 3F6BX 4QREA 3ORFA 3KJZA 5IZ4A 1OX6A 2NO1A 1P5HA 3H87A 2HRDA 3NHBA 5DNDA 1HKUA 4L4XA 4UZSA 4ZODA 4EYQA 3LY5A 4N82A 5LMUB 1Z45A 2QTNA 1UF9A 4RIHA 5FEMA 5C3MA 3DJYA 3R6WA 3ENNA 4HN4B 4V0QA 1SU6A 1EEXB 1VMKA 1GQ2A 3H0EA 9LDBA 1IZ6A 1S2GA 1KI6B 4IH4A 4FP5D 1EYZA 4R9WA 1QONA 4MUIA 3WIOA 1Z88A 3EN2A 2BGUA 4JQSA 1HLPA 2E4AA 4RA6B 1I6HB 1QPBA 5C8YB 3PIIA 5J23A 1KRXA 4TQGA 2D0OA 1U7TA 1W9MA 1FTYA 1JEQB 1U2DA 3TQTA 3TZDA 3TP8A 2A9JA 3I64A 3ELWA 2M1ZA 4L2IB 3COWA 5ADUS 2NN6I 1GZUA 1E1DA 1QOZA 2X22A 4F8EA 1D2BA 4GI3A 4RELA 2PCFB 3OQHA 4LWPA 1PDQA 1CKNB 3RIXA 1UT8A 3KEQA 4FHGA 2JS7A 5EZYF 5L3QB 2WB1E 1R18A 2GSWA 3ILVA 2IHKA 3UC5A 3QWAA 4RMHA 2WM8A 5KOHA 1M34E 3QA3E 2IY9A 4LGVA 4GPTA 2NVWA 1RQ7A 4ZC8A 5GIPE 2QU7A 3QRWA 3DA8A 4OMDA 4RAQA 3S5JA 3ZVNA 1G64A 3MRXA 4S04A 1BYUA 3AF5A 2C4MA 3KJPA 1G3IA 5BW4A 2ZW9A 3IP1A 1KZ4A 4X65L 1WW3A 4R8RA 3E27A 5TQ2B 1U28A 2J45A 2PXHA 3FKIB 4E14A 3RYIB 4B9EA 3CD6A 1JQDA 4HCSA 3B3JA 4C9BA 5DOVA 1E6LA 1H0KA 3LM8A 2CL6X 4JYBA 3ERSX 1RKVA 4UARA 1NI5A 3EBLA 3VZDA 3B2NA 3WI7A 3OFND 4LY0A 3TI7A 5A3RA 3F90A 5AW1A 4OIKA 1L7AA 1TUIA 1P18A 3DCIA 3L46A 5EKXA 4PLVA 3RTGA 4DCCA 4QSHA 4P3KA 1YB4A 4AJHA 3K59A 4RABA 5TLSA 3V1LA 1Z35A 3QVWA 4RGOS 1NVVQ 2AQHA 3HR8A 4G4IA 4Y6PA 1EQRA 1DBPA 3W90A 2E1PA 1S4QA 1I3OA 2HCRA 2LKCA 4Z0NA 4LRSB 3I4OA 1YJ9A 3VPBA 3ZTTA 3OZVA 1ONSA 4JAVC 4JLOA 2TMPA 1RBZA 2FP4A 4KAFA 2NVOA 3O8QB 1GM5A 4LYYA 4EB8A 4XX0B 1ODFA 2JGAA 4ZANA 4EMSA 5I48A 2G82A 5K36G 3GGSA 2E76C 1R12A 3UKDA 1MU0A 1G91A 5A9SB 2YOGA 4LVOA 4V0OA 1B0PA 1FFDA 1BYIA 3WNVA 1NVMB 1ZP6A 4ZVNA 2EERA 1N2CE 3AIIA 3PHGA 1GDTA 2R85A 3I92A 2KYRA 2X2PA 3T7RA 4GKKQ 2FKNA 3HG7A 2F0FA 5LQNA 1SE8A 3J7AF 4C6TA 2JSOA 3ID6C 5D86A 2DZDA 1EFRD 1GAXA 1EFRA 4Y67A 4IDFA 2NUTA 4EUNA 1E2JA 2BH8A 3GELA 2FDRA 5JZ9A 3L8ZA 3LP8A 3NIWA 4RHUA 5KDLA 4E1BA 3OQIB 3R4VA 2CFCA 3FZNA 1RQGA 4JP1A 1TEHA 1VGQA 4QXMA 1A15A 2VQDA 4UM7A 3MMXA 2JFNA 4F2GA 1Q22A 4DK6C 1Q1GA 3RYHB 2F1HA 5FOTA 2R8ZA 3WLKX 4ALNA 4XARA 1I3QB 4ENTA 1W4ZA 2R79A 4JVZA 1Z9BA 4E7PA 1MRZA 3A7EA 4INJA 2X6LA 4XSVA 4BRWA 3HOUB 5CA1F 1GSHA 5FI3A 2BMFA 1OWPA 4LA4A 5B3KA 1PJQA 4X6YA 2P9JA 4D99A 2WB1B 3OUTA 3REFA 1ZK3A 3OJCA 4JP8A 2XA9A 3WGVA 5EZSA 2JQOA 1YT5A 2G6BA 3MEHA 1R7RA 1TQ6A 1Z28A 2HU7A 3MGGA 3M49A 4RLFA 4B3SL 1GU1A 1RYYA 4O1HA 3OZFA 3QPBA 4B3BA 2SICE 6NULA 1D6MA 2M2IA 3KDPA 3O1HB 2JIRA 2V1XA 4HL6A 4QOSA 5K9ZA 2Q9UA 2FPXA 5EKUA 5DGCA 4JBMA 1TWAH 4LJ5A 3UGKA 5HTKA 5JZVA 3GJYA 2ZUSA 2NVYH 3LUHA 1IN1A 4M37A 4CR6A 3TXAA 4NU0A 2XNKA 4RF4A 1SC6A 1MGSA 3WE7A 1N5DA 2H1EA 3Q85A 3W5AA 5J4YA 3HWX1 1MH1A 1Z4NA 1FMTA 2OV8A 5COQA 1E2MA 1FUKA 1QC5A 1N1DA 1T4MA 3FUTA 4PHHA 1PRTB 2PH3A 3AETB 1YWGO 4CDEC 4IFTA 1OI7A 2ZAIA 3GLUA 1U8AA 5JAOA 3TR0A 4WFN3 2E7ZA 3F7TA 1SXPA 1O95A 1SROA 3GUZA 2NVTB 2B2VA 1SULA 4R8LA 4RESA 5DNCA 1YNND 3VU3A 4L0QA 1PH2A 4Q48A 1Y9DA 5C44B 2PWZA 2XUPA 5IGBA 4XDYA 3ZY4A 2B2WC 3ADKA 3EVAA 5IJZA 1P2FA 5E7IA 1DC5A 4FJ1A 4DY6A 3H05A 2NO5A 2VPZA 4FYKA 5A06A 2UVPA 4DF7A 5ELFA 1XDWA 1TTHA 2MSEB 1N2EA 1EB9A 1IBRA 2VHTA 2WIKA 1DQZA 2YZNA 2VDOB 2Z2ZA 2CKZB 2ZG6A 4GP7A 4TQAA 1YC2A 5D2CA 3BIWA 5T64A 5IMSA 3NORA 3QWIA 2E21A 3OURA 5AI6A 5FUMA 5D3IB 2OFPA 2QE7A 3TLEA 3OP4A 5IM4F 3G02A 2ZI5A 3CX3A 4FILA 4JB0A 4KVAA 1JEYA 2QMZA 3DTNA 5J2UB 3H2JA 5F2EA 3OM1A 2GN6A 4M9CA 3MCZA 1IEXA 4Y2JA 3TRIA 1MSHA 4X3CA 1UC4B 2WTMA 4FU0A 4KZKA 1U0SY 2G25A 2ZB2A 5HILA 4B4DA 4TV9B 1CBUA 1E3SA 1R6XA 1I2MA 2OBNA 3FMFA 3FTNA 3LYAA 1TXGA 3NBAA 3I6ZA 4GAEA 4IO0A 2BSQA 1WSBA 1QYCA 3R20A 3K9LA 3Q41A 4HNVA 2AG6A 1S5DD 1WXHA 1YQWA 4CKEA 1U2PA 2FSGA 1OFHA 2WPNA 2H4ZA 4ZAYA 1KQNA 3ZWMA 3U60B 3BMQA 3CPHA 4I2NA 3KRTA 4I4TB 1NRIA 1NMYA 2NWQA 4JL6A 3A4NA 1VPVA 1X1TA 3QVXA 1NUCA 1YDGA 2ZIZA 2HIXA 1L7VC 4PG5A 5JVDF 1GYQA 1THGA 1GTRA 2WJYA 4YEDA 1V1MB 5DCWA 1NR4A 3K8ZA 5AXDA 2PKEA 3WV5A 4HK4A 4Z4FA 1A8IA 5JPDA 3U9SA 2V6MA 2YWGA 4YFYA 3STTA 2JFWA 2K28A 1IXZA 4BA1I 1SOUA 4FFLA 4X41A 1RZRD 1MC5A 4KQJA 2XOEA 4TMTA 3SKXA 1T5BA 4EM6A 3DFKA 1UBLS 3AR8A 4ZCIA 1YS6A 1KP2A 5E8JA 4H08A 4K2AA 1KK3A 3TQOA 4LSMA 1QYIA 2MYPA 5DI9A 1TZCA 2VDMB 2I5LX 1QH8B 2Z4SA 4BBSB 4UTXA 1KYQA 4ENWA 3O8DA 2A57A 3D3KA 4J4HA 5G40A 1GUBA 1GCGA 3U31A 2A1UA 2OQKA 3PC8C 5IX8A 3EF1A 1JHQA 3K8OE 2Z58A 1Y1LA 3I2IA 3LOUA 2H85A 1I01A 4OQXA 4IVRA 1PEYA 3R7WB 2YXDA 4MYHA 3PF5A 3L8CA 5FI5A 3GTMB 2D4AA 1E4EA 4PLTA 4U0JA 3N05A 1RRCA 2G9UA 1A0IA 4C2MB 4ZRZA 1IJFA 2WKPA 2WIJA 3IDAA 4DARA 5CBPB 1V5FA 2LUOA 2XUZA 4MO2A 1HSOA 4H4CA 5EWLB 2NACA 1S9HA 3W1GA 3GVIA 3KWLA 4IFIA 3LK6A 5I7HA 1QNFA 1H9SB 2XECA 3R41A 3LNCA 3GUUA 4LFAQ 1GU0A 1PKEA 2DUJA 4UMFA 5CX1B 2QROA 2RGDA 1GN9A 2I2XB 3AONB 3FHLA 2VYQA 3GCZA 3IT1A 1R9MA 4RJ2A 4E94A 2PX5A 4HT3B 3OYYA 1JKFA 1TS2A 4G36A 4GU5A 2QWXA 1XEXA 5E6UB 5U4XA 2C82A 3R8XA 3SPXA 3WWDA 3VI4B 1ULHA 2Q4RA 3CH5A 4CMIB 5JR3A 3NHYA 4GMGA 2FUNB 1E4EB 1JDSA 1UH5A 2JEOA 4F88A 2GN0A 2RIPA 3EBEA 4EGFA 1E0JA 3AERA 1WFQA 2K6GA 5LZ5A 4V3BA 5I2XA 2PSSA 1G8KA 2WFLB 2QRMA 3G85A 4E11A 4CUZA 3H1AA 3UUFA 1BU8A 1N1MA 2JH3A 1D0VA 1YIJA 4HO1X 2NB0A 4OO1H 1Q92A 3A37A</