2BBWA

Crystal structure of human adenylate kinase 4 (ak4) in complex with diguanosine pentaphosphate
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
220
structure length
220
Chain Sequence
KLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords adenylate kinase 4, AK4
publication title Crystal structure of human adenylate kinase 4 (AK4) in complex with diguanosine pentaphosphate
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 73
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 2.7.4.10: Nucleoside-triphosphate--adenylate kinase.
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bbwA00
3ZIAD 3AVWA 3KKQA 3CX6A 2JCSA 2FWRA 1MV5A 2ATXA 3OEED 3U3MA 4NCHA 2WWHA 4Z51A 2VLIA 4PSVA 3RABA 2RH5A 1NVVR 1KI9A 3NDBB 2FSIA 4PR0A 2REOA 3BK7A 5JFGA 5HTKA 3L0OA 1VTKA 1XWIA 3AGQA 3R8CA 1DO2A 1O3YA 3CKLA 2C9OA 2GXUA 4NONA 3TMKA 2J0UB 3FPAA 3SJBA 3B5JA 3PEUA 3Q9LA 5BW8A 1P9RA 4PANA 3B1ZA 1G9XA 4B34A 5JZVA 4QGFA 3TSOA 2N1BA 4M1MA 1F48A 3ZH9B 1E2GA 1OFTA 2QORA 2X8AA 3GJ4A 3C5CA 1OKKA 1ZBDA 2PX3A 4IRUB 3IDQA 1GIAA 4EFMA 4D0NA 2Z43A 4HAWA 4KO8A 2IF0A 4BGDA 5GVRA 1KJYA 2IWRA 3ZYCA 5L3QB 5LBIA 5EE9A 1ZAKA 2WJYA 1EWQA 2GJSA 2HV8A 4GP6A 1KHTA 2F3TA 1DAMA 2GZHA 2WJGA 1GSIA 5FPSA 4JS0A 2OV2A 1QHHB 2A30A 1DAKA 1YJ5A 2FJUA 4PZZA 4OK3A 1VCIA 3ZQJA 1GP2A 2NO0A 5LD2B 5IF9A 3SJAA 2O8EA 1MABA 4QXAA 3RSLA 3PUXA 1NMYA 2HYDA 4FW9A 4AYWA 4D4LA 4DLZA 4R2HA 3AKYA 2ZR0A 3H2YA 1YHNA 1WDTA 4TL8A 2WTUA 2YZ2A 1GITA 2I4IA 3EC1A 2C04A 1MO3A 1JR3D 4CRWB 4HAYA 4AKEA 1J7KA 2O0KA 2G3YA 2QTHA 4ZIRB 4MGYR 4U5XA 4H9GA 2RMKA 4C2TA 3CRW1 3AGPA 3SYKA 5JMTA 3T5GA 1DELA 3KJGA 1RIFA 4F38A 2ZRNA 3B9QA 4A0FA 2FEOA 4JBWA 5DN6A 4Q4LA 3GQBA 3H0KA 3U3KA 1A2KC 2FDCA 2CHVA 2JATA 2QL6A 3VKWA 1D6JA 1S9HA 1J2JA 3GLHA 4DJTA 3LVQE 1GKIA 4DDWA 3IO3A 1W5SA 1ZIPA 2WKQA 3EWAA 4DSNA 5KNCA 2EVWX 1JQJC 3GJ6A 3QXJA 4DCVA 2GZAA 2V6JA 4QJ3A 1AKYA 1KKMA 1Z6YA 2W58A 4ZDWA 1HUQA 3R7WA 1XPRA 1ZRHA 3BAFA 2YV5A 2QPTA 4FWIB 3OEHA 5GJCA 3K0AA 4CYMA 5KSPA 2QENA 3KJEA 3J81k 2Q3FA 1E32A 8OHMA 1I2DA 1T0HB 3K1JA 4LGMA 3UIEA 3PENA 1EGAA 1EX7A 3MWJA 4J0QA 5D3QA 4W5HA 2ODEA 4Q00A 5FTLA 2NO7A 2QGNA 4AYTA 1DG1G 1WA5A 6Q21A 4RD6A 4IDPA 2UVQA 1NBME 3H84A 4TWZA 3GJXC 4TTRA 1T3LA 4Q7JB 4HAUA 1COWA 4JJKA 4OQXA 1I4TD 3LW7A 4BLRA 4Y0VA 4XD7D 3GJ7A 4OQFA 3VU9B 3BIFA 2ZJ8A 3KUDA 3ZVMA 3LLMA 4EDHA 2XAUA 1SVMA 4NE2A 1VG1A 1X6VA 421PA 3PUWA 3VFDA 4FMCB 5KYKA 2I1QA 4QGHA 4LJYA 4ABYA 1BYIA 3QEJA 2RGXA 4URVR 1ZUHA 1A4RA 1E2MA 2OO7A 2XNDA 2ZSEA 4ZV4A 3DKVA 3CM0A 2O8DB 2P65A 1U8YA 821PA 1DG3A 2Q6TA 3TSZA 3X1XA 3ZLJA 2OBNA 3E2IA 4A8JB 4G01B 1G7RA 4KAXA 2MMCA 4PHGA 5A0FA 2OT3B 5TXGA 4URXR 1PVOA 3DKPA 4IDHA 1JJ7A 3MWLA 1VCOA 1N5IA 1S8FA 2FFQA 1R5NA 1XD2B 3ZVRA 3X1WA 3K0CC 3C15C 3QBTA 5GJWC 2IK8A 3RYTC 2GCPA 5CM9C 3UMSA 5SZKB 1P6XA 1U0LA 3FDIA 1E0KA 4PHHA 3EA0A 1E0AA 1G1MA 3CPHA 2ZE8A 3SBEA 4US2R 2O8BA 2SHKA 1XPOA 4AC9A 3MLEA 4DDVA 3W6PA 4TMZA 3FHTA 4TZ0A 1S1CA 2ZJOA 2BVNA 3HYTA 5DO9A 5HE8A 1P3JA 3X2SA 2WHXA 1TF5A 1E79A 4LPKA 5GJVC 3HP1A 2FSFA 3PV0A 3Q72A 4M53A 2ODWA 1M7HA 3N2IA 3AP3A 5JWOA 1N6LA 1XXHE 1MOZA 2BMEA 2ZYWX 5EXSA 3U7HB 4IOJA 1E69A 2ZAOA 3A36A 4JKIA 1SVLA 1OFUX 4YDHB 4DT1B 1GRNA 2QQEA 2WOOA 4JT4A 3B82A 3QE0A 3O47A 1OLOA 1JNYA 1UJ2A 5K8TA 2V1XA 4DXAA 2F6RA 4GPTA 3LXXA 2J87A 2CNWA 2D06A 3IBYA 2V4ZA 1RJ9B 5BQ5A 4C30A 1NN5A 2LKDA 1KI4A 1T5LA 2B21A 2NO6A 2OFXA 5P21A 2ZVQX 3V4FA 3I92A 2QTFA 3NVAA 3DL0A 4LYHA 4X8LA 1E2FA 2VF7A 4LRWA 4U02A 1KAOA 1CR4A 2QE7D 3AVXA 3L8YA 1KMQA 2CDNA 4DVGA 5K8IA 4BFUA 4PX9A 3BRWD 2QRZA 4XTCS 1Y63A 3QG5A 1Q1ZA 3DMDA 1VECA 2WZQA 1IY1A 1T6NA 2WJHA 4RD0A 3THXA 1FNMA 3EASA 2D7CA 4HLDA 5KNDA 2IXGA 4EAQA 2C95A 1N3BA 2BM0A 4BUJA 1CR2A 3VMFA 2C03A 4R9UC 3ZZTA 5E3HA 1CS4C 4BZPA 4RFSB 1I2MA 3LXRA 3PJRA 2MMGA 5DYGA 2BKUA 4B6EA 1W0KD 4GRAA 3WP0A 1KYIA 3DO6A 3KUCA 4NCJA 2GEVA 2AXNA 1P72A 2CLSA 2PCLA 2ODNA 4FCVA 1EG7A 3NKVA 4EIWA 1JEEA 1G8GA 3VNVA 2QA5A 3K0EA 1F60A 3H4MA 4IOLA 4FN5A 2FMXA 2KJQA 2F1JA 4LV8B 4LBYA 3IIKA 4P33A 4BLQA 4LV5B 3W5JA 1UEIA 3FMFA 1RC8A 1XBTA 2YOHA 1IXSB 1YR9A 3O8BA 1KZ7B 1DEKA 3CZPA 2QP4A 1N5JA 4KCGA 1W5TA 3U3OA 1Z3IX 4ERNA 2KBEA 1J70A 1P4SA 1IBRA 3NC0C 5F2EA 4P0TA 5EUQB 2FNAA 4CEJA 1BKDR 1FP7A 3BJIC 3FYHA 2XTMA 3Q3JB 3SOPA 2BJVA 5J4VA 4HAZA 4UKDA 4C0QC 1TPZA 1M8PA 5TB5A 1A82A 2H18A 4IDOA 4H1VA 4Q21A 2PJZA 1TQ2A 3K0CA 2G0NA 3OFND 4I81A 1T0JB 3REFA 2WJJA 2O8EB 2BHRA 1UKYA 4JL5A 1F6BA 2GRJA 1KO5A 2ZRGA 1GM5A 2ZITA 4HAXA 1ZW6A 1ZVQA 3JZMA 2I3BA 1CEEA 5JI2E 4M8NE 4X8HA 2JLRA 4GP7A 4B43A 4AWXA 4A15A 3SEAA 2E87A 3D6TB 2DY1A 2IEYA 4OHVA 2NIPA 1IY2A 3X1DA 2PMDA 4OKSA 1XEXA 4KHZA 4RKEA 2ZE6A 5JRZA 2QMUA 4ZCIA 3ZD7A 2IF2A 3UATA 5C46F 1SKYB 3ZJYA 2QY9A 3RLFA 2XGJA 1DAIA 1E0JA 3AF2A 2VTKA 3GD7A 2O8DA 4TMWA 2VF8A 4HLUC 1GOTA 2WSMA 4ZI2A 2P67A 4CEHA 4PTLA 1BMFA 1FX0A 3WBJA 3TW4A 4NP6A 2VHJA 4HB3A 4S2EA 1MABB 3FB4A 3N70A 3CR7A 5JJKA 4ITRC 1HURA 3S1AB 4C0SA 3QKUA 2O8FB 2H92A 3FFBA 4B3DA 3MUFA 2ZYUX 3W9YA 4UJ3A 3AKCA 4F92B 4IVPA 1TADA 2OBLA 1EFHA 3EIQA 4YMWA 4XVRA 4HLUA 3KKOA 4TTQA 5EE5B 2PX0A 4LOAA 4KU4A 1XJQA 3PR1A 5FBLB 3GFPA 1KI8A 4MRRA 1DPFA 4FMBB 4D80A 5H70A 5FBVB 2QN6A 4PHTA 2C8VA 2GA8A 4KFRA 3AUYA 3GLHB 2V8OA 3AF0A 3CRVA 1G3RA 1T4GA 1GVNB 1P5ZB 2BMDA 3A1WA 4IKEA 3DPUA 3G0HA 4LBVA 2O0HA 1OIXA 5F98A 2QZ4A 2IYQA 5FTJA 3F0TA 4OHWA 2WKPA 4BQSA 2XTZA 4KITB 2W00A 5B30A 4MYTA 4MITA 2A9KA 3GEIA 4NYMR 4PC6A 4KLNA 2AFIE 2VRWA 1GUAA 1RYFA 4DCSA 3C16C 1Z6GA 2RGNC 2FG5A 3EWSA 1PLJA 2ZI7A 3TVDA 1Q22A 4LJ5A 4AKGA 5LB4A 5FUVA 1SQ5A 2WWFA 4LUCA 3VAAA 3GLFB 2WM9B 2DCUA 5H8WA 3K9HA 1IXZA 2BBOA 1SXJD 1AS3A 1XZPA 2F7SA 1RKBA 3R9WA 3D8BA 2IYWA 2WMNB 1VKJA 1OT3A 3QIAA 2AK3A 5G40A 1Q1EA 5AJXA 3BGWA 2Q21A 2ZJYA 4RSGA 3FE2A 4ZDKA 5J4HA 1PUIA 2KWIA 1NLZA 2G0TA 3BB1A 2ZTSA 5EXXA 3WXMA 4KSCA 3EC2A 3TGPA 4DLUA 4GDFA 4QJ4A 2WVJA 5EJEA 3U7GA 1KI6B 3V9PA 2BEKA 5AUOB 1XJCA 3AF1A 3SJCA 1NL3A 1G7SA 2A7QA 1QG2A 2QMEA 3RC8A 2IBMA 3DHWC 4KFSA 3CF0A 2ZE7A 3AUXA 2NZJA 3NBZC 1CJTC 5CM8B 1ELOA 5FOUA 2QAGC 4Q02A 4KODA 2QMHA 2WWIA 1Z2CA 4XVQA 4LDJA 2Z0MA 5EE0A 3LX5A 2G88A 1R8QA 2GCNA 5JLJA 3CW2A 4POAA 4G5QA 3KXIA 3WMFA 1U90A 5KUTA 4TTPA 5FPYA 2OSBA 1Q20A 3O8CA 4I99A 3L8ZA 4QFMA 3GEEA 2VSXA 3TVTA 3TUJC 4QGAA 2YC4C 4AURA 1VYTA 3W90A 3QY0A 3QKTA 2CNWD 4LJ7A 4OHYA 1Z5ZA 1C4OA 2OG2A 2A2ZA 4LJ8A 4TL7A 3CRMA 1Z0DA 4JLVA 1QHIA 3KQHA 3U3RA 4Q01A 4QRHA 2ATVA 2GCOB 1P75A 3TSWA 1A1VA 3SHFA 1Z0IA 1EXMA 1II8B 4GL2A 1Z63A 1SKYE 4QG7A 2AWNA 1OPXA 2DFTA 4M21A 1AJEA 1PJRA 2CBZA 1J90A 1Q12A 5FBRB 1XJ0A 1W2HA 1G5RA 1N6KA 1ZP6A 2C9YA 3DVLA 4OQLA 1RRCA 4JLNA 1JPJA 5FBWB 1YQTA 2OAP1 2IYRA 2XTNA 4TMVA 2D4HA 3OIUA 2OZEA 5HE9A 1MO6A 1W0KA 1GL9B 4JL8A 1G4AE 5KNBA 2R2AA 1WMSA 4M4SA 1U0HC 4DKXA 1KMHB 2R6AA 3FFAA 2RCNA 1RRPA 3MCAA 3QPVA 3X1ZA 5IT5A 2NMVA 1AKEA 4AYXA 4CEIB 4ZDIA 1NIJA 2JJ1D 1HY3A 1OH7A 4A6PA 1X8KA 2PZGA 3FWYA 4MKHA 2VQSA 2CL0X 2ZRKA 1GNPA 1G3QA 3DEFA 4ZDJA 3WHKA 3K70C 3QI2A 4HLCA 1U8AA 5JSZA 3SI7A 3CB4A 4C2UA 4Y0AA 4MDEA 4FMDF 4BE7B 2P5SA 2G9NA 1S2MA 2F9LA 2W2TA 5C2JB 1N5KA 1W4BA 2YWGA 1TQ4A 4M2LA 5F9FA 2IX3A 3RRYA 4YMTA 2IYVA 4M9QA 3T1QA 3G5UA 4JL6A 5M04A 4B3XA 4NYIQ 1Z22A 1EFRD 5GJBA 1Q3HA 3M6AA 3OESA 1W44A 4CT4B 2AKYA 3K0SA 3IQWA 4TL9A 4M1SA 2ZJ5A 1E1RA 3T34A 3I5YA 4Q5IA 2IC5A 1YZUA 4BRUA 1ZM3A 1FOEB 3OIVA 5TARA 3VR6A 2VSFA 2V7QD 5LPNA 4A82A 4QBFA 3CO5A 4QBHA 1D8TA 5IHPA 1GAJA 1R0ZA 5HCNA 5ELXA 1W36B 2G83A 4ZI3A 1D5CA 4D81A 3CH4B 3GFOA 1TNDA 4DSTA 3ND9A 3QXHA 2DBYA 1W4AA 1AGRA 3NBFA 4KJZA 3TAHA 3IBGA 4QNRA 5K8LA 3LDAA 2FFHA 3K0FB 1IHUA 3WY9A 2AFHE 2RGEA 1U99A 2A78A 4O2LA 4EKDA 1Z28A 3UG7A 4EPRA 4M1TA 1RJ9A 2HT6A 3QXSA 5CYPA 1P61B 1FL9A 3JVUA 4F91B 3ZIAA 2DFKB 4URZR 2G1KA 1X8LA 4N1AA 2IS1A 2KB0A 4HATA 3U6BA 4JYBA 4TN1A 2IUTA 4B2PA 2F55A 4I1VA 2IHYA 2ZUDA 1NMZA 3CPEA 3IEUA 2QPAA 4JLPA 4JLJA 5UKDA 4EQ6A 4Q1FA 2EWVA 1NRJB 2ZAMA 1L4UA 1ZM2A 2CLCX 3QF4B 2ONKA 3AB3A 1Z8FA 1E9SA 3FMOB 4F93B 1EFTA 4QGGA 2PCJA 3TLXA 1K8RA 2ZSAA 1W4RA 3MJHA 1AA9A 3LWNA 4D4JA 1XMVA 4Q47A 1GILA 3OZXA 3FKQA 5CLLA 5HKKA 2OCPA 1ODFA 4RY2A 1QHXA 3NBYC 4DUGD 1W47A 3W5IA 1E0SA 1T3SA 3GP8A 4ARZB 2QPOA 1Z0KA 3D3QA 3H86A 1SVSA 5C4MA 1MKYA 3BB4A 3OIYA 4NL4H 2ZRHA 3I1FA 1U94A 3AF4A 1P2SA 2GK6A 3B8HA 1R7RA 1OHHD 1CIPA 3IO5A 4HSEA 1NI3A 2WWWA 2DYKA 4D82A 1XF9A 4WXPA 2ZREA 4QM6A 2V1UA 3VTKA 3BH6A 5DI3B 1ZNWA 4I1SA 1MO4A 3I73A 1G291 1UFQA 3NHBA 3BOSA 4E5UA 4II7A 1LS6A 1QRAA 2EFEB 3EAQA 2HT1A 1KI6A 2ZRFA 2QM8A 2R6DA 4TYWA 4RZUA 2MSDB 4KFUA 1G7TA 4CVNA 3GJ0A 1HT2E 2NPIA 1KY3A 1TUEA 2YOFA 3QOFA 5FUYA 4G5OA 3B1VA 3ASZA 4B6FA 3CWZA 3IIMA 3LQQA 3PEYA 1IY0A 1NIPA 1S3GA 2GVDC 1E1RD 1M6NA 3I32A 2QMOA 1OXTA 5DYIA 4EUNA 4O2RA 4PO8A 1G8YA 3RVBA 2V3CC 1KAGA 4AG6A 1X1SA 2GBLA 5KDDA 1GRRA 4RD1A 2MSCB 5G3YA 1DTSA 2IT1A 2Q3MA 5G53C 2GKSA 2GF0A 3ZVNA 3K0FA 1G5PA 1RRFA 4EFLA 4NCIA 4OQNA 3IUYA 1UKEA 3WYAA 3CIOA 2BBSA 1NN0A 4GMDA 1ZNZA 1NBMD 4MGIR 4Q9JA 5G3ZA 1EWRA 1WE2A 4NTZA 1V43A 3REGA 2IUUA 1X1RA 4HZUA 4JLOA 4US0R 2IYZA 1JECA 4NHOA 3U4QA 4TQUS 2REBA 5KSYA 1EX6A 1XCPA 3EARA 4B32A 3L0SA 2AWOA 3T5DA 2YWFA 2Q3HA 3EZ9A 2JLUA 1FQKA 5J4YA 3O8RA 3KDSE 3K8YA 3SFZA 2IYXA 3B9PA 3FOZA 2AKAB 1AS2A 4Q1DA 2O8FA 2AN9A 4C0HA 4A9AA 4DB2A 4CIDA 2CJWB 2XNSA 4IW3B 1E2LA 4A1FA 1DAHA 1SXJC 2WWGA 3MWYW 4DRZA 4TYNA 4QC2A 3FHOA 4R7ZA 4Q4JB 3NXSA 2EWWA 2DFNA 4WVFA 2KSQA 3KQNA 4GFDA 3C14C 4OHZA 1PZNA 1R6BX 2R8RA 3WRYC 5JJIA 1CJKC 1ZNYA 3FKSA 3NC1C 1IJEA 1DOAA 4DZZA 1QVRA 3KQKA 2LWIA 3BFXA 1HE1C 1UKVY 3BC1A 5J40A 1CTQA 2NTYC 2VO1A 4QJ5A 3GLIA 4G5RA 1JAIA 2X2EA 1T8TA 1NVXQ 2WIAA 1OXUA 2XZOA 4BPBA 2ASEA 1U81A 5L3SA 2ZI3A 3VU9A 3C8UA 2H5EA 2J5XA 3HR7A 3NH6A 4WZBE 4BFSA 2ZI4A 3RANA 5AUPB 5KHOC 1K5DA 4EPTA 4IOMA 1NF3A 3UK6A 2OE2A 5IK2A 4NMMA 1WRBA 1P73A 2CE2X 4A2PA 1CRQA 2OM2A 5F9HA 4LJ4A 2JEOA 3SHWA 3BXZA 1KO8A 2OEPA 4H1UA 3QJYA 3I5XA 2ERYA 3QF7A 4MYCA 4JYCA 4UNNA 4HB4A 3LY5A 2PT5A 4DCUA 3HYRA 2ZE5A 3EPLA 4LX0A 1KDRA 3L43A 1T3HA 1SVOA 1ZUIA 3V4RA 1IONA 4HDQB 4GSYA 3DDCA 3RS3A 2FF7A 3KXKA 4MQBA 3TUIC 4DLSA 4QHYA 4XSGA 3JVVA 2CHQA 4JJZA 2G77B 1W36C 1FP6A 1GWNA 3P32A 2AK2A 5IDVA 2JDIA 5SZJA 5E7IA 4CEIA 2P0EA 1VMAA 1CJVC 5CDFA 1KGDA 5BWMA 1U8ZA 3QUSA 3B1WA 2GJ8A 3HU2A 2QG6A 4BFXA 2VHCA 1HTWA 3KJHA 2ZXUA 1XTIA 3IILA 2ZANA 3M0EA 3IHWA 2QAGB 3VR4A 3D7MA 4WOPA 3ASYA 4R98A 1US8A 3U5ZB 2FSGA 4KVAA 4DIEA 1T8UA 4HB0A 4W5WA 4GOKA 5AJVB 2ZR9A 2PZFA 3F8TA 3ZVLA 4DHEA 4GOJA 1AM4D 1KJZA 2ZSBA 2PJRA 4GBMA 4MKGA 1S4QA 1G3UA 4A0RA 4JLAA 2ZYTX 2FH5B 5DNYB 1M7BA 2CVFA 2FPMA 4JT2A 1NJFA 3ZD6A 4P4SA 4OHXA 4EJSC 2JAQA 2WPDA 3BE4A 5JCPA 3DM9B 1IN7A 4D26A 2J7KA 2OCAA 4TLAA 2QROA 2C2HA 1M7GA 5AJZA 2RB4A 3B13B 4L8GA 3T35A 1TAGA 1ZC3A 2V55B 4D0LB 4DBLC 2VHTA 4QOSA 1IN6A 3ZZUA 4BASA 4FI3C 3GLFA 2D7DA 4L9WA 4E03A 1PLKA 3I4LA 1G41A 5CLQA 2PBRA 2QBYB 5FR1A 4B44A 3ECCA 5J4KA 2ZRJA 5JHGB 3ND8A 1GTVA 1KI7A 1OSNA 1YZKA 4ON9A 2A5JA 2WWXA 3V00A 2B7BA 2XJ4A 4MKIA 3KB2A 4W7SA 1T91A 1OHHA 2EYQA 1HH4A 4XWOA 1VG9B 3KQLA 1G16A 2J59A 4ACBA 4JIMA 5FOTA 2RKOA 4W9MC 5CIWA 3WRXC 2QSYA 1UM8A 3GLHE 3SBDA 2BJWA 3CNNA 4GOXA 1V5WA 4RZ2A 4DSUA 1NN1A 2WBLC 1N6HA 2PLFA 4S35A 1E79D 1G8FA 2PH1A 1N5LA 4WA7A 4M9ZA 2A5FA 1OFHA 4URUR 4B35A 1CJUC 1P7CA 1WP9A 2JJ8A 5HCIA 4BECA 1AZTA 1XTQA 5DE3A 2A5GA 4QHSA 1DO0A 2HCJB 4GNKA 1IN8A 2N46A 3GCGA 4M9SA 4LHWA 2C78A 4KSBA 3THWA 2HLDD 1E9AA 5KPDA 2XB4A 2ZU0C 4LBZA 3WBKA 3P4XA 2IW3A 4IEIA 1IJFA 2PZEA 1KJWA 4BEJA 3NTUA 1Q1QA 1NBMA 1ZYUA 4YMVA 3VHXA 3SNHA 1M74A 2Q9CA 3GLIB 1H65A 4LK2A 4JSYA 2UZ3A 4B73A 1KIMA 5AK0A 5ANRB 2B6HA 2W0MA 5FPHA 2J7PA 4O25A 3T1VA 3LNCA 1W0JA 3K9LA 3NBXX 1YE8A 4PSKA 4L15A 1AZSC 1ZD1A 4YXWA 2IS6A 4D4KA 1OYYA 1N6IA 1G4UR 5L3QA 3LRPA 4Q4AA 2Z4RA 3RAPR 1ONBA 2H7VA 4TMTA 3GFTA 121PA 2QRNA 1E94E 4QBIA 4B74A 1E9DA 1E9BA 1TQ6A 3LD9A 2GZDA 4OBEA 1GRQA 3VR1A 1Z0JA 4CZ2A 2GBLC 3KFXA 1QHYA 1WB9A 1RPZA 3SN6A 1E2JA 5HPYB 3T61A 2YOGA 3ICEA 4NDZA 4LHVA 2PT7A 4RCYA 3HPRA 4Q66C 1GG2A 2WJVA 1UADA 2WPDD 1D2NA 4KLZA 3RRZA 4RFSA 5FL7D 3Q7PA 3VQTA 3NWJA 2VL7A 2FA9A 3SFVA 1W48A 4NCKA 4RFVA 1Q57A 1R10A 3B1XA 1XMJA 1OB2A 1TEXA 3FMPB 4NYMQ 3K9NA 2QU8A 3AKEA 1A7JA 1D9ZA 1G6OA 1FTNA 1SULA 3KKPA 4PPQA 1E9RA 3DZDA 4DLVA 2DB3A 1UPTA 1UKZA 2C5LA 3QSYA 3PUVA 4Q1CA 4AIIA 3AVUA 3CUEF 2QT1A 3CRRA 4A2WA 4ZCLA 1BH2A 1Z08A 1XXHA 3W6NA 1SXJA 4LJ6A 2BEJA 2Z5FA 4N0EA 1AQYA 3GLIE 5B2ZA 1ZINA 2FSHA 4BZXA 5L8VA 3AQ4A 2NGRA 4C4PA 3EXAA 1HA3A 2AXPA 1KTVA 2YKGA 4G5SA 1P2UA 3AP1A 2HJGA 3LFUA 1ESNA 2VP0A 1UEJA 4Q7LA 5LB2A 2V9PA 3W3ZB 3BERA 3RRNA 4O3MA 1SVKA 4YMUA 2J9RA 4Q9LA 1NSTA 2XEXA 4A6XA 3TIFA 5KSOA 1QHHA 2BMFA 2ZRLA 2RHDA 1VCMA 3KTAA 4WAUA 3LAWA 1KI2A 4TYQA 2EQBA 4PXAA 3TUZC 1CKEA 4C9BA 2D2EA 5J5CA 4CGZA 3MAAC 4TL6A 5HR5A 3T1TA 4B75A 1S96A 2C98A 3LV8A 5BN3A 1HQYE 4OK6A 2VHQA 1F2TB 4XTRA 3RS7A 5BN5A 4EPXA 1EESA 3VKHA 2O52A 1Q21A 1N0UA 4Q19A 3EPJA 1JXOA 1M1YE 4X8MA 3ZS9A 3LBHA 4Z1MA 4MDFA 1YZNA 3AVOA 1M34E 1XDBA 4EJSB 2ZUCA 4XVUA 5B57C 5B58C 1GL7A 3L2OB 3W34A 3CR8A 2ECKA 2XOKD 1E9EA 2BM1A 5SZHB 4HEJA 5J47A 2IA5A 1G19A 1QVAA 2QE7A 5LD2C 4B3CA 1IXRC 3L0PA 2BMJA 4ZIRA 4BFVA 4MYUA 4PSAA 1KY2A 3QKRB 2HXYA 2IEZA 2YJTD 2IWHA 1OXXK 1A5TA 2VHUA 4HUTA 1IM2A 5B64A 1G17A 2DPXA 4B33A 4D2IA 1ZD9A 4TSFD 4CEHB 4X8OA 2YYZA 3WNDA 4P4UA 4UQOA 5D3MB 4B76A 4IFBA 4GZLA 2ZJBA 2BKEA 1TF7A 1Q44A 1F3OA 4B3GA 4B48A 3O8DA 1D2EA 4CF7A 1SVIA 3LQRA 2WAXA 2RGBA 4AG5A 3QKSA 1LV7A 4G3XA 5DISB 2A3RA 1NVUQ 1SHKA 2D2FA 3A4LA 3S1AA 1LB1B 4TQ9A 1AGPA 2ZUBA 1KDOA 2HF8A 4JKYA 1T9HA 1TEVA 1XTKA 5DIFA 5FI1B 2F3RA 2FFBA 4US1R 3WMGA 3HU3A 2ZPTX 3LLUA 5K8UA 4JLMA 3CF2A 4OK5A 3OIWA 1E2KA 2R6GA 2PMKA 3LBIA 3MJRA 2YWEA 5TDHA 3ETLA 1CLUA 4LHXA 2GEDA 5IK2D 1NKTA 4L4UA 2ZS9A 1KOFA 1E98A 1P2TA 2QAGA 1XEXB 3I72A 3KQUA 3BH7A 1NLFA 3WYGA 4N3NA 4Q18A 4QM7A 2QBYA 4TT3D 4LHZA 2F1RA 2LCFA 2XSZA 3E1SA 3PQCA 5FOVA 5JWHA 1F2UB 4V0NA 5FR2A 4TQAA 1XEWY 3RHFA 2NOAA 3L0IB 1PLLA 2W6JA 4MRVA 3QPUA 4ASUD 3EW9A 1KSJA 2VH5R 2DWPA 4AK9A 2VPPA 4TMXA 1CF4A 4PPGA 4V0OA 2O0JA 3Q8XB 5EP3A 4KXFB 1MRNA 1Z83A 4Q9IA 2QM7A 3KTAB 5TMPA 3BWDD 2B8WA 4HZUB 3EX7C 3TH5A 3K53A 4LWZA 1RFLA 4B3BA 2Y8EA 5KDOA 1E1QD 4P4SB 2IUSA 5L3RA 3CBQA 3RS2A 4DEXA 1XX6A 3CONA 3W8RA 2ZSDA 2P2LA 4JVSB 4TLDA 1GL6A 3SZRA 5JWRA 2GEUA 3MG9A 4NU0A 1KK1A 1FMLA 1EFUA 1FX0B 2ZS7A 2IS4A 1E2IA 5DSZA 3R7WB 4IXMA 4AD8A 2WSSD 1NJGA 2R65A 3BH0A 1LVGA 5FUXA 4XSHA 1DBSA 1QHGA 4YMSA 1OIVA 1W2GA 521PA 1VG8A 1Z2AA 2C96A 4OQMA 2FGJA 1ZJ6A 1W1WA 1HQCA 1YZTA 3KKMA 1XU4A 4LHYA 3OEEA 1KO1A 1SZPA 1E9FA 3B78A 2X19A 2O8CA 1C9KA 2ZJ2A 3CNOA 4A0HA 2AR7A 3M1IA 2VA8A 2EFGA 3WMEA 2GESA 4E09A 3GLGE 1MRSA 1Z6AA 4TZ6A 2AL7A 1H8HD 2C77A 1KI1A 3GPLA 2JGNA 4JVMA 2P3SA 4ACAA 4DEYA 3GLFE 3AEZA 3NEJA 4C7OB 4KVGA 1RW4A 3OE7A 4PC2A 4L16A 3U61B 4LV6A 4DSOA 4BZQA 3AVVA 5HZKA 5CK4A 1GFIA 1COWD 3U44B 3K0AB 4AKHA 2HJVA 2XB2A 4PHFA 4C0JA 1TMKA 4XD7A 5EUMA 4AI6A 3QENA 4C3ZA 4GI7A 4D6PA 2CHGA 2EFDB 5JJLA 4DDUA 4RZ3A 1Z29A 2J0UA 3RC3A 2A5DA 2B8TA 1LFDB 1II0A 3C5HA 3MWKA 1Z07A 2RGAA 4PAQA 2GVZC 4MGKR 2ZRMA 1DS6A 3AVPA 1CULC 1OKKD 1ESMA 1ANKA 3BBPA 1OE0A 2XNDD 5GVSA 2NPFA 4AKIA 3QXCA 4NYIR 2W6ID 2CMKA 5KDLA 2ZYVX 2IHBA 4YDSA 2BIFA 4YC7A 1CR1A 2PL3A 2TMKA 5FOSA 3SC3A 4BRWA 1HV8A 2H17A 5JS7A 1JALA 3I3SR 3K70B 1TL7C 2YVUA 2Z4SA 2J41A 1NVVQ 3UANA 3I61A 3U60B 2GJ9A 4O0MA 5JRJA 1EFRA 2ZRIA 5C4GB 2WWYA 4PQRA 3C41J 3IGFA 4Q9KA 4AY2A 1MH1A 2BDTA 2XZPA 3TJZA 2DR3A 3TE6A 4Z8XA 2ZM5A 4PQFA 1NP6A 3QG1A 2W6JD 2ORVA 5JEEA 1LS1A 2NQ2C 3VR5A 2FE4A 1E9CA 4IJMA 4JLDA 5H1YA 1N0WA 3A4MA 1UDXA 2UZIR 4WZAE 5CJ2A 2V7QA 1NN3A 3P26A 4JSTA 4PO9A 3DOEA 1B23P 5AUNB 1LY1A 1W49A 2CLDX 2IYSA 4LC1A 2ZRAA 1XD2A 4WIAA 2DWOA 1L8QA 4I1UA 4F4CA 4LSGA 2J0QA 3PIRA 2NO9A 4IVQA 2FU5C 3AP2A 4RD2A 2ZJAA 1XD9A 4RJLA 2OHFA 3PXGA 3MMPA 4GZMA 2R44A 3KX2A 3U3JA 1IN5A 1G8HA 2GCOA 3AM1A 5EXPA 5H68A 3R8FA 1CBUA 4Z1MD 1FW6A 2WV9A 1CJMA 3ADKA 3FHCB 3N5CA 4OJKA 2WMOB 3RWMB 3BD9A 3QNUA 4QNMA 5FPTA 3UWKA 2ORIA 1U2RA 1I4LD 4F7WA 3T12A 5EP2A 4FCWA 2FFAA 4TLBA 4TSFA 1CR0A 1KZGB 1NNEA 2DFLA 2JLYA 4TYPA 3ADDA 2R62A 2XX3A 1N6RA 3FTQA 4EJSA 4V03A 3HR8A 3B7GA 1E6CA 3ZZ0A 5A5GA 1W36D 1UBCA 5E95A 2W2VA 2ZS8A 2EU8A 5KTYA 2OFWA 4B2LA 1WBDA 4A36A 1AS0A 5JI3E 4G5GA 3PCRB 3Q7QA 4Q48A 3UWOA 2HCBA 4DCNA 1VHLA 4DC9A 2GHIA 2CL6X 5HKKD 2GXQA 5FL7A 1HT1E 2PLRA 4UNSA 2IS2A 3K70D 4DLXA 4DUGA 1SXJE 3FGNA 2W83A 2X77A 3RS5A 1VIAA 5CJPA 3TR0A 3AVTA 4EPVA 1RRGA 1E3MA 2YINC 2AHOA 1NSFA 4RZXA 5JCZA 1Z0FA 1XPUA 3TRFA 1L7VC 4MA4A 4OL0A 3SDZA 1EK0A 1QHSA 2ZU6A 2CK3D 5DGXA 2GXSA 3RNLA 1KO4A 3W8NA 4FXPA 2JLWA 3MD0A 1G7CA 2OXCA 4HUQB 4W5JA 3THOA 4BEBA 4QBGB 1OH6A 4MKFA 2XXAA 1P62B 2FPKA 3X1YA 2BCJQ 2CJWA 2MSEB 2QGZA 1ZM4A 3BS4A 4KI0A 2ZI9A 4GMXA 5BN4A 3THYB 1OH5A 3EZ7A 1E4VA 1E2DA 2OCBA 1RZ3A 1TX4B 4LC0A 3PITA 4ASUA 2J0SA 3A1UA 4OI1A 1B0UA 1YZLA 1JR3A 2XJ9A 1L2TA 2GETA 2XSZD 4RD4A 2ZRPA 2VP9A 2WJIA 4NH0A 5KOYA 3VNUA 4YLGA 1G8PA 1E2QA 3D31A 2ZEJA 1KSHA 3OFNA 2JLZA 2ZRBA 1YKSA 2OBMA 4BLSA 1FTSA 3I62A 3THWB 5DN6D 1E4YA 1F5NA 2AX4A 1GKUB 4IFEA 1JJVA 5E4FA 3ZGXA 4WBSA 3LW8A 5LDDC 2ZIAA 4XOIA 1G3MA 3EPHA 1FNNA 2GDJA 5SZIA 3RSOA 5TY0A 4HZIA 3BB3A 3C7KA 4M1YA 4KYIB 5JECA 5G41A 2N42A 4BLPA 1WCV1 1PV4A 3QKSB 3AVQA 2JDID 4FCTA 2D62A 2WSSA 4I4LA 3GLGA 4UJ5A 2JJ2D 3TQFA 5EQTA 3AKDA 2HDNB 5FI0B 2W2XA 5EE3A 3U7EB 1F2TA 5JHHB 1X8JA 2WAYA 3KKNA 3LH5A 5EE1A 4C0KA 1BIFA 2KBFA 1UF9A 3BFKA 4JBYA 5EZ6B 3ADBA 1AN0A 1CP2A 4FMCF 1BYUA 1KK2A 2ZROA 1YVDA 4ZO4A 5AUQA 4C0BA 4NCNA 1BS1A 3GJ8A 5TV2A 3CRQA 1YZQA 4Q4HA 3R9XA 2H57A 3R9IA 1ZC4A 3EA5A 3MGCA 1Z47A 1FZQA 1WXQA 3VHLB 2ZRCA 1Z6XA 1XTSA 1BOFA 2ZRDA 1MR3F 1HEIA 3PFIA 4EPWA 4URYR 3THXB 4ZCMA 3SJZA 3T15A 1AIPA 1LF5A 1NY6A 1YR7A 1J99A 2Q9BA 1E2NA 3GJ3A 1W4CA 1R5OA 3HU1A 1NG9A 4PO1A 5KPJA 3P4YA 1JPNA 1BO6A 3KJIA 4UXHA 4GT1A 721PA 2BBWA 5C18A 5L3SB 1K5GA 3W6OA 2CCGA 5CITA 1OIWA 1N0VC 4V0KA 3CPJB 4V0ME 1II8A 5A4JA 3NDPA 2EW1A 3B1YA 4EFNA 3A8TA 3RRMA 4D25A 1QG4A 2C9CA 1KNQA 5FH9A 4Z54A 1XB2A 2BV3A 3QPWA 1XCMA 3BORA 2P6RA 2W6IA 5E7MA 3QEOA 4WXRA 1XTJA 5DH9A 4DT1A 2QI9C 5FBQB 2L0XA 4KV9A 4BLTA 3TW8B 1Z0AA 5AJWA 3CH5A 1KK3A 3DM5A 4G0NA 4YQFA 4Q1AA 1ZCBA 1OYWA 4RVCA 3EZ6A 2JLXA 1FMJA 4LI0A 2GXAA 2OLKA 2I1VB 4OI2A 1KDTA 3UG6A 4BFWA 2QTVB 1DARA 4JZKA 2VP6A 5EP4A 4TMKA 2ONJA 3MFYA 5FTMA 2IYLD 5JS8A 4FWTA 2DWQA 5C1BA 1GNRA 4IEEA 1KSFX 2ANBA 1UDWA 1ZMXA 2Z83A 1NMXA 5FTKA 4PAOA 5DLQC 4BFTA 1JEDA 1TF2A 3JZAA 4U00A 3K9GA 3EZ2A 4IDQA 4DB4A 3WYFA 2HYIC 4B71A 4BFZA 2VIIA 1VYUA 1RYHA 1SKQA 2BBTA 2ZI5A 3KB1A 3CLVA 1YZGA 1NVWQ 1RVDA 4IXNA 2QUZA 3HPQA 4A8JA 1I4DD 4E22A 1OXVA 1JR6A 3B60A 2P6UA 5EXTA 4FINA 2EYUA 4K8OA 5IRCD 3IKJA 4WZ6A 5FL3A 1BMFD 3WNCA 2J45A 3QBVA 2R9VA 1WQ1R 4RCZA 3F3YA 2WICA 1NG1A 4PQYA 1JXMA 2X1VA 2HUPA 4OYHA 3CZQA 4DLRA 1DVRA 1TU3A 4JMPA 4Q03A 4M1OA 2JLSA 2H8KA 3PEVA 4E07A 1ETUA 2FPLA 4NBSA 1W0JD 1OF1A 1W46A 1YR8A 3VKGA 2JA1A 3LO5A 1U9IA 4B3FX 3UPUA 1HE8B 2RGNA 2WOJA 3HDTA 4JLKA 3K09A 3UMFA 1OXSC 1CU1A 3U4QB 3ZQ6A 3VX4A 1G3IA 1OH8A 2CCKA 4JVLA 2EFHB 2NO1A 1U0JA 1E96A 4N0DA 1LF0A 4HDOB 1NLYA 2IXEA 2CEAA 4MGZR 1U9IC 3EZFA 5TVKA 4XWKA 3WHLA 4P32A 2JIZA 4LZZA 3SE0A 1TU4A 4MYHA 1X86B 4LYJA 4MRNA 2AD1A 3SQWA 3SQXA 3AVYA 2VYFA 3LVRE 3OHMA 2GTPA 2VEDA 2QT0A 2QSZA 3B2EA 4G1UC 4QHTA 4KBGA 4RKFA 1J8MF 2B92A 4FIDA 1S9DA 4OI4A 4UNRA 4LJAA 1A2BA 1IOZA 1VCNA 2RGGA 2F43A 3DZ8A 5BYKA 4FMDB 1JBKA 5FOWA 5GADl 1TTTA 2QAJA 4P4TA 2OCYC 3RDPA 3U6KA 3CF6R 1XD8A 3THYA 1XTRA 1JR3E 2J46A 4IVRA 2G6BA 1R0YA 1IN4A 1XP8A 1FPMA 1XCGB 4HDCA 1GNQA 4HUQA 3ADCA 1SGWA 3BFVA 4MUAA 4LYAA 2RGCA 2B7CA 2OAQ1 1KI3A 3VR2A 1K6MA 4M1WA 4UNQA 5CYOA 3HWSA 2O5VA 2CXXA 2IL1A 4I1OA 4U7DA 4KBFA 4TLEA 1R2QA 2WKRA 1YRBA 4F4JA 4Q4HB 2OUKA 4PC1A 1DE0A 2BC9A 4IHQA 4K46A 3CX8A 5CDFE 1ZIOA 3TAUA 3UXMA 1WBBA 3UKDA 4EQ6B 1KNXA 1H8ED 1AQUA 1FUUA 4JBXA 3OAAA 2ERXA 4MUBA 1G18A 1R0WA 4JLBA 2XXAB 1ZM9A 2GK7A 1TQDA 2H1LA 1P9NA 3B6EA 4L5BA 4UXIA 2CVHA 3AV0B 5KSZA 3E5HA 3PUYA 1E99A 4TLCA 1YR6A 3SU8A 1SXJB 2F1HA 1VIYA 1KDPA 3A1VA 5CB6A 1R5BA 4LPSA 3KFVA 2NZ8A 1ZU5A 3N2EA 3Q5DA 2QP9X 5CB8A 3PVSA 1D9XA 4MH0R 1VPLA 1E2PA 5EP1A 3DOFA 4PZYA 4Q9HA 1N25A 4HI0E 2GILA 3CNLA 2JJ2A 4ARZA 5JEDA 5L3VA 4LJ9A 1GKYA 2JASA 2D3WA 2Q9AA 3EIEA 2J7PD 3QKRA 4WW0A 1S1MA 4QKQA 2E9SA 4LY6A 3PEWA 2ZSFA 4OI0A 2YNMA 2XOKA 3CWQA 5JBQA 1MT0A 4MRSA 4JVNA 2J0VA 4C0LA 3QF4A 4CDGA 2A5YB 2NG1A 2F9MA 1MO5A 4R71A 2ORWA 2VP5A 4Q1EA 1JB1A 1E2EA 1Z06A 3F5FA 2CE7A 2H16A 2ZI6A 4YXWD 4TYYA 3A37A 1OB5A 2PEZA 1XNJA 1FUKA 1QBKC 3DMNA 2VSOA 3KXLA 2K5UA 1KMHA 4IOKA 3MRSA 2XZLA 2VP2A 4YONB 2VP4A 4A0GA 1VDZA 1J8YF 4Q4AB 1N6PA 1LNZA 2GJAA 1ZCAA 4A8JC 3CX7A 1N6NA 4HYYA 3NHAA 2ANCA 1NKSA 3G82C 3A4NA 4XWAA 3VX3A 3P27A 1AK2A 2OXRA 2XITA 3A1SA 2OILA 4B47A 1R0XA 4UNPA 1QDEA 3TK1A 2J3EA 1Q3TA 2CK3A 3LBNA 2IYTA 4HB2A 2F1IA 3C4JA 1OFIA 4BLOA 5F3WB 1S3SA 3SYNA 3R20A 3W3AA 3ONWA 4CT5A 1JI0A 1GDDA 5EZ5A 4KYUA 1ZUNB 5FTNA 1DAEA 4IDNA 3LA6A 2CL7X 2FEMA 5FPKA 3NIBA 2GF9A 1ZD8A 2FZ4A 2ZR7A 4PC3A 1P9WA 4DIDA 5KO2A 3FMIA 2Z6VA 3KZ1E 1S0UA 2HF9A 1XZQA 4A2QA 5CK5A 2REXB 4V0MA 4Q4JA 4A4DA 4ILEA 2YHSA 4DLWA 3OF5A 1VHTA 2V6IA 3ICQB 1UBGA 1P2VA 1XFAA 2HXSA 1DAGA 3A1TA 4KFTA 2FX3A 2IXFA 3B85A 4HAVA 4PFSA 4TT3A 1G64A 5E7JA 5BXQC 5DHFA 3PUZA 2OESA 3ZS8A 4ESVA 1YU9A 1QF9A 2IYUA 1LW7A 1WF3A 3SS8A 3UMRA 4UXJA 4OJQA 4NYJR 1KO7A 1ZU4A 3TBKA 1JQLB 2HEIA 4LCBA 4NPHA 1HYQA 1T5IA 4LBWA 3RS0A 4D0GA 3OAAD 1UBFA 2GNOA 2HLDA 2KI5A 3U2QA 1VG0B 1G6HA 4Q7KA 1QZXA 3I8XA 4FD2A 5DI3A 4L9SA 4M9XA 1JAHA 1N6OA 3H1TA 5FUWA 4RD3A 1X3SA 4MRPA 1KK0A 3NH9A 3K09C 1W7AA 1F2UA 2ZVPX 1N2CE 4ZKDA 4K81B 2F43B 3IHLA 3T06B 1II9A 1QHNA 1CXZA 1DAFA 1M2OB 4LYFA 2GAOA 3QVUA 1CRPA 2EFCB 4PPNA 2O8CB 3WP1B 1KSGA 2VBCA 1OW3B 5AJYA 3RWOA 1RE0A 4R2IA 1FQJA 2ZJZA 2W0SA 2V54A 3OEHD 4P3YA 4C0AC 3IPXA 4M22A 4ZKEA 4BFYA 1C1YA 3NEYA 4C7OA 1GZSA 1XMIA 2J1LA 3PG5A 2ZETA 2BOVA 4DLTA 5DHAA 5AR1A 1H8HA 1Y3AA 1R4AA 4HLQB 1Z6TA 2LKCA 1G21E 4M1KA 1D2MA 3TR5A 4A92A 2QEQA 3E70C 2Q0HA 2YWHA 4M0LA 2CCJA 3GJ5A 3GMTA 3AH8A 3OE7D 1XXHB 1NY5A 1UAAA 2P6NA 3P1JA 3U7FB 5HZHA 2FZLA 3QQ5A 3A58B 1SVWA 2WIBA 3Q85A 2X2FA 4ZPXA 1DADA 2JLVA 1FFHA 3IQXA 4F4IA 2JIZD 1IAQA 2FV8A 2JJ1A 2RHMA 4B2IA 3LX8A 4PZLA 2O8BB 4Z8YA 3IIJA 3T1OA 3TKLA 3ZDQA 4EPYA 1VYVA 3FKSD 2C99A 3NG1A 2P5TB 1ZNXA 1P60A 3WNBA 2JLQA 3MSXA 1ZM7A 2OLJA 5FOXA 3U44A 3I8SA 4CEJB 2ODBA 5AWFC 1OJLA 2E1RA 1Q0UA 2AD5A 2RGDA 2FN4A 4NKRA 2DHRA 2KE5A 3EIHA 3RS4A 2BCGY 3IEVA 1U98A 4DDTA 2PEYA 2R6FA 1UBEA 3AF3A 3M4YA 4PAMA 4V02A 4D4MA 2GJKA 2RAPA 2GWHA 5J4LA 1IQPA 3GLGB 1H8EA 221PA 1Q1BA 2UKDA 4PPFA 3EPKA 1SHZA 4URWR 4NZYA 3KL4A 4XH9B 2IYYA 4Q1BA 3A6PC 5DI9A 3Q5EA 4DCTA 4PC7A 1G20E 3IPYA 4Q7MB 1XMSA 3P20A 3SR0A 4DLYA 3FVQA 1XEWX 5BYJA 5CIQA 1E1QA 2YC2C 2FOLA 2QQ0A 1OV4A 3VR3A 1R8SA 1YRAA 4P31A 4XIGS 3QXXA 2QP3A 4XJXA 4CW7A 1PUJA 2D74A 5D3MA 3GEHA 1LTQA 5JSZB 4DWJA 621PA 2G1JA 4ESHA 3L82B 1XEFA 2R6CA 5KU1A 1EFCA 1G5TA 2BWJA 5FFMA 1TUIA 3TNFA 4BWYA 3QVVA 1XRJA 1US8B 1KKLA 3SYLA 3EG5A 4NYJQ 2GAAA 2OFOA 2ZQ5A 4QL3A 3TQCA 3HJNA 1E2HA 1L4YA 2QNRA 2FGKA 4V0LA 1O87A
chains in the Genus database with same CATH superfamily
3PUIA 3KKQA 3EA4A 4LRUA 1Y9ZA 4DIBA 1ZOOA 2ATXA 3SS9X 3R7FA 2OMEA 3D02A 3NWBA 4AVYA 3I4FA 1K66A 1TM2A 2JK1A 3IJ5A 5TMBA 3RABA 3AZOA 3KETA 3ZTWA 3JS5A 4HWRA 3HKCB 3KYIB 4U0JA 2FSIA 4M1ZA 2REOA 3WBFA 3U4DA 3K9FC 3L0OA 1VJ0A 4TS4A 4CKCA 3B3GA 1XWIA 3PC6A 3V8MA 1MOQA 3QPBA 3TXXA 1T15A 2Q0SA 1LK0A 3GLVA 3CKLA 4ZTUB 1XUOA 4DUZB 3TMKA 3SKVA 5L95A 4RADA 2WU3A 4Y2QA 2BTQA 1BX1A 4JC4A 3B5JA 3SJBA 3VNBA 1BDBA 5IYZA 1D0IA 1MG5A 1RAFA 1T2VA 3ME5A 1EGQA 1LNQA 2FG7C 2KLHA 3OLVA 5JZVA 2UYQA 1E89A 2NZXA 4Y1GA 1ZN8A 1QO7A 3TSOA 2I7VA 4Q16A 3P7MA 2H4YA 3QFRA 4BP3A 1F48A 3M6UA 1H6CA 1FF9A 1E2GA 4WNAA 2G28A 2PGIA 4PZ0A 2H8GA 4ISCA 3PGA1 4WL0A 1Y42X 1ZZGA 4QPPA 4OY3A 2PX3A 4WGFA 4IRUB 2QV7A 1KQFA 1A2QA 3U16A 3P96A 1G9SA 3IDFA 2Z43A 4FFVA 4HAWA 5AKZA 2IF0A 4EEZA 4K40A 5LBIA 2G70A 3DE3X 5HFJA 1K08A 4IYRA 1FMFA 3ZIUA 1CS0B 2I54A 1CFZA 4G25A 4O4JA 1ZJZA 1QGZA 4XB6B 3TPCA 5A2GA 2MYTA 2WJGA 1GSIA 3CJRA 1WZIA 4UDYX 4JS0A 4LMRA 3C5WP 4P7FA 1QU2A 3MJ4A 4XPIA 1B8VA 1IHPA 5BSGA 4AJ2A 3OQIA 1DEHA 4JZYA 1GP2A 2XUJA 4FBMA 4XARA 3NT2A 3G88A 2XMPA 5M34A 3OX4A 1BDHA 1R8YA 1JA0A 1SELA 3FWPA 1FU7A 4R7TA 4AYWA 2CLIB 4CCWA 4QNNA 4DLZA 3AL0C 3WGOA 2J6BA 3ETNA 2H4FA 1WDTA 2QT9A 4TL8A 2BDUA 4TRNA 1AMUA 1GITA 3EC1A 3FAKA 3SJ7A 3GT7A 1T3ZA 2C04A 1MO3A 1JR3D 5KYVA 4R5HA 4HAYA 1MXFA 1ZBQA 2VDWA 2LIVA 2DY0A 2F64A 5E9QA 3KVNA 1H69A 5LZ5A 3RQSA 4IRXA 4U5XA 1XRNA 4H9GA 3ZGOA 5KU7A 2QRMA 1TKCA 2P9GA 3QV2A 1EIWA 4D3YA 1CF2O 4GR9A 4KXUA 4OYLA 5DBEX 4QWWA 3FSEA 3CRNA 3TQSA 2I66A 3B9QA 2PYDA 4JBWA 5AW1A 3EQ6A 2XE7A 5LYJA 3L7JA 4X90A 1RP7A 3BCRA 1S8AA 2CHVA 2JATA 1YQUA 2QL6A 1XXLA 1S9HA 1J2JA 2DECA 3GLHA 4KIWA 3VKWA 1AURA 2OHHA 3IO3A 4XW2A 4DSNA 2WKQA 3LT0A 4XVCA 3PWTA 1T2NA 5LYJB 1QOPB 1DINA 2GZAA 2DRIA 3MS2A 4WV3A 3JYPA 1AKYA 5KTNA 1Z6YA 1N8SA 3WJAA 1HUQA 2NSHA 3IP3A 4Z7JA 1XPRA 5DOVA 3WGLA 4BNZA 1TTPB 1VXRA 2QPTA 3JSXA 3K1AB 5GJCA 4BBPA 5GZ6A 3K0AA 5F5LA 4DQLA 4AMVA 3KSUA 1PYGA 4CG3A 5H9WA 8OHMA 1I2DA 2FMKA 5NLLA 4NARA 1JG7A 2KM1A 4KFCA 4NXMB 1QU3A 1H2WA 2IJGX 3X2EA 2QJRA 1IBMB 4XEHA 3H1GA 1EX7A 3ZY2A 2TYSB 3MWJA 1LWOA 4R81A 2QX7A 2AV6A 4W5HA 2ODEA 2FQQA 2NO7A 4WK0B 1DG1G 2AMLA 6Q21A 5C5CA 2BRUC 4DJ5X 2ENUA 3MCWA 1T9GR 3PTZA 5ARDA 4N6NA 3C98A 3G6WA 4B4UA 2AQIA 1T3LA 2OV8A 4Q7JB 3BDVA 1VKHA 2OBFA 1VSBA 4ZOAA 1KJQA 5AK3A 1KYZA 5CAEA 3PHBE 3B51X 3LW7A 2C61A 1TGYA 4BLRA 2I87A 4Y0VA 4EDFA 3WXBA 1V9LA 2K87A 3GJ7A 4FC7A 3RFXA 1C4XA 2PRJA 3NIGB 3I53A 3VU9B 2ZJ8A 2Y1DA 4CG2A 3ZVMA 5T6BA 5BV8A 3V7NA 2EKZA 5FAKA 1VL2A 3F78A 2M98A 4WNIA 421PA 1BXRA 2P9JA 1RHJA 1N2IA 4PO3X 3BFJA 4X66B 1QDUA 1BYIA 3DMTC 4B79A 4HL6A 2OO7A 4NY1A 1JG2A 3C24A 5J63A 5ITZA 4OHKA 4ALNA 2NXNA 3DKVA 1L7RA 3R44A 2DFVA 3GCWA 5B6PA 2O8DB 2FP4A 2UV8A 1K0FA 5GPBA 4WERA 2B69A 1Q1NA 3E2IA 5DF1A 3ZGVA 3DLPX 2W4MA 1MW8X 1X0VA 2OT3B 3GYGA 4URXR 1PVOA 4UQLA 3JAWB 4IDHA 2O54A 2J6HA 1U4OA 1JBEA 2FFQA 1OV6A 3D8HA 3QPAA 4QVIA 2XCSB 3EHDA 4CLOB 3QBTA 1MLDA 3QWHA 1ABFA 2JFPA 1NRIA 3A1CA 3DCYA 3UMSA 1J2YA 2YHAA 5AVOA 2O2XA 2Y05A 1J20A 3KFLA 5SZKB 2MWMA 2QIPA 4GBJA 4QECA 2WC1A 3ZCXA 2AFIB 1BGXT 3TEJA 4RA9A 1W5FA 1YOVB 2FHPA 4US2R 2XDWA 5JRDS 3MLEA 2D5LA 3H5LA 2GKOA 1VPWA 3R6WA 4IH1A 2HIHA 2CD7A 4GLFA 3EXHA 1NOIA 1WL8A 2BVNA 2ZJOA 3NOOA 2C3MA 2O2CA 2Y71A 4H1HA 2WTBA 1PQ4A 1P3JA 1FYVA 2WHXA 4XX1A 5HE8A 5HF6A 4LPKA 5GJVC 3PQ3A 3EG9B 4M53A 2ODWA 3A1DA 5DHPA 3AP3A 1N6LA 3DONA 2G04A 1FEZA 2BMEA 4G5YA 2CLMB 5EXSA 4AKTA 4EABA 3W2TA 3RNOA 4G24A 2IH4A 4PZCA 3L77A 1E1CB 1Q7RA 1OFUX 3MJEA 4OA8A 1U5AA 5I7HA 5K3AA 1UC9A 2G9RA 2QQEA 2XUAA 5C3UA 1TO6A 1C9EA 4NQRA 1KEEB 3OQMA 3QU9A 1KIAA 4UDNA 1NQVA 1DJNA 1RLJA 3KEGA 3LI2A 3T8YA 3COYA 1OLOA 2E37A 5JNTA 4CDRA 2F6RA 1JWAB 3RVRA 3HDQA 4DV4B 1WV0A 4II2A 5TPZA 5JXWA 2N3ZA 2CNWA 1WDMA 5CD1A 2A84A 4YHBA 3PFHA 3IBYA 2V4ZA 1RJ9B 2W2OA 3UJDA 4Z4CA 5P21A 1KFBB 5BN5B 2E7ZA 2ZVQX 3I92A 3V4FA 4AMUA 2AW5A 1E2FA 3I9LA 1KAOA 3W9BA 2JHCA 4HNSA 4EATA 1EAYA 2W4QA 4FGZA 4GPZA 3PIDA 4HVAA 4ZT2A 5CNKA 1VECA 3ZR4B 3TXYA 2WZQA 4TV8B 4Z5XA 5JPDA 1T6NA 3N9IA 3G2OA 1RJFA 2D7CA 2FRDA 4NJEB 1T5BA 2IXGA 2IUFA 1N3BA 4UU1A 1UANA 2XD4A 4L02A 4BNTA 3STWA 5KTSA 1AK9A 4JGGA 3VMFA 1P4RA 2XYPA 1E2BA 3RHZA 5F2KA 1UFVA 3TZ6A 4RFSB 1PP4A 3WL7A 2R66A 5TPWB 3TKAA 1JHDA 2PKCA 4B6EA 4BP8A 1HETA 4KYTA 2GF2A 3F5QA 4QELA 1H2EA 3Q1KA 4GRAA 3JQ9C 1MIHA 3KTDA 4TM8A 3R9XB 4NCJA 3DZKA 3VYTB 2GEVA 3WLHA 5BR4A 3RYFB 1F8FA 1DGQA 2CDBA 2CLSA 4BAUA 2ODNA 4PZ9A 1JHXA 4E2FA 3RTDA 3NKVA 1XL1A 1QIFA 3OT4A 3BMCB 3GMIA 3C6YA 1YDMA 1XGKA 4WLFA 3ET5A 1R88A 2XBLA 3DF7A 2BUCA 2W70A 1U0OC 1ORTA 2FR8C 4QYSA 4UEKA 1GPJA 3RC2A 3UZUA 4L2IA 3IIKA 4P33A 1YJQA 1MBZA 4ITUA 5DGIA 2I3ZA 1HO3A 1IXSB 1R0BA 1YR9A 1ZKMA 2QW1A 3C1OA 4ZGWA 1CRLA 1Q7GA 2B4YA 4HNRA 4B2YA 1OLUA 3Q12A 4ESOA 1K6EA 1MNAA 4LTDA 3PJDA 3U3OA 4R3WA 2P9FA 4GM0A 3OLZA 3ZU5A 2KBEA 3IOEA 1OCEA 4CKBA 1IBRA 4WNAB 5F2NA 1NVBA 5HNKA 3ENQA 1UQUA 3OJLA 2P30A 1BKDR 4KTTE 1PSDA 5J4VA 3PEEA 4MUXA 2H0RA 2WU0A 4UKDA 4Z9FA 5A05A 4CF4A 1TPZA 1M8PA 1Y8AA 5TB5A 3ZV4A 4D8TA 3P9KA 4KJXA 5FUQA 1NDUA 5LNK1 1NUQA 2F67A 2EGHA 3K0CA 4Q21A 5DRYA 1Z4NA 2Q5IA 4XDZA 4YDRA 4EJ0A 1E7RA 1GNTA 3K15A 2QLNA 3L7IA 2DVMA 3REFA 1VBFA 2O2IA 1T3TA 2BHRA 3C1TA 1F6BA 2GRJA 4XCVA 1CR6A 1ND5A 1GM5A 4OB8A 1R4MB 4CKWA 2I3BA 1U3TA 4ARBA 1EDDA 3MJDA 4FT2A 3N5KA 5JI2E 4BTVA 2MSNA 1FNSA 1GLGA 3GVIA 4QUAA 3WFJA 3SEAA 1KMCA 1K1EA 2CY0A 2E87A 3I23A 3SDBA 4QOEA 1FMCA 3LLCA 4G41A 3NV7A 3DA8A 5A71A 4RKEA 1V8ZA 4KHZA 2VJLA 4MV4A 3VZQA 4HNUA 5I7EA 2EDCA 2HK6A 3PRHA 5JJ5A 3ZD7A 3UATA 1EP3B 3JQBC 4MWEA 4MV7A 1SKYB 3DAPA 3ZJYA 4EYGA 1MOSA 1QKIA 5DNUA 2PH5A 1TZ2A 4WESA 3RLFA 2W6MA 1TFUA 1TPYA 4UE3S 4XWTA 3SAJA 2G4CA 2VCYA 3CF4G 4G9BA 5FUBA 3VISA 2AB0A 3DXXA 2VF8A 3NUQA 3DTNA 4HLUC 1H5UA 4TMWA 2WSMA 5F35A 4ZI2A 4HDSB 3OIFA 4IPTA 4FYYA 5BOSA 1OBOA 2P67A 1KS2A 1Y98A 2MIIA 2GZMA 2O07A 4Y6SA 4EYSA 1GGJA 4WWHA 2VHJA 1V8FA 1ZRSA 2IZ7A 4AJKA 5K4GA 4S2EA 3CR7A 5JJKA 4ITVA 3MB8A 7ADHA 4S2UA 2DJIA 3FG9A 2J4DA 3BWXA 2UVPA 3MUFA 1Y8QB 5E1DA 3V80A 3WQSB 1U0EA 1SC6A 1Q0SA 5DGTA 1TADA 5BY2A 3EIQA 2B78A 4P22A 4X1YB 2X8LA 3KKOA 4ZOBA 1YU6A 4FDAA 1E7SA 1E4EB 3NTOA 4WFIA 1FJGB 3HRKA 1VPTA 3I83A 1UXGA 1YGPA 4FMBB 4D80A 5MF6A 4PHTA 2NZVG 4X1YA 5C8DA 1JMYA 2G6TA 4KFRA 3GLHB 4J7AA 4XJSA 1Y3HA 5ALTA 2V8OA 3AF0A 4MJXA 1GVNB 4IX1A 2BMDA 4MW6A 4OGFA 5EJAA 3DPUA 3WGIA 3G0HA 3HVIA 4YAFA 3O7MA 2EDAA 2JI7A 3AI1A 3MIIA 3MGBA 4A91A 2XCRB 4P80A 1R8XA 4D96A 2WKPA 4K2AA 1ZHHA 2XTZA 4YAOA 4D8VA 2EFJA 4KITB 2W00A 4UDOA 5HRAA 1JX6A 1JIJA 4MITA 1NJ5A 2A9KA 1GGKA 1WXFA 4NYMR 5HS4A 1PFGA 3GGJA 1GUAA 1RYFA 3C16C 2VNJA 3KSBC 2XMBA 3INTA 3H5IA 1PLJA 3TD2A 3L4BA 1Q22A 1F2VA 1Y34E 1WW3A 3OSZA 4PTYA 1T2EA 2Z5LA 1SQ5A 3KEMA 3DVAA 3L9WA 3NHFA 1EIZA 1KBOA 2RJNA 4LUCA 1B3RA 4KO1S 1RR6A 4QPNA 3ESXA 3K9HA 1YJAA 4GGMX 1DFIA 2F48A 3EXIB 2C8KA 1XNQB 2F7SA 1HE4A 5MFZA 3VDQA 4W9NC 1VI2A 3ONFA 1PT8A 1GO2A 2IYWA 3L0BA 3SXUA 1YCHA 3QIAA 1CUVA 2H9IA 1OLSA 1Q1EA 1A9PA 2GASA 1L4GA 2LGJA 3NJ8A 3DT8A 2G09A 4L7VA 5CDSA 1AMNA 3HXMA 2Q21A 1LRLA 1PNOA 3JASB 4RSGA 4FB4A 5J4HA 5CFLA 1B8NA 1PUIA 1Z7YA 3RU9A 1QTQA 2E4AA 2NTNA 4F5ZA 2NTVA 3VO1A 4FGUA 3RH0A 1V7QA 4LNHA 4TUYF 1FJ2A 1BVYF 5CA1A 5EJEA 4ZCRA 1WKVA 1CUFA 3HP4A 5BUZA 2BEKA 3L7KA 5AUOB 3ZWYA 4DY6A 3HBJA 1NL3A 1SQFA 4P81A 1QG2A 2BTEA 5JZMA 3HZOA 3LKVA 5EQJB 3DQQA 1G0NA 1UBNA 2XDQB 4JEUA 2PL1A 1D6SA 5AW5A 1JU3A 1AQJA 2VJYA 1H2RS 2A6PA 5LMCA 3AUXA 3KB6A 1IG0A 1YZFA 1RC0A 3NBZC 4MRAA 1MAHA 4PG7A 3OCJA 1CJTC 3E84A 5JMPA 5SYNA 7REQA 3HS3A 2MSKA 4E5KA 3T41A 3KKEA 1DJOA 1MJNA 1Z2CA 4UU8A 3IQZA 3N2LA 3G2QA 3RS8A 4FOLA 1L4FA 1WULS 1ST2A 3AR3A 5J2UA 1GPWB 4ENVA 3F46A 5IYZB 4G5XA 3BKWA 3K5HA 3KXIA 4C4YA 3HJBA 3HCDA 4W6ZA 2PLAA 2EF0A 1NQXA 4L2IB 4LF6B 4UCFA 1Q20A 2BR5A 3UB3A 1N7JA 3GEEA 3OOSA 3PR3A 3ZTYA 4QGAA 4ED9A 2CFOA 2YC4C 3E27A 5F7ZA 1WMFA 4CIAA 1D04A 3QKTA 1F1JA 1NBHA 2CNWD 1VE3A 4F3RA 1WQ3A 2OG2A 3O8RA 1KIFA 2GN9A 1Z39A 3CRMA 4A16A 1RPJA 1RYYA 4NV0A 1RCFA 1UPUA 1XCJA 2XMQA 4Q01A 4YJGB 5IAEA 5A02A 4CU2A 5JQWA 2A59A 4JYAB 5DX8A 4R0NA 3NM4A 1ETHA 4Z86A 4GDMA 4NZMA 1EXMA 1II8B 4P54A 5F4BA 5KI6A 1CCWA 1SKYE 1VMIA 1TCVA 1XQYA 2Z09A 4QG7A 3TR6A 1HE5A 3WFIA 2CBZA 2ABWA 1CERA 1J90A 1JNXX 1Q12A 2CMHA 5KQSA 5B2FA 5HS6A 1BGVA 1XJ0A 1G5RA 2C9YA 2PK3A 2ZB7A 3R2JA 1H6BA 2YWBA 1JPUA 1N3YA 3JPWA 4J1SA 4L5JA 4PLTA 3HCPA 4NE7A 4YMIA 3RAGA 2QTCA 3ISVA 3GMDA 4CQJA 4Y3UA 3FLBA 3JYQA 1J0CA 1SCIA 5B3KA 1G4AE 5KNBA 2M6RA 5JDIA 3CG4A 1KMHB 1PL7A 3OOEA 5BOVA 4QG3A 4BJHB 5CCDA 1SHJA 3WYDA 3ZLTA 3RKUA 3W3AD 3W6UA 4A10A 5BORA 3NUGA 3I1JA 4AYXA 2NMVA 3HNRA 4AS3A 3FNHA 2AOTB 3VSBA 1X8KA 3E4DA 1Q7BA 3IQEA 2QG4A 2Z8ZA 2ZRKA 1R0CA 5IVPA 1G3QA 4DM7A 1ZNQO 1HKUA 4KZKA 4YRLA 3W04A 3AO0B 1U8AA 4MV1A 4BWVA 4FWBA 1GTG1 2PKEA 5HOEA 4L9AA 3SS7X 2FSSA 1T4CA 1XYGA 4BE7B 1DEOA 1YS2X 4V3CA 4WKBA 1I5RA 1NAIA 3OZDA 1S2MA 2IW1A 4PRLA 2VDRB 1L7DA 4Y8VA 3QLVA 1QM5A 4XJVA 1TQ4A 5F9FA 1DZ3A 2Y1KA 1Z3CA 2V0CA 4X3PA 3WAKA 4JL6A 4U2DA 3KQQA 5DLYA 2QDXA 4KR0A 1Z22A 4NYIQ 1KDYA 4KQCA 2CFTA 3M6AA 4LRSB 1DUSA 4ZT4A 3TCKA 5LZ2A 4CT4B 1RCTE 3K0SA 1H85A 1NQUA 3Q2IA 4M1SA 4TL9A 4WZZA 4OOEA 1T34A 4X60A 4Y2UA 2Q29A 3QEMA 1TUGA 4EQZA 2ONCA 4UUBA 4UUAA 5CH3A 2QNIA 2IC5A 3HGTA 2DE0X 3MWDB 1FB5A 1WB4A 1WM1A 1LWNA 1N8NA 3OT5A 4MYRA 4WXHA 1K7XB 1K7YA 3MMZA 1A88A 3E2PA 1TC2A 5DFAA 3VR6A 3MA0A 1HOTA 2PS1A 2VSFA 1ONSA 4HLNA 1C7JA 3JALB 5LPNA 2IHVA 4LXXA 4QBFA 2WYVA 4H7HA 3MHTA 1O0SA 2XA1A 2Y6VA 1F8GA 2IQIA 4OHCA 3PE4A 5ELXA 2K6GA 4ENUA 5JS1A 1XO1A 2YZKA 3J7TA 4D81A 4BXOB 3NCTA 3V3TA 4DSTA 1SKMA 4WCVA 4AF8A 4KJZA 1W4AA 3FDJA 2YNMC 3LDGA 2PUAA 1AUPA 1BCRB 3LDAA 2FFHA 2Z08A 3H16A 2AFHE 2CHUA 5AYVA 1NAHA 1CJCA 1E6LA 1PFWA 2Q4TA 3AU9A 4J8PA 5EOVA 2AUMA 3DL2A 1NULA 4O2LA 2O0MA 3DFFA 1AX9A 1J56A 1BXRB 1X70A 5E9JA 4X6XA 1TB4A 3BICA 3OZFA 5AVXA 1BU8A 5CYPA 1P61B 1FL9A 2AG0A 2HO4A 3JVUA 3L8HA 4P2BA 2FPWA 3R6GA 2ZYHA 3ZIAA 5BRJA 1E5TA 5IKMA 3W2HA 1FVOA 5JAQA 1XRSB 3QTTA 4W7IA 4HATA 4PFJA 3U6BA 5JATA 4KNYA 1Z4LA 2JIRA 1H2AS 2H9YA 2HWWA 4I1VA 1ABEA 2BM8A 2ZUDA 1NMZA 4JLJA 4IVNA 2CUZA 5UKDA 3ROPA 5LQRA 5TR9A 2RARA 1RM3A 2EWVA 1SB8A 1NRJB 2DLCX 1L4UA 2I80A 4RUKA 4HN9A 3QF4B 2IV7A 5I7SA 3WE7A 2HI0A 3DDZX 3QYPA 3SIXA 2WRZA 4F93B 1LV8A 2XWBF 4QATA 1V95A 2PCJA 4WY8A 1K8RA 1CYEA 2MCFA 5E4JA 2GLXA 1W4RA 3MJHA 3AFOA 1PJQA 3OUZA 4WBNA 3A7EA 4RIEA 2R5NA 3ANTA 5A3VA 4UC0A 3ZV6A 3KPVA 4Q47A 2H2FA 5HW0A 3OZXA 5CLLA 5EL0A 1YDGA 2A9RA 2OCPA 2VF5X 1EWYA 5E6SA 4BKPA 4CIXA 1QHXA 2I7TA 3NBYC 3BHIA 4KWCA 1E0SA 2G5PA 1HDCA 3DOIA 5TEVA 5BWBA 1L5KA 3WB1A 2CMGA 3L8CA 3H86A 4GSLA 3NPMA 1SVSA 4IY1A 1OU4A 3SBOA 5C4MA 2BEVB 3FF4A 2AMVA 3ABIA 4MUKA 3VNSA 3O4GA 1ENOA 2QN1A 2ZRHA 3QUQA 4QTUB 2YHUA 4EA8A 4MJ3A 2E4UA 1P2SA 1X80B 3KKKA 1L3BA 3REQA 1CIPA 5ICFA 3UVEA 3DZIA 4FDTA 2G9VA 1I3CA 2DYKA 2WWWA 4D82A 1KEZA 4WXPA 4LKOA 5ILOA 3FB1A 2HMAA 3BH6A 4E33A 2B4QA 1NXXA 3OIDA 1C2TA 1IC6A 1XC7A 4II7A 4P9NA 1QRAA 5DW0A 3MAJA 2JA2A 1A7AA 1ADJA 2ZRFA 2QM8A 3DJYA 4MR7A 4NX2A 4TYWA 2IOFA 3D8TA 4RZUA 4ENTA 5C1DA 1G7TA 2MU1A 4R4JA 5HIMA 3OMLA 1NI4A 1VFNA 1HT2E 4MV3A 2NPIA 4Z4EA 2Q2WA 4POOA 4A8TA 3QOFA 4I19A 2EEZA 1YI8A 5FUYA 3SIRA 4TWAA 3DC2A 4RIGA 5AM1A 2NUAA 2YXEA 3IIMA 4ICIA 4B6FA 3LIIA 5CLJA 1OY1A 5JADA 3WLIA 1ESEA 4EH1A 4EVQA 3P4UA 3T3OA 1H2BA 5B6IA 9LDTA 4O2RA 3GAMA 4XLLA 1Z88A 3D1LA 2WM3A 2OCGA 3DBHA 1H3FA 2V3CC 3O26A 1GN9A 4AG6A 3ADOA 2GBLA 3EISA 1GRRA 3R3JA 4R3UC 2XQVA 1BS9A 4FNOA 5G3YA 4BN0A 3HJRA 3RD5A 4JXXA 4QVGA 3ZHSA 1B26A 3GAZA 5G53C 1U2QA 2ZXEA 2WFMA 1G5PA 1RRFA 3NEAA 1YRHA 1THGA 4B9EA 1JT2A 4EFLA 4KUEA 1TW2A 2JRLA 5I8WA 3P5BA 3WYAA 2RJOA 3CIOA 1V8BA 4L08A 1RKVA 4AZ3B 4A0SA 5AD1A 1NUPA 4ME6A 4MGIR 5IANA 4JV5B 2WHEA 5JWRA 3HQ4O 3IPAA 4OXRA 3W79A 1ISSA 4I6EA 1EWRA 1WE2A 4NTZA 1PQYA 1RACA 4UAVA 1AXRA 4F6RA 3REGA 3UT6A 4EECA 4L0CA 2B1JA 4D3SA 3GDOA 5E9WA 1QJ4A 1SK9A 4TYMA 5C80A 5DT9A 3DW3X 1FFBA 1C9DB 4F5EA 1MFZA 5BNTA 3U4QA 3DMRA 3M5WA 4ROSA 4EUHA 1G1AA 1QK5A 4NS1A 2WF5A 4IZHA 3CNEA 2LNDA 3WGNA 4B32A 1WOYA 3T5DA 2YWFA 3KZNA 2H48A 3CVOA 4G86A 2AFIA 4GWKA 4IRMA 4TQGA 5DYWA 4DV2B 2C9MA 4E5PA 4J4BA 4J0EA 2O8FA 1ZN2A 2O3TA 2P9EA 3EIUA 2QN2A 4O8CA 1S3FA 2G8NA 2J32A 2O14A 2QD5A 2PKRA 2ST1A 3SOZA 3UB2A 4Z7QB 5A3QA 2NT3A 4CLOA 4BRSA 2ROQA 2QTWB 4A1FA 2GYUA 2GM4A 4MCHA 4OJNA 2WWGA 3MWYW 3TOSA 1PJAA 4DCPA 4R7ZA 1JKIA 2EZUA 2B99A 2EWWA 3LL7A 4WVFA 4RLHA 3KQNA 4G0WA 4GE0A 4MUJA 1KP2A 1UR5A 1U80A 1YBFA 3QUAA 2RGRA 2AZXA 4WZAB 5HF5A 5BSTA 7AT1A 2ZWIA 2HIMA 1DOAA 3WGYA 3KQKA 5A62A 1SM4A 3F4KA 2RDMA 1HE1C 2O2ZA 4TTAA 4WOBA 2NTYC 5J40A 1M1ZA 4AJHA 3SZMA 4IDAA 1F0NA 1YKFA 1NOJA 2IXTA 2X4LA 2Q6KA 4J1TA 1NVXQ 5AI8A 3ORRA 2ZJ3A 3S0JA 2FKNA 2YTZA 3PWKA 4E1AA 4WINA 2ZI3A 2YIDA 4NESA 2ZIWB 4JEMA 3NH6A 3KXPA 2HK8A 2YV3A 3RANA 5HZGA 2PWYA 1IPHA 3GIWA 4XYEA 4RTPA 3IC5A 2FR0A 1H0SA 1WRBA 3KELA 3PI6A 3Q8WA 5F9HA 1CQIA 5EIFA 3WLSA 4LJ4A 4L5YA 4RWEA 5EKDA 1EK2A 3P9YA 4LXGA 3M9LA 4H1UA 1IRIA 3RFTA 1E5XA 1I3LA 2CNOA 3D7NA 4MYCA 4GSKA 3V9AA 5IVHA 3ZHZA 4BQIA 4HB4A 4WLVA 2Y1EA 2NUAB 4M9CA 4ATNA 5BQPA 1CQPA 4YY3B 3F73A 2EERA 2VJMB 4DCUA 1MA0A 1YTUA 1GPYA 4N54A 5CVCA 1YQDA 2RBEA 4BQQA 1FZTA 3CW9A 2QR5A 4U4AA 2W6NA 4KKXB 4E2WA 4Q82A 4EITA 1SVOA 4D44A 1LQ2A 3O73A 3GX1A 2R3SA 3DDCA 3RS3A 2FF7A 3WB2A 3KXKA 3PF8A 5ALHA 4BGIA 1QIGA 1V7ZA 4QHYA 1C7EA 3P5SA 4JYPA 1JLLB 3WGKA 3ZZ1A 2CHQA 2XBMA 3SHTA 4ANFA 3O3NB 2AI1A 2WA2A 2V7EA 2CW5A 3FLEA 3CUWA 2AK2A 2H4WA 2G5TA 2W6PA 2Y9PB 3UJ8A 4EGCB 5E3JA 5E0KB 4BVBA 3D3NA 1JIKA 3O84A 3PGVA 4QU8A 1PWYE 3AESB 3WV5A 5CDFA 4NEGA 5BWNA 2HF2A 3W0LB 1HRDA 2GJ8A 2QG6A 3TCNA 3D3WA 3IAFA 4X94A 5HBRA 1XTIA 1GZVA 1BFUA 2PQMA 4P7JA 5THKA 3ZD9A 4D46A 4P4GA 2FVYA 2Z9CA 4GZ3A 4RK1A 4HYEA 1W85B 3A3NA 2I7DA 4OFXA 4F84A 3J7AC 2JHPA 2R8YA 2YHIB 3K8QA 4P98A 3TKYA 4D4HA 5I4IA 3RM3A 5C31A 1RWPA 5CNMA 2XB9A 2YNMD 1CJSA 3QGMA 3HA7A 4GQAA 4QXRA 3CKYA 3NBAA 3OKPA 4L3VA 2VJPA 1FJHA 1NW9B 3OETA 2C3YA 4OL9A 2WABA 1GV1A 3K2QA 5TNXA 4GOKA 5AJVB 1EX9A 3ITKA 2PQ0A 4FEYA 2PA3A 3CE9A 2P4UA 4R2XA 3ZHXA 3ZVLA 4AXXA 4DHEA 1U2TA 4GOJA 1KJZA 2W4IA 2ZSBA 3D8NA 2ODTX 1S4QA 1SUDA 2W6ZA 3HA2A 4AO6A 3H6GA 4A0RA 5CXUA 4CLRA 2IPMA 3G0IA 2C57A 1M7BA 1BW9A 1TW3A 1NJFA 1EXNA 3GOHA 4PS1A 5B37A 4RTRA 3BCSA 1I1NA 3GDGA 4G26A 1XLWA 1P2GA 4BNXA 3BF7A 3QI7A 1IN7A 1VE6A 4D26A 1BJRE 4YIKA 4Q37A 2OPHA 3NBMA 3FWNA 3ONNA 1YWGO 1SCDA 2QXUA 3V34A 1TU0A 1TAGA 1GCIA 3LOUA 4M36A 4E08A 3OEWA 1DFGA 1MX3A 4GQIA 4QOSA 1I94B 5JYBA 1HNXB 1WU8A 4NBKA 4NOKA 1O4VA 4ZMBA 1PLKA 4AZWA 3QY9A 4ABTA 5CLQA 1DAOA 3QYFA 5F1PA 5FR1A 1XRQA 1D4FA 3H19A 4B44A 2QBYB 2NM0A 2FN3A 4HK4A 4WD3A 4IMRA 1GTVA 4E3WA 1YZKA 4WJKB 4U3JB 1GPNA 3V00A 2YYYA 4N49A 4R7GA 1SCUA 2IIPA 2QRJA 1T91A 2JGAA 3GBPA 5CTJA 1ATIA 2D00A 3L4EA 2GSDA 3S8YA 1BQ3A 1J8FA 1XLTC 4U3JA 3S2GA 2WMYA 1C7QA 1G16A 1SCBA 2J59A 2EAUA 3OWOA 4W63A 1XA0A 1SFRA 1JYEA 1XJ5A 2RKOA 3AJDA 1U5BA 4P0QB 1YBVA 3ZVKA 3G5LA 2VCHA 2QSUA 3VTAA 5JALA 2HTFA 3CNNA 1BHQ1 1FC0A 1NW6A 2FJ0A 2I65A 4IIJA 2PLFA 3F3KA 5CR9A 1E79D 4BGVA 2OL4A 3EGXA 4UW9A 5JUWA 1OFHA 2G9ZA 2BGMA 4OQ4A 1B6GA 3VTZA 5FWAA 1VKOA 4OLHA 5ABPA 2OYSA 3IXLA 4P3PA 4DZTA 2EV9A 2I7XA 5DYYA 5FLXA 4ZEOA 2NSJA 1AZTA 4W6QA 4AECA 4YUZA 1HFJA 3B3JA 3DXFA 3M5CA 2RGWA 4GMKA 4H15A 4Z9XA 5LVAA 5JY6A 1I32A 1JAYA 2WM2A 1IN8A 1P6UA 4GNKA 2O59A 1HMPA 2FR8A 2OORC 1E6MA 2R8PA 3ZKWA 1EBFA 5IXJA 1C30A 1X1CA 3GFFA 3RK1A 4OP1A 5KPDA 2PGNA 2ZSIA 4Y9RA 4LBZA 4Z9YA 1EDBA 5AXDA 1OI3A 4HNAB 1TJ3A 1KVTA 2IW3A 3A11A 3BWCA 4R1OA 4F8YA 1P9OA 2PZEA 1KJWA 4BEJA 5J2TA 2WFZA 3COSA 2IOHA 8ATCA 4HGNA 1K06A 3SNHA 4ZAZA 2GH1A 4KMSA 1UXKA 2ACWA 4JSYA 3U9LA 1ZDMA 4ZAXA 2ET6A 4BJ3A 1NTOA 3CINA 4HAIA 4WXEA 2EIXA 1OA1A 1X77A 4C2BA 1F7UA 3T1VA 2Y77A 1EVLA 1GADO 1PT7A 4N3BA 4YROA 4JUCA 2ZBGA 1W0JA 3MJCA 3LY8A 3VR4D 1YE8A 3QFHA 1AZSC 1L5ZA 4RZIA 4BB5A 1QFJA 1DIOB 3OZGA 1KAMA 1KHHA 3DZBA 1TT7A 2DJ5A 1U6KA 3LRPA 4M0FA 4Q4AA 4EI2A 2OZVA 3K0HA 2H7VA 3GFTA 121PA 1FDOA 1HQDA 5JU6A 16PKA 3BUSA 1E9BA 3I6IA 1KY5A 3OD1A 3W4KA 3K5PA 2GZDA 3LD9A 2YBEA 1HZJA 1IK6A 3ND7A 4GXNA 1STOA 1DTWA 1OWPA 1QVZA 1D2RA 2WJZB 4EY8A 4MK4A 1ZIYA 4CDNA 2WHQA 3E35A 3SHOA 1E7MA 8LDHA 5JZ9A 4KX3A 2VTEA 2YOGA 5FEUA 3TAHA 2R1ZA 3JZIA 3U4HA 1DC8A 1V47A 1K97A 2C4HA 2ZWAA 3MQ2A 1DBIA 3IPLA 2WPDD 4WGGA 1O08A 1GGNA 4ZODA 1U8UA 1J09A 3RRZA 4GUAA 1VIMA 1FRQA 3MBOA 3WYEA 1Y3BE 3O4JA 4AJOA 2CC2A 1RMQA 4WK4B 5C5IA 4G0QA 1DBPA 3AFIA 3CNBA 3WK9A 2HPZA 3B1XA 1XMJA 3MPUA 4I9FA 4NYMQ 2OCDA 3K9NA 2QU8A 2Z56A 3DO8A 4JJFA 1JJIA 1ECGA 2KYRA 2E21A 3FZEA 4E3ZA 3TQHA 2DH6A 3KKPA 3GL9A 4DLVA 1UKZA 5I5GA 4R54A 5LKRA 1CZNA 4FONA 3TBHA 3VH4A 3L4SO 2V7UA 1H4QA 2ZDHA 3L01A 3IXMA 4ZCLA 1Z08A 4DNFA 3O7WA 1SXJA 1IBKB 4Y2SA 2QYOA 4N5LA 1PL8A 1AQYA 3GLIE 2BW0A 2PVSA 3LF2A 1W1IA 1ZMTA 3HVUA 4BZXA 4DABA 4WDRA 5L8VA 2NGRA 4L4RA 3Q7TA 3JATB 4RIFA 3PQ8A 1C1DB 3JAWA 4JA0A 3U39A 4CHGA 1WCIA 2HJGA 1FFYA 3M3HA 3VDXA 1E4OA 4MAAA 4Q7LA 2PZBA 2V5VA 1EE1A 4DQVA 3CZ9A 3W3ZB 2V9PA 1N4AA 4AP9A 3PL1A 4JSRA 4MMYB 5BW6B 1I14A 3ZY6A 1IOVA 1C3OB 4DEVA 1WUKS 3HXOA 1CIVA 1NSTA 2AYYA 5KMGA 2HCFA 1T8RA 3BFPA 3P9SA 1QHHA 2BMFA 2ZRLA 3GFQA 3QKWA 4O4IF 4X3OA 2XEDA 1NQAO 4FNAA 3PC8C 2WLTA 5LLSA 2VYQA 3LAWA 4TYQA 4PXAA 1OLSB 1XWFA 1M2OA 3QKIA 3E5RA 2X8JB 3DEYX 3OOHA 3LZCA 2VZEA 4OYRA 3VPCA 3T5PA 3NFYA 1A8SA 2LTAA 2QM0A 3B5EA 4TL6A 4UHBA 3ZCQA 3WISA 3LV8A 4OK6A 2VHQA 3COPA 1EESA 3OCVA 4RQUA 3RV3A 3EPJA 3OI7A 1I3MA 4X8MA 3ZI7A 4C06A 3WMRA 3T7AA 2CZQA 1RYBA 3OKAA 4OFWA 1UMDA 4REQB 3EXEB 1GL7A 3S68A 3W34A 4HGPA 1UPFA 3WGUA 2XOKD 4BB9A 5IXSA 4JQOA 2HU2A 3C3DA 3MTBA 2XCOA 2QE7A 5LD2C 4B3CA 2YUTA 3L0PA 1U2GA 3QVJA 1L5HA 3IKLA 2J33A 2VLBA 5LBTA 1YA8A 1D6NA 3QKRB 1UPXA 4ARUA 2HXYA 1TO2E 2H5LA 5TPWA 3DDWA 2JD0A 3O92A 5JD4A 5EGSA 2D5AA 2VHUA 3F6PA 4HUTA 5B3JA 1PJBA 3D0QA 3PNBA 5L51A 4IGAA 4OQQA 3RUIA 4IO0A 5CVEA 1X1AA 1LD3A 4G67A 4X8OA 2VQ3A 3C8DA