2BFDB

Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
341
structure length
332
Chain Sequence
AHFEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
publication title A Versatile Conformational Switch Regulates Reactivity in Human Branched-Chain Alpha-Ketoacid Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 129
structure length 332
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bfdB02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bfdB01
1TKCA 1UM9A 4FEEA 1JSCA 3DV0A 2EZUA 1UPAA 2BFFA 3EXFA 5K6TA 3ZHSA 1V1MB 3AHEA 3EXG1 2JI8A 4KGDA 4D5GA 5EJ8A 2C3MA 3OOYA 1X7WA 2JLCA 2NXWA 2Q27A 2WVHA 5ESDA 4C7XA 4C7VA 2JI9A 1X80B 2BFBA 2PDAA 2BEWB 1TKAA 4GG1A 2EZ9A 4MZXA 1UMDB 2UZ1B 2C3PA 4KXWA 2BP7B 1V5GA 1YHYA 1OLSB 1OLXA 2BEVA 3DUFA 3EXIA 3ZHRA 2C42A 5K3SA 4JUBA 5EJMA 5K6RA 1N0HA 4K9PA 2VK8A 4ZP1A 3UPTA 1X7YB 1DTWA 3HYLA 5HGXA 1UMDA 1U5BB 1QS0A 1GPUA 1OLUB 3ZHUA 4RJKA 4K9MA 5C4IA 1Y9DA 1PVDA 5I5GA 1T9AA 3LQ4A 4XEUA 2PGOA 2BEUA 1X7WB 1YNOA 4JUFA 2C3YA 4WBXC 2JIBA 2WVGA 2YICA 2BP7A 4FEGA 3AHCA 2X7JA 2W93A 3EXHA 4JU8A 1B0PA 3EXFB 3KOMA 1X7ZA 2BFBB 1UMBA 4JUAA 4MPJA 5IMSA 3JU3A 3M6LA 1V16A 1UPBA 1RP7A 1UM9B 2OZLB 1OVMA 3AHHA 2XTAA 4MPRA 2C3UA 1QPBA 1X7XA 1X7ZB 2IHTA 2YIDA 1V1RB 3EXHB 1BFDA 2QTCA 5I51A 1UMCB 2G28A 2R5NA 1ZPDA 2Q28A 4D5EA 2FN3A 2WVAA 3M49A 2OZLA 5DEIA 1PYDA 2VK4A 5DGTA 3EXG2 3EXHC 2Q5QA 3AHDA 2JI7A 1UPCA 3IAEA 2R8PA 1OZFA 3LPLA 2O1SA 1KEKA 2FWNA 1YI0A 1U5BA 1YD7A 3M7IA 1W88B 2AG0A 4QELA 4JU9A 3FZNA 2VBGA 4QPZA 3HWWA 5AHKA 4JD5A 1V16B 3L84A 2J9FB 1V11A 3DUFB 1QS0B 3UK1A 1YHZA 1TRKA 3AHJA 2Q29A 3LQ1A 2PANA 4MPPA 3E9YA 5ERXA 2EZTA 2G25A 3MOSA 2Q5OA 3D7KA 3EYAA 4GM1A 4GM4A 2BEUB 2VJYA 4RJIA 1UMCA 2BEVB 3ZHTA 1WCIA 5ERYA 1X7XB 2Q5LA 3HWX1 4GM0A 1X80A 4COKA 4RJJA 2DJIA 5FEMA 3AHFA 5I4IA 2EZ4A 4KXUA 5HHTA 4K9NA 2IEAA 1Q6ZA 1AY0A 1NGSA 2XT6A 5EJ5A 1Z8NA 1T9BA 5I5EA 3EXEB 1OLXB 3EXIB 4KXXA 1OLSA 1PI3A 1R9JA 2V3WA 2Y0PA 1V1MA 2QTAA 1V1RA 4MQ5A 2BEWA 2BFDA 4Q9DA 1IK6A 3EA4A 3ZHVA 3DV0B 5EJAA 1OZGA 3F6EX 5EJ7A 1MCZA 1OLUA 2BFEB 3AI7A 1UMBB 2O1XA 3AHIA 2BFDB 5HYVA 2BFCB 2JI6A 2VBFA 1DTWB 1W85B 1NI4A 1X7YA 4GP9A 1OZHA 2JGDB 4GPEA 2XT9A 4K9KA 5EJ6A 2BFFB 1V5EA 4K9OA 3M34A 2C3OA 4KXYA 1YI1A 2IHUA 2PGNA 3IAFA 1NI4B 5EXEA 1W85A 4QQ8A 1V5FA 1L8AA 2BFCA 3RIMA 5HJEA 3DVAB 1V11B 2R8OA 2C31A 2IHVA 1YBHA 2J9FA 3F6BX 3ZHQA 1WCIB 3AHGA 3OE1A 1TKBA 2AG1A 2EZ8A 5EJ9A 3LQ2A 2VK1A 4K9QA 4JUDX 2VBIA 2G67A 2UZ1A 3DVAA 3EXEA 3FLMA 4JUCA 1PO7A 1T9CA 1T9DA 2BFEA 3EY9A 2E6KA 2Q5JA 3FSJX 1ITZA 5EXDA 1QGDA 1POWA 5K2OA 2JGDA 1W88A 2JLAA 4K9LA 1POXA 5DGDA 5EJ4A 4KXVA 2UZAA
chains in the Genus database with same CATH superfamily
2RAPA 2QMOA 4IXDA 1EDZA 1X70A 2GPAA 3I61A 3OM0A 1A2KC 4WOBA 4I4TA 5EWMA 4P22A 3YASA 1RJDA 3I8OA 2Z30A 4XTCS 2E4YA 3NVKI 1CERA 2GKGA 3ASYA 3ZY5A 2HJSA 3FWNA 4DEYA 1E0KA 1YJAA 1CE8A 4KO1S 4RPJA 3N5KA 4RD6A 4BP3A 5LDHA 4Z9FA 4Q7MB 3NP7A 2NUAB 5FYDA 3DS8A 3EPPA 3S2SA 4AZ0B 1K86A 1EEXB 4DJ5X 1QE3A 1RHRA 5BW4A 1T36B 4HAXA 4CFZA 1X9HA 4RK0A 4RC9A 4BV2A 2IP1A 5F4ZA 2EGUA 4Q3BA 4XOUA 1AGPA 1FMCA 1GPUA 1J42A 1OU0A 3K0CA 4MLZA 2AFHE 1IOZA 5HE8A 1BRMA 3RG8A 4EQ6B 2COKA 2O19A 1E9AA 3SBXA 2NZYA 3N2GA 3LXRA 3OKAA 1NIPA 1Q57A 4E1AA 1UM8A 2HHLA 4NMWA 3ZIDA 2WZCA 3MUOA 4WINA 2OV1A 3UZUA 3TGLA 3JAWA 3B3JA 4JI2B 3LP6A 3L8GA 4F8JA 3HBMA 4XVUA 2HV8A 2PZAA 5E8JA 4G67A 2Q2QA 1Q84A 1E4VA 2JJ2D 2C5LA 1TLLA 3CSUA 2XY4A 4RIIA 4WJKB 2ZQ5A 3E48A 3EZNA 3IDZA 3WL3A 1V47A 2P5SA 3BBLA 3GZNA 5HFNA 3HJBA 3MUEA 2X2FA 5DLQC 2PUVA 4ALNA 4FFOA 1PS8A 4Y98A 2AVDA 3WMXA 2ZTUA 3ZVLA 4J0HA 3WMEA 1PK7A 3SQDA 1FX1A 1EDOA 2EXXA 2Q07A 4OB7A 1UBMS 5BNFA 1BDHA 2VP5A 5KTOA 4UTXA 2YIMA 3A4IA 4OVKA 1XXHE 2HK7A 4GC9A 3T7IA 3CLSD 2RC6A 3B53X 1X1AA 3DCYA 3SDZA 3D3NA 2XE4A 1NM5C 1ZZGA 3QG5A 3AFHA 2IX9A 3BEDA 3EVFA 4HWTA 3X43A 4EHJA 1FRZA 7YASA 1FDIA 2J0QA 4AJOA 3ZKAA 1VZ2A 3PXBA 4RU1A 2Y93A 5EWJB 5KYWB 4KDCA 4NG5A 2FZWA 4BECA 4BLWA 1MHTA 1GCOA 1K5HA 3BK1A 3P32A 3EVTA 5FTJA 5H9VA 1SY7A 2C0PA 4H0CA 2QDXA 2O3SA 1GTVA 2K4MA 1JAHA 3G5AA 2OAP1 3M34A 4YEDA 3WWPA 1J0CA 4BNWA 3ENKA 2H5EA 5JMOA 3RPEA 3LWBA 1ZHOA 3KEOA 2XYHA 1WBBA 4UEKA 1GVNB 3ZCTA 4CTKA 1PJCA 2V54A 2BYTA 3IPAA 4F5WA 1VL0A 1MJ5A 1N78A 3EPHA 2FOXA 1M34B 4PHGA 4L73A 4PVCA 5CVUA 1PVVA 5IAGA 1M6NA 1T8TA 3D81A 3THSA 1NW9B 1D2EA 3LXXA 3O93A 5DMHA 1PFYA 4E31A 3NBUA 2CXOA 3OX2A 4P7GA 1J25A 3IKMB 4CM3A 2WB2A 5LZ2A 4KR7A 3H5OA 3SJZA 3H75A 4KPYA 4CHGA 1PTJA 2LRHA 4HDRB 1ISPA 3OHMA 4QT4A 3N8IA 3K1YA 2GJ9A 1AT1A 3OUTA 2CFTA 1P2GA 4K05A 3VC7A 3IDQA 1UJNA 1C1DB 2A59A 1PQUA 4KGVA 1KSFX 1E2JA 2BHTA 3CTMA 1U1IA 1C9KA 1XZGA 3U3DA 1MDFA 3K6SB 4O4HA 2BSQA 3TQRA 2Z9CA 1NP3A 2ZJ1A 2D3WA 1U8ZA 3GU3A 3WYNA 3LTEA 1NVVR 3MRSA 5A02A 4BMDA 2QKYA 4M9CA 4H2DA 1UWCA 3FGZA 1PT6A 2ZRNA 1YACA 1N92A 2JFOA 2QZZA 3GLHE 3QWFA 4DXDA 3EB9A 2VHJA 5IWAB 1Z62A 4HGYA 4A3SA 5ENZA 3LOQA 3ZE6A 4BJ3A 5B5SA 3AETB 3NVDA 5HKKA 3R09A 2AK3A 1C1DA 1Y1QA 4CM8B 2ZWIA 1MH1A 5IN4A 4KLRA 3WRVA 4IEIA 1SRQA 3G1TA 1C7ZA 1ZNZA 1Z22A 3K9HA 4MNTA 5J4HA 2XBUA 2IU0A 1FTNA 3UENA 3W06A 3QOYA 2WFZA 1X7ZB 4Z4QA 2YXLA 3VPFA 5I51A 3UAVA 1TF5A 2GM5A 1TA4A 3D6HA 5AVOA 1MV5A 2ZBVA 3U80A 1OFHA 3LSTA 4NU5A 2CXRA 2RHWA 4IDDA 5C8DA 3T7KA 5B36A 5EMKA 5DGXA 2CF5A 1LKZA 2DGDA 3ETLA 2TMYA 4YVFA 4DUGD 4EYOA 3JQ7B 1YDHA 4XLTA 1L5RA 3GROA 2HFKA 5AVRA 2IBSA 4C7OA 3IVMA 3D6JA 1BS2A 5HKOA 2EZTA 4NULA 4TSFD 4DDHA 3HUEA 1BVUA 3UUFA 4J7CA 5EIXA 2OLKA 1H2AS 1NYRA 4RVDA 4TS4A 4OQNA 2B4RO 1KVTA 3O8DA 1ZIXA 2CBGA 2XUHA 3CONA 1MTZA 4ID9A 4NNJA 1GFWA 1D8AA 3RUCA 1J8MF 2FZLA 1AM4D 3G0BA 2CLEB 2D62A 2I87A 3U3KA 1KGDA 3LLUA 2EARA 4B43A 4N7BA 2Q8QA 3FI9A 3LD9A 1RW4A 3R23A 4EPVA 1A9XB 1LTHR 5F9FA 4PC1A 1FYDA 3RM3A 4K5QA 2YIJA 2FUCA 2ZTSA 4TLMB 1YNSA 3HCBA 5EPEA 5JE8A 2NV6A 1B23P 1GRNA 2GCOA 1V37A 4KIFA 3VPAA 3WZMA 5FOVA 1E1RD 5LXTA 4IEEA 1PUXA 4CIAA 1WCV1 5C52B 1F38A 2JCVA 1ZUWA 3LUPA 1DEXA 1NLMA 2AQKA 1UJMA 1PR9A 4GECA 4URHA 1WABA 4CMIA 1N2XA 2ZBRA 2GK6A 3P9PA 1XZLA 4JB2A 4LOAA 3T3NA 3A26A 4MV3A 4JUDX 1U2PA 4Q1BA 1ZCFA 4KBGA 5GOZA 4QFDA 3VR0A 5FWDA 1DKRA 1DXYA 2FFAA 3FSJX 4BNHA 3ESCA 1RABA 2WIGA 2PUFA 1RQLA 4H77A 2YW2A 3I53A 4FMCB 1SVNA 5DBFA 4BVKA 4ZYYA 2XECA 5BV2P 4QHSA 1W4ZA 2RB5A 3NOQA 5HFAA 1AOXA 2V6GA 3JQAB 4QREA 5B2ZA 3N6RA 4HH0A 3HCFA 4O2RA 3W5SA 2BCJQ 4CM6A 4J2HA 5JAMA 1LK7A 3DD5A 4G07A 4AJPA 2OGZA 4PYOA 4DCSA 2ZRCA 4G8DA 4ZZ2A 4G65A 1IQPA 4ZMSA 4IJQA 1XRRA 4KDEA 2GI4A 3MAGA 5ILOA 2DOKA 1Q0SA 4PSKA 4REQA 1ML3A 1XE3A 1CQIB 3O26A 1IL0A 3PUVA 3FHCB 3MELA 3T95A 4YRGA 3LPNA 1XDDA 3PDCA 2QRPA 5I5GA 4QU8A 4NBUA 4UAGA 4BVLA 5AKGA 3QEMB 2HRRA 3LQYA 3UK0A 3O9VA 2QTFA 3N0TA 4MQBA 3EVCA 3PGA1 4I4TB 4N0EA 1X7ZA 1SZPA 5EWMB 2X2PA 2Q8PA 4KDFA 1V8ZA 4MW6A 2YY5A 4PG4A 3WDKA 1ADJA 4ZRMA 1AGNA 4JOQA 4CFSA 4ESOA 1KVRA 3GXBA 4QTXA 4WN9A 2QVBA 2XB6A 2E48A 2XGGA 2IP4A 3GVHA 2XKAA 3IBGA 2DE0X 2PFKA 4OGLA 3VHLB 4AK9A 5JD4A 3PFIA 2G36A 1SBIA 1RCFA 2PS9A 1FUYB 2QD5A 3H1TA 5TGZA 1JKJB 4G81A 2BUCA 3WDSA 1U04A 4ZVTA 5I7UA 3QMVA 4IYRA 3M82A 1NBIA 2ZJ4A 4JLJA 3KYDA 2QPTA 5AI6A 4ZQEA 2PPLA 1Z08A 1T2EA 3SYKA 4I55A 5DH9A 4N7RA 4OHZA 4IUCS 2MCFA 4C7MA 2BR4A 4CMEC 5JO0A 2PANA 3PDHA 1KEWA 4D9KA 1Q1BA 1REQA 1QG2A 2GSWA 3TPCA 2KBFA 3ZW7A 3IH5A 5KREA 4NMLA 2Z5FA 3IO3A 4EHLA 3BWDD 3CKMA 5KX5F 5KYUA 5JSKA 2VDVE 4JL8A 2YOHA 3ASZA 5D6NA 4Q1CA 2VBCA 1KI9A 2VWPA 2ZIGA 3L1VA 1JVBA 2IF0A 3NRCA 4HAWA 1MC4A 4OM7A 5FUWA 2ZIAA 5FI0B 4ZEVA 4W9NC 3U5TA 5F23A 1YKSA 4U5XA 2A8YA 5GMOA 3TXXA 1V95A 3L7AA 1RIFA 1GR1A 3U40A 2C5FA 2OORC 1VIDA 1E32A 3EIEA 1R9MA 4UM5A 4Y8VA 2ZTMA 4R0MA 4NHEA 1A71A 4RJLA 1SC4A 2DVMA 2OLEA 1J0EA 3O7WA 1PD0A 4BYGA 2OTCA 1KQ3A 3Q5EA 4QRDA 4PE5B 5SZKB 1KTVA 1G8JA 1K7FB 2H1FA 4W5WA 2C59A 1CJTC 3QVMA 1BYUA 5I9BA 3SVLA 5B37A 3NB0A 4KKVA 5A4AA 4E70A 1JFFA 1IEWA 4Y6OA 5SY6A 3ZD7A 1DEKA 3L43A 1F0YA 1CR0A 3B1WA 4WLUA 2QL5A 4C87A 5KTTA 5L7YA 1Q2XA 1XK6A 2PKCA 4AT1A 2IZ6A 4F7DA 4EUEA 1RZRA 1MB4A 1EBUA 3RV3A 3S81A 2ZJOA 1EP2B 1SQFA 1AUOA 2EQ5A 4NICA 4TVKA 4C0SA 1M8JA 1KZGB 1II9A 2YY6A 2QK4A 1LLUA 5JRJA 1W0KD 1YQUA 1EJ6A 1DXHA 1VPLA 3EDCA 1LEHA 4Z86A 1Z33A 2IV7A 4DSTA 4HVCA 1IY0A 3VPGA 1FRVA 3ZGLA 2JLWA 4PXAA 1NX9A 1Y3FE 3ILYA 1UBFA 2BZGA 2RI1A 1QH1A 4JBNA 3BS4A 1MGPA 1RJWA 1U7ZA 4OL0A 5FXMA 4MRMB 3SKVA 3NBMA 4P4LA 1IJEA 2R86A 2ZE8A 3NJ4A 3GRFA 4B6JA 4G0WA 5E2BA 2QR3A 4HWPA 2IS1A 3U9LA 1PGOA 3PNSA 4TMFA 1W5TA 5LQCA 2G1KA 1QAQA 4X7RA 2VPIA 1RWKA 1UMKA 1C0EA 4CG1A 2HMAA 3SYMA 3OFVA 4L4UA 3QA3E 3VR3A 3GGDA 3M6FA 2H52A 4JLWA 2ZZMA 3LHKA 1DDOA 1RQGA 2VL7A 2RH8A 1RQ7A 1T5OA 4Q3KA 4U2DA 3ITNA 5F12A 1N2SA 1OXUA 3IUSA 4EG5A 4N9WA 5JARA 5JPDA 5K0GA 3S68A 3NHPA 1E0AA 3I92A 4RJ2A 5KAMA 3FNIA 5K2MA 4EOGA 1PYOA 1UMCB 2G28A 2PX3A 4QUAA 4DWOA 5HUHA 4L6IA 1Y8RB 4UTZA 5F2OA 2FE1A 4UTVA 4GL2A 1ATIA 1JLKA 1TADA 2HREA 2I55A 2EG5A 2IPAB 2VDLB 1FEZA 3P9QA 2JI7A 4XPZA 4ENUA 4B85A 3WBJA 1M7HA 3HCWA 3QW4B 4O2LA 5LP6C 1ZOOA 2B21A 2RH5A 2EX1A 3GVCA 2B7BA 2BGTA 1T3GA 2HYDA 1TRKA 1V9LA 1PR3A 4KVZA 1YKFA 3C5VA 4XX1A 3X1WA 3IJPA 4M1KA 3K70C 1LTKA 3O1JC 3QYAA 1UMCA 4PAWA 1G5QA 3G9UA 2YNMD 3NG1A 2N47A 3G3EA 2BKEA 4FBGA 1IWOA 2C4NA 4EG6A 4WUTA 1AKMA 4G5OA 2V6MA 4IS2A 1NAIA 4KNYA 1FXWA 2Z4RA 4XGQA 5BPFA 4O4IB 1XEWY 1Z8NA 2XOXA 3SBDA 5YASA 1XFDA 4AWAA 2Y0PA 1N2IA 4B4WA 4ARZA 3HDTA 4OAOA 4WK6A 5SZHB 1Z4QA 3FUCA 2AR7A 4XWKA 1NNEA 3M5CA 5SV2A 4AZ3A 4QEKA 3ZDBA 3PFFA 3AUSA 2BCGY 5AR1A 5DT2A 4HGNA 4TVSA 2UYHA 1R4AA 5AK6A 1DQZA 2AYZA 4QTZA 1VP3A 3WL5A 4WNYA 3STXA 4G2TA 1ONSA 2X77A 3E9ZA 3GI1A 1G9SA 5KNBH 2J9FA 3VNUA 2WRZA 3SN6A 1SZJG 3AHGA 1JWBB 2XVYA 2GBFA 3L05A 1JEYB 5JJCA 3ZXIA 4CU5A 1S89A 1N33B 3TXAA 4FMPA 4ZHQA 2P9EA 5ICGA 1XQ6A 4LWOA 4WCFB 4MR8A 3WGGA 3A31A 2BH2A 3II6X 1C1XA 1B6RA 4DV7B 3W8DA 1BXZA 1RXIA 1ZD3A 4I5GA 3KVRA 3L2OB 4KQGA 4N7JA 3NHSA 2E55A 4GP6A 4F91B 3PTAA 1GNRA 4R2KA 3ANMA 3VV2A 3AM3A 1PE0A 1G8PA 2H8GA 3ISVA 2EFGA 3DQQA 4JP5A 5JMWA 4XAQA 4YV0A 1C3VA 3LBFA 1MOSA 4ZQBA 2G04A 4ZYTA 2VYCA 4IV5A 3VNSA 3LV8A 3DOHA 3NKVA 5CLIA 1KNQA 4FW8A 4QJIA 1L5GB 3S2GA 5KINB 3RF6A 1UK6A 1HE3A 4W7IA 1T9HA 1YS9A 2Q9CA 5FLYA 3RRZA 3OLVA 4YMHA 1PJZA 3GOHA 1NN3A 4XQ0A 5IEJA 4WY8A 2I3DA 4C4OA 1GRRA 4GR4A 3KQLA 4AG3A 1LCIA 2I78A 3KDPA 1OB2A 3LQFA 1KNXA 1N5RA 4BNIA 1XMSA 5GV8A 1G2PA 1GV1A 5F77A 1KERA 3HV0A 3E53A 4L1KA 4IG4A 1TIKA 4YT8A 2Q9AA 4W7HA 1ZC4A 2H0RA 4Q7QA 3ER6A 5I9IA 4I3FA 3NH9A 1ULZA 5DTRA 4HDOB 1E4EA 4XYEA 1T9GS 5CR9A 1FP2A 3TQFA 1ZNYA 5CDFA 3MWGA 3GT3A 1XRSB 3JQBC 1X1BA 2XTAA 4YJHA 1DKNA 4R83A 2FX2A 3H1AA 3MBIA 4FN4A 4WXMA 1BFDA 4U00A 1EIWA 3KZ1E 5DBGA 1HEYA 9ABPA 2CLLB 1KMHA 1SCQA 3CNHA 4TQUS 2JBHA 4B6EA 1N2JA 3JZDA 5IH7A 3B78A 1O77A 3IQDB 3IV6A 2D0PB 2NSYA 3TG8A 1NOJA 4EG1A 1EK0A 1M0SA 5EEHA 1QKKA 3PFNA 1XTZA 3UG7A 2QJWA 3PUYA 4LXUA 3NHAA 2MMGA 3RLFA 1L8XA 4B1FA 2JLQA 3OHSX 3AB7A 4NBRA 1JKXA 4PLFA 4DLAA 2YWRA 1KF0A 4XIJA 3DAOA 4MKFA 5EIWA 4QFBA 4QYMA 2IE8A 4P3YA 3HPRA 2WPDA 2A9OA 4MR9A 4YTEA 3WIUA 1E58A 1P75A 1KP2A 1Z12A 2CHVA 3D2LA 4IQ0A 1RS0A 4TWIA 3VO1A 1CF9A 3QI2A 2CXXA 2VSFA 4L2IB 1ULSA 4LRUA 3ZEIA 2D5CA 1QYWA 2YZGA 3ECSA 2WQ7A 1K3TA 2J48A 1P0FA 1M8PA 1PSZA 3CA8A 2I65A 2IEIA 4IW3B 2BY4A 1BDMA 2FN4A 1BEZA 1XYVA 2RHOA 3MWKA 4HLCA 4DQ0A 2ENUA 5BWMA 4F04A 1GAWA 5CX1A 1TYCA 4HCJA 1T0IA 2VTVA 2FPGB 1ZCAA 3DFMA 3WLNA 2ORED 1NBWB 4N01A 1ADGA 4BNTA 1GCAA 1I4LD 1SPBS 1XNHA 5DM1A 3SMVA 2YV3A 1U2ZA 4E0BA 5TNXA 5K5EA 2C88A 2ONJA 5CDSA 3V3TA 3HGTA 2GBLC 2Q5CA 2VNAA 1XMXA 2C5HA 1L5ZA 1XZCA 2LIPA 1JPJA 2R8OA 2QLLA 3KG2A 4O8ZA 5AXDA 5TE9A 4TMVA 4F46A 4H7HA 1JXOA 4K9RA 3HR4A 3OCXA 3O1HB 4WK2B 4D44A 2I6QA 5K01A 4Q7LA 3VOTA 4D8UA 1I01A 1W29A 1Y42X 3L77A 4EA6A 4ENRA 1T9DA 2IXFA 1WOYA 2CCJA 4D4JA 5F3DA 2OHXA 1KPIA 2AEEA 1QGDA 2UZ3A 4GU5A 2PZEA 4L7VA 1RPNA 5JS8A 2WP0A 3WSTA 2VAPA 4Z8XA 3QWAA 2M32A 4BQIA 4NBTA 2HA6A 1D8TA 4NV3A 4N3CA 3DNMA 1OOEA 1T1JA 3S70A 4CKBB 2PO5A 4LRXA 1IXYA 1FS6A 2YTZA 3KZNA 2PD6A 3A6ZA 1EFLA 3ZU2A 1HETA 1MLDA 5CFPA 4YCNA 1XWFA 4XWAA 3C3DA 2FN9A 3PHCA 4P08A 1GL3A 4NAVA 4DSNA 3QE2A 5C8YB 3WLTA 4GSYA 1LPOA 3U49A 1ODCA 1JR3A 1FMLA 3ECAA 5C3UA 3OQBA 4YCSA 3ZWCA 2BF4A 4ZI7F 4KDRA 3VO2A 3ZLJA 4RF3A 4AQDA 3KP1A 3H13A 4MOWA 2FPIA 1DJPA 3WYDA 2GCOB 4OBEA 2XTJA 4P36A 4B81A 2FWIA 1YRLA 4ZALA 1UBEA 2JLSA 4DNFA 3ZVNA 4PCUA 3KZKA 3R0QA 1VC2A 1S96A 2Q9UA 5DBHX 3B7PA 4NOMA 2HX1A 2OCBA 3WBBA 5JYDA 1WDTA 4DV1B 2G9NA 1Y4ZA 4WXEA 5IMSA 5LQJA 1LJLA 1H22A 1LNZA 2HBQA 4UXIA 4YX9A 3AVVA 1XXHB 3LNCA 1Q0UA 4OXQA 4I8DA 4UZSA 1V9CA 5FUYA 3RFVA 5KYNA 3BIFA 2AN4A 5DWQA 1KK3A 5JJ5A 2F4VB 1OSNA 3DC7A 4XWWA 1Y80A 3CRZA 3F3KA 4E88A 5I7RA 5AVKA 3AB3A 2IUSA 2WMNB 4IIXA 2X6QA 2VF8A 1O08A 3I6MA 4BMZA 4X1IA 3LPLA 4JXZA 2GPYA 4QBTA 3GEMA 1TYZA 4H6VA 4LYEA 3W6OA 1P19A 2GRUA 2ZR8A 4OYHA 5LKAA 4EMUA 1QH9A 3UY4A 1DDIA 4UPEA 3DWEX 4Q05A 2JLYA 3EGXB 1PQ4A 2RBKA 4GM1A 3R7AA 1Y1KE 1ZGGA 3REFA 4GGMX 1X0XA 4P83A 4MJ3A 1LPAB 3JQ8B 2C8LA 3F97A 5HE9A 3HJCA 4IFIA 1EVKA 4LHYA 4V24A 5LOVA 5TGDA 1X2EA 3EIQA 3L6RA 2JFHA 2JDIA 4FB4A 1N9ZA 1CY7A 2NSLA 3CB4A 4NHOA 2BEKA 1ECPA 1DBQA 4I50A 3K1TA 2DU8A 4KNVA 3VYSB 4UTNA 4US2R 3AKYA 2W98A 4E03A 4JYAB 2HPVA 5TPWB 1PS9A 1BE8A 5L3QB 2E4AA 2HY7A 1KRWA 4WE3A 1YRYE 4HGQA 4ZQGA 1RYHA 1IBCA 1KMIY 2O1WA 3EEIA 3EZLA 1TNDA 1VJGA 2H9AA 3IYLW 3MJVA 4RANA 3WWZA 1K88A 3WE7A 5IT0A 1XQ9A 3WL4A 2R85A 3W2TA 8ABPA 1XRLA 4K9OA 1I3CA 2WSSA 2XOKA 2ODWA 4FSDA 1E9SA 1G17A 5EHXA 3JTMA 1F12A 1G8SA 5SZIA 3ZTWA 4Z51A 2GYUA 4I9FA 2P79A 1NMEA 3BGVA 3UAXA 1P3DA 2HCFA 2F00A 2R6FA 4LV6A 2H31A 1MUUA 2EP7A 3OP1A 4BKQA 1YVUA 3AL2A 3FLMA 3KWJA 2GERA 1FSSA 2QZ4A 3F5FA 3CG0A 4B3SB 3BCHA 4YRFA 4DCCA 3ASUA 3C4VA 3MMNA 5JCJD 2ALJA 1QLHA 3IO5A 4AKEA 4XVRA 4LAFA 5FOXA 4QOFA 3HXPA 4DJJA 3ZBPA 2EC5A 1UXHA 1XUOA 3CJRA 3IOCA 4LWPA 4EYSA 5DNYB 1BCSA 2PEZA 2EDCA 4BATA 1TVEA 3A0RB 3UC9A 1QR2A 4QHYA 2AEFA 2GCNA 3IP5A 2GZRA 4I1IA 3GO4A 4WESA 5ILQA 3ZZ1A 4CT0A 2PJRA 1RM3A 1RYDA 3OPYB 5D1NA 3CRMA 3UG6A 1H8HD 1XYYA 4I55F 2MSCB 3E1GA 4LGCA 1RQRA 2VZLA 4LDAA 2OD9A 1O7JA 3OQNA 1JSLA 1U1EA 4MICA 4X6YA 5HCIA 5KUTA 2IWRA 2PKRA 2YKGA 3NATA 3ZWQA 1H5NA 1HT0A 1OLUB 2J6CA 3SKYA 1BOOA 5A7FA 1UAAA 4TS9A 3OUZA 5LNK6 4CQMD 4J1NA 3GFGA 3EMDA 4TL8A 4KQKA 4FFBA 3ZWDA 4CLOA 3GG9A 4YQYA 4DCNA 4ZOCA 2PWPA 3DBRB 4EHNA 5I48A 1XZAA 3OEYA 5BSWA 3ACDA 1YXMA 2BLNA 2OFXA 5AI8A 1TJ5A 2D8AA 2CJYA 4EBBA 5FOWA 3IKVA 1IN1A 5U1PA 3G8AA 3THWA 2P6NA 4XVQA 5KNBA 3R6DA 3PC4A 5G4LA 1KI8A 3ST7A 1TAGA 2ZQYA 3RC7A 4EFDA 3KUCA 3VDXA 1S5PA 1PFGA 1CZRA 2Z04A 3LF1A 1KH1A 3TX2A 3ZJ4A 4O33A 1Z4LA 2LV8A 3L7CA 1SGWA 5L40A 1D1PA 5A05A 3N86A 5ICFA 3KSRA 2O0KA 1HPLA 3HRHA 3BSWA 4KZPA 3Q0EA 2Q3FA 5LJIA 4B3CA 3PQ8A 4OEHA 2HU7A 1UL1X 2YJ4A 4AN4A 3D2BA 2G25A 4GQBA 3MUNA 2WJAA 5I8WA 2AD1A 5A06A 4C2AA 2NT3A 3TZ6A 5KWJA 2QM3A 3NDPA 1W4RA 5FUBA 4I5DA 3B9RA 2BPOA 1P4AA 2ZJZA 2QG9A 3R8FA 4FMDB 1K89A 1WB4A 3G02A 2VVTA 5HMMA 2C5EA 2C0CA 4M9QA 4OHKA 5FB3A 5JW6A 2Y0BA 4AXXA 4ER0A 4XD7D 4KYIB 4CLDA 3S2UA 5LFAA 3QLVA 3CNNA 4GXNA 4FX2A 2QX9A 2I6GA 2VQEB 1LBTA 3E22A 3MPOA 1OJ7A 2HPHA 2QP9X 2HF9A 3WK8A 1C0LA 1UC9A 1KMNA 2G09A 1V4NA 1T6BY 1GA1A 2EYQA 3IQXA 4CM9A 4EHDA 2C5AA 4WVLA 4D45A 4YDHB 4BNUA 1BGWA 2R1VB 4ARAA 3BFVA 1H42A 3RRFA 3U3OA 3UUGA 3G9XA 1TF7A 2HK9A 1DC3A 4RTPA 1SVWA 2GD6A 1DC6A 3C74A 2HF2A 2YNMC 4GX1A 1D6JA 4LJ5A 4UULA 4WDQA 1SZDA 3EFBA 3P8ZA 5TS3A 4YDQA 1SU4A 1R8SA 2EHDA 1LPBB 3GLSA 2FZVA 3GNTA 4NH0A 1EG7A 2LWIA 4Q1FA 5KJEA 2ZRIA 4G36A 1U2QA 5TLSA 3H2HA 4LF5B 3NXSA 3ZGOA 1O0BA 4XSGA 1NDUA 2IHJA 2KW5A 1TJ4A 2ERCA 5C31A 3U62A 3TR0A 4OP2A 1WKVA 1ZONA 2W2LD 3VDNB 3MB5A 2IFTA 3LLMA 1CC1S 5E95A 4TMZA 1FSZA 5CCEA 4KV7A 1SBTA 1MOZA 5LD2C 1YCHA 2IE0A 1AUPA 3CZCA 1PIWA 4JYBA 4K6HA 3W5VA 2ENWA 3L7JA 4PPYA 2PZGA 4LTNA 1A7KA 1UFKA 3DBLA 1PRYA 1UEIA 2XMDA 5AKEA 1SHKA 1YHYA 2P77A 2NVUA 2WUWE 3LWNA 3T0IA 2IGBA 4DF3A 4W1RA 2QLNA 2CL7X 3EN0A 2RGAA 4HRAA 5IK2A 2MYNA 2PLAA 1XMJA 4DREA 1DJLA 2NQ2C 2MJLA 3BMXA 1UOQA 2Q6OA 1X13A 1JDJA 5M3BA 4DDVA 3PJDA 4OLJA 1HYHA 1FUEA 2QUAA 4W99A 5HTKA 1UKBA 3WGMA 1QQAA 4C0KA 2UXDB 1PJ2A 3ZDAA 1HFJA 2A0WA 4RKWA 2OECA 2PKQO 4D2IA 1N9GA 4NV1A 3P9CA 4KIJA 4HVAA 2P8JA 5DYIA 1PUIA 3C3PA 3HY4A 5KQPA 4Q9LA 4F2WA 3R0VA 2HA4A 1YJ8A 2OCYC 2PSEA 3A25A 1RI1A 4K7JA 5DTEA 2ZIZA 3ZEAA 5FH9A 4G5YA 2WT4A 4G4SO 5EHGA 4G9EA 3LC7O 3QMPA 2ZT7A 1JMVA 3FYUA 1Y3DE 3KEMA 3OF5A 4IG9A 4MGEA 3TQOA 4F0JA 3M5PA 5K6AA 5KOYA 1KEVA 2POQX 1NSFA 1VXOA 3JZIA 1YOVA 3VC2A 5TX7A 3TOCA 3DUFB 4UMVA 1IPEA 1N6HA 2XNDA 3K1ZA 3QV2A 5HIMA 3ZBUA 1OAOC 2AEMA 2B36A 5AHOA 4D3SA 1VE9A 5AVJA 1YS2X 4BEVA 3DLBA 2BGGA 3COVA 4OUDA 2VEOA 1Z68A 4IXWA 4K81B 1J1UA 4KO3S 1AK9A 5BNWA 3UTCA 2QXUA 3G68A 4YJ2B 4Q4JA 3ZDXB 4COKA 5I6DA 1TUIA 2OKGA 3WP0A 4ALMA 4K9NA 1QIJA 3CCBA 2H63A 2OXIA 1FDOA 3QOWA 1O0CA 5KQMA 2F8SA 3KCNA 4DR7B 4YJ3F 3HO8A 4WCFA 3B6MA 5LOVF 2IXAA 3RVRA 5KNCD 1JDSA 2JJQA 1PLKA 1LC3A 4DV5B 3T35A 3KZMA 1N7JA 5TXGA 1QU2A 3L49A 1FFGA 3Q9SA 5FNZA 3BK2A 4GWLA 4POAA 3H2ZA 3A6EA 4J75A 3CPSA 4M9UA 2NUPB 2WMDA 2W2KB 3T7TA 1CRLA 3CCCA 3QM1A 4U7GA 1UXIA 1Z17A 4O1MA 3CF4A 4R71A 1RJ9B 4TMYA 2QVGA 4YJ3B 4PF1A 2WG1A 3TTSA 1E1CA 3C6KA 1QO7A 2ZB3A 2YMPA 3PYXA 4NZOA 4LOKA 2KHZA 2PZFA 4EKGA 4GKKB 4I6JA 3ZY2A 4NBWA 3BGOS 5DRTA 3SM3A 4FYWA 3FSEA 5FBHA 4WY2A 1TZMA 4XSVA 2NYAA 4HBZA 3DD1A 5JATA 5T4EA 3FXAA 4DNQA 1W88A 2FEWB 3PYMA 3D4IA 1AKEA 2DHCA 3QYPA 4QQNA 4YWHA 2AZTA 1QVZA 4R1LA 4DNOA 3FFTA 3IC5A 2BISA 4HG2A 4KXLA 3GLIA 1WSBA 4KW7A 3THXB 4FCVA 1N8KA 1J0DA 1SUCA 5AXAA 3TLAA 2D5BA 3NMUF 1TKRA 3ZCSA 3AFNA 1I2MA 3WFZA 5LUAA 1Z5GA 2Q3HA 4KH0A 5CB8A 1CYEA 4DDTA 4BJ6A 2O59A 5D51S 3TSWA 4MV0A 3B1YA 1XVIA 4W8HA 4MWSA 2PDAA 3X1XA 1UDRA 3ZWOA 2F3TA 4DMLA 4UNPA 3WMGA 4XVCA 1Y5MA 2I6TA 3A06A 3EXIA 1F48A 3UMFA 4NARA 1EP3B 1FMTA 1X3LA 4S1PA 3FTPA 1ZXXA 3INRA 4MV8A 2IYLD 2JH8A 2P91A 4N41A 1XA3A 1CQWA 1N1DA 1U0HC 1V8FA 2FW9A 2P4HX 2PH7A 4HDNB 4RY0A 2WK1A 4XX0A 2YVKA 1H1LB 3I4LA 1H2EA 3ODPA 1R50A 4CCYB 4OJMX 2F43B 3H5VA 1YBVA 2O20A 3N58A 2UYOA 3TQCA 2B8JA 2PZJA 3WK7A 4F93B 1PD1A 4IBOA 4URUR 2A1IA 2O9JA 3FWPA 4MPJA 4UPVA 1K68A 4BNNA 3KV3O 3TF5A 3PHIA 3VR4D 1NWCA 2LR0A 1PR1A 4QPPA 4MLCA 2G9QA 3F7OA 4FGLA 2EDAA 3SXJA 2V0CA 3PUZA 5G1PA 4DS3A 1RLOA 1BNCA 5TMDA 1R0XA 1X8XA 3BN3A 3ITEA 1OWOA 2EKPA 3ZDCA 4GOJA 1JIIA 4X94A 2V7VA 4NC9A 3T41A 3U7FB 3GX1A 3TRIA 3ZYCA 2R79A 3GYBA 3JD0A 3HWWA 3LT1A 3PC3A 5DJ5A 1KKMA 4RZQA 4H3SA 5JASA 4X1KB 1VGRA 4K8RB 3MJFA 4G0NA 3TMAA 1Z45A 3GPDG 2XLBA 1GKIA 3VNAA 2WHQA 4HFMA 2AFVA 4RVHA 2DY1A 4BO9A 1WMAA 5B3LA 5BN4A 1UC5B 3OCJA 1PT5A 5CFQA 2I91A 2CVZA 1BS1A 4LEIA 1OC4A 4BTLA 3PRYA 4WZAB 1GYRA 1AV7A 3EAQA 3EOBI 4JT9A 5HA5A 3WYBA 4XUCA 4AZVA 1PHRA 2Z95A 3ICQB 3QWHA 1TEHA 2HSDA 1KJIA 2R0QC 2IQ5A 2NZ8A 2LDXA 3T6KA 5HJ7A 3AVWA 3TRJA 4WHMA 4PO3X 3ZDQA 4EAAA 2EBUA 5JLAA 1VG0B 1VL6A 2ECPA 2HIGA 4JL5A 3UC5A 4Y2HA 2QQFA 3VU0A 1WQ1R 4JA2A 5BYJA 4DJDC 1S2GA 3B7GA 3O8OB 5IAOA 2YWXA 1XAJA 2HTEA 2J0EA 3FDJA 1GQYA 2DC1A 4K87A 3S1SA 4DV4B 2XMPA 3FKJA 3QVTA 3AKCA 4RFSA 4HXEB 2FOIA 2C2XA 1NW6A 4XEHA 4DLLA 1NZDA 3O38A 1Y48E 2FWPA 3EODA 1JTFA 1JYEA 1WSWA 3NTRA 4B6SA 2COEA 4B7XA 2C2ZA 1XDGA 5DEOA 3PTZA 3WWCA 4A5SA 1TM2A 4YMTA 1DWQA 2EZ8A 4ZIRA 3GJYA 1P61B 4QL3A 5EQTA 4DB2A 3OPMA 3L7IA 2UYCA 4O25A 5JROA 3GT0A 4RV9A 2Q5HA 4J0GA 5CLFA 2B34A 1UBNA 5CXXA 3ANTA 1QH8B 1A5SB 2Q50A 3GH1A 2PE5A 4KN6A 2ZW9A 1XZBA 2VK2A 4K9LA 3B2QA 3NIFB 1VJ5A 3KB1A 1JXAA 3DPUA 3CX3A 3O8NA 4P3KA 4IYJA 1Y82A 2G07A 3OIFA 3UGKA 4ALJA 4PGFA 2W8BA 3AW8A 3TNJA 1XPUA 4OTZA 2I6FA 1FNBA 1W49A 1HORA 2M1ZA 5KDOA 1I3OA 1PDWA 1JG6A 3KQSA 4X00A 4NZNA 2WHPA 4Z4GA 3UTDA 1ETHA 3FIUA 2QN9A 1JA0A 1LI4A 2EZ9A 2IHNA 1VE6A 2RAFA 2HLHA 3UJ3X 5DNWA 5ALXA 5EVJA 3HDYA 3UA3A 1S3GA 3GP3A 1H1LA 3HMKA 4ZU3A 1UMDA 4QA9A 4R98A 3GCZA 1MMFB 3JSAA 3LXMA 1WY7A 2X2OA 1HDGO 5EWLA 1NT2A 1UAYA 2JPDA 1CVIA 1US8B 4TTSA 1OFUX 3IOMA 4QRHA 1CRWG 5CW1A 4EB6A 2GXQA 1ZISA 4K86A 2BKLA 5HS6A 1Z8HA 3KSUA 2WYVA 2ZRAA 3JQGB 4CQMA 3HI4A 3RU2A 1JDZA 4NIMA 1XZQA 2R751 1N9KA 4ZKDA 1OV6A 2XCOA 5J58A 2ODTX 2O06A 2JGRA 3DEYX 3QLUA 1UOPA 3GCXA 3VO9A 1PQWA 3G0CA 3GNSA 4U2CA 3ZLBA 1HA3A 1RHUA 2QPAA 2YFKA 2J67A 1QUFA 3GLHB 2X5NA 2R8RA 1TCBA 1W1IA 2YHUA 4H15A 2GAFA 5BSUA 3GPCA 4BKRA 4WKPA 2I33A 3BT7A 4B75A 4YLGA 4AROA 1CJKC 4I8XA 5AM2A 4V2UA 3HP4A 4HVLA 1BMFD 1UDWA 3DT9A 3N70A 5I7WA 3K0CC 4H7PA 4RTOA 4ZT3A 3IMFA 5COBA 3R5FA 3KE9A 4B8YA 3FLEA 3OJXA 3GN1A 2ZIXB 2ZUWA 3N2KA 5JCJA 3HWX1 4MS1A 4K88A 5A9TA 3F1LA 2REXB 2P9ZA 4C0AC 3NHZA 3SDSA 3E6AA 4QD3A 3H5IA 2AFHB 4HEHA 4I99A 2AN9A 4CMAA 1YRAA 4NCBA 5IDVA 5DSXA 3L6DA 1ACLA 3B60A 1QTIA 1R6VA 2R47A 3K70B 1T5LA 2YX1A 2NUPA 3G2HA 5FKJA 4LISA 4WW0A 3FRJA 4HS4A 2J59A 3C8UA 3L4EA 2UZ4A 3AESA 1F14A 1T1IA 3IMKA 1UJ5A 5G1NA 5J5AA 1R7RA 2IS2A 2RGCA 3RQSA 4M86A 1Q91A 2WJ3A 3QOXA 2QR2A 2XF2A 4JR0A 3M5WA 2KPOA 2LVBA 4W1SA 4UOEA 1K5PA 1WLSA 1X7HA 3EQ2A 1SVLA 3FGNA 1MENA 1V43A 3ANXA 4PYMA 4QQ8A 3ZIAA 2ZDGA 3S8MA 1CETA 5E2AA 4XDHA 3KR0A 4DLWA 1O96A 2V6BA 4YR9A 3WGQA 2QD1A 2E5LB 1DUVG 1HM5A 4A5OA 3I04M 5K3FB 4CMCA 4EBFA 1SIBE 3A05A 4HGRA 1K6IA 5A7HA 3OP4A 3P2KA 4BBZA 5FEUA 2A5FA 1CUIA 4MV7A 2GO1A 4JP1A 3T4EA 4DPMA 4QAJA 4PQFA 4H6PA 3UOWA 3UA4A 3SHTA 5DGDA 4AN1A 2OHOA 4Z1MD 4MX8A 2JAXA 1Z8DA 1M2HA 5KTNA 4MWGA 2OZKA 5K0EA 2EJUA 2AQHA 4PRZA 1PFWA 4RADA 4JNKA 1KOFA 3VTFA 4H59A 4D6YA 5HJEA 3CHYA 1KZ1A 1P2DA 2H1SA 3CJQA 1OXXK 2RBGA 3M2PA 4ZAFA 4BGIA 2VPPA 1IBSA 3TW6A 4CDRA 1X7WA 4RENA 3MTQA 3W6ZA 1YQXA 4A8JC 3OQ6A 2RGNA 4RD3A 2QQGA 1EH5A 1R5BA 1GNPA 4UHDA 2FSGA 2FPWA 1UMDB 4HLQB 4WZBE 4W5QA 1ISFA 2CLCX 3MQ2A 3Q10A 4OBXA 2C42A 1PJTA 2ZBQA 3BXOA 2NO4A 4Z6KA 2DPGA 3QHQA 3RSLA 5TC4A 4EKNB 2PCLA 4MMYB 4R8LA 5E4TA 1ES9A 1TQ4A 2A4MA 4BWGA 3RSFA 3HVKA 2J41A 1YR8A 4URYR 4JB3A 4G1BA 2FR8A 1W75A 1YSCA 4D8XA 1G9XA 4XM0A 3EJ6A 1I3MA 3KQNA 5D5PA 4I55B 2QTRA 3JU3A 1A9YA 5IULC 3SXUA 5SYMA 4CL0A 4DBZA 5L7TA 3B85A 1X1TA 3ZI0A 4XGIA 2IHTA 5K8TA 2RCYA 3QQ5A 5J1TB 2J6IA 5K8CA 5KSWB 2CB9A 3JQAD 2IZ0A 3CNQS 1OE0A 3KT3A 2OCIA 1PJBA 3L7BA 5F7XA 2BONA 1RYYA 2B98A 4H1TA 3OJWA 4TUYB 4URWR 3AJAA 4J9UE 5I7EA 1FVHA 3N0WA 3K30A 4I1UA 2QOEA 4PWZA 4AJNA 4CPDA 4DEXA 2JRCA 1HY3A 2BGIA 2J08A 3OUUA 2DETA 1G19A 4HDRA 2YUTA 1YZQA 4IHKA 4JKOA 5KHAA 1XB2A 3R44A 2JNWA 3E8MA 4URVR 3ND5A 4GUDA 4P34A 5JRDS 2Q0SA 1EGQA 2XF8A 3K0AB 1TI7A 2V1XA 4JJ4A 3A11A 4W5JA 4EJSB 2DY0A 4E4RA 2Q7DA 4X20B 3E3MA 1EDBA 5C5IA 3CWCA 2P27A 5IAJA 1QANA 1EFPA 1MFPA 2XGOA 3WISA 2Y27A 4NEHB 1RM5A 1MB9A 1HR0B 4EG0A 1T2VA 2CY0A 4RCYA 5JFOA 3OT1A 3WNCA 2Q2VA 3K4QA 4P5PA 3C5CA 4NLLA 4GDMA 4NE7A 1IATA 4EFNA 1YZYA 2K2QB 3ND8A 3V1LA 3EZ7A 2XT9A 4MVWA 5FJIA 4II3A 1FF9A 1FQWA 1TCCA 1U1GA 4IGEA 3QJGA 5JISA 2I80A 2R5FA 3V4FA 1JQAA 3AVQA 3SLRA 1P1BA 5JD3A 5CU7A 3ZS8A 3IP9A 1H2WA 1R64A 2LXNA 2ZU0C 2VZEA 2BFNA 2C0QA 4ZVNA 1KBQA 2RHLA 2I2CA 4GYKA 3RYIA 4OGKA 4UCWA 3EDOA 3WJ1A 4IDAA 4RTQA 5IXYA 1JLRA 1XCJA 3F46A 3H16A 3STUA 1SU6A 5JBIA 3KJZA 5K0JA 1SG0A 2B4AA 4CODB 1GGVA 1K5DA 4G4JA 2XDAA 3K0EA 4C9BA 2QMQA 4HYYA 4GL4A 2R11A 4KAAA 3FCXA 2ACVA 4LJLA 5DK6A 1A4RA 2OBFA 2ZRLA 4Y2SA 5AHXA 5HF9A 5HZHA 1L5QA 3SQMA 3D0OA 4W8OA 1KIAA 3VJLA 4CMHA 1J0AA 5EMLA 3G2IA 3OZ7A 4FGUA 1GIAA 3SC4A 4EW2A 1FW6A 3S1LA 1H85A 3W2FA 3P2EA 1CUJA 4Y0NA 2A1TR 4CIBA 1IWPB 1FDTA 4DTCA 3H99A 3CGWA 5ESDA 1XSEA 1ZOSA 1DCTA 4ZGGA 2N42A 3G1UA 4RPLA 3IOYA 4WZBB 5IZCA 3FTNA 3Q8MA 2WHRA 3IP3A 3MTBA 4RH1A 3KJQA 3DV2A 3GZNB 1A7UA 1Z73A 3KQOA 3MSXA 2AS0A 4JGGA 5ENDA 2DXIA 1R0ZA 5LYJB 2NNWB 1SVOA 5GGXA 3AR9A 5K0CA 1IBMB 5CBPA 2QG4A 5DRYA 1WJGA 2QGFA 2Q4OA 4AVYA 4F97A 2G3YA 2PUHA 2CLFB 3K3PA 4DT1B 1C1HA 2WUVA 1IM2A 2AXNA 2BKUA 4P33A 4CEIA 1XIVA 3A1NA 1Z0UA 2GS9A 3TPZA 3U7EB 3R6TA 4QXAA 1ZCZA 1EQAA 2DH5A 4C7OB 1VFPA 3I45A 3W78A 5C4MA 5L4LA 2K6GA 2B2XA 1IEQA 1TMGE 4OG2A 5IAKA 5I9SA 1Z88A 1H2ZA 4RL4A 5DULA 5T5QA 2QTCA 4LXIA 2G9UA 3Q8KA 2W2VA 4QFMA 4BO6A 4RK1A 3BOSA 1K4KA 2VP6A 3PEWA 2IYOA 3CNBA 2QXTA 4DR3B 3T3HA 3CUWA 2CGEA 1YI0A 1L4YA 4HADA 1PNVA 3JSXA 4D0SA 3K8OE 4ENQA 2O5EA 1JI0A 3P20A 3CLTD 1JB1A 1TM1E 5CJJA 4C6TB 3SDBA 4QARA 3JV7A 4P5EA 2I1VB 4ZREA 1ENYA 1GN8A 5JI2E 1NIJA 2ACWA 3H9CA 1XRNA 1Z2EA 1NZJA 2ZI4A 4Q9KA 2C57A 3K53A 4V1CB 4Y1RA 1QHFA 1WQ3A 4LBWA 3FMPB 3GFFA 3HYCA 3IAS1 4X8OA 3NM6B 2G8LA 2C96A 1NNI1 4RJJA 2DJIA 3QIAA 2IXDA 1DKLA 1SXJA 2WJIA 1I2ZA 2XT6A 4BX0A 3AB8A 5F5LA 3PB3A 1I1HA 2Q62A 2V3WA 1PI3A 4MARA 2Z5LA 3V2GA 1FRNA 1WP4A 2ETXA 4CN9A 3HFRA 4NDZA 4YASA 2GBLA 2XHZA 1GY8A 1Q44A 4HQRA 3SWWA 4JQSA 1D2NA 3HU5A 4G01B 3GC6A 1U5CA 4E30A 2QZJA 3MLAA 1OBVA 2PIDA 4NOLA 1W85B 2HLNA 1RSZA 2YC4C 4IIYA 4ZYWA 1U9YA 2OQRA 1PGPA 1C2TA 2OAEA 2G1UA 1ISSA 2PL5A 1MABB 2HMVA 2P2GA 3AIMA 2A88A 3M83A 4J0KA 1GGNA 1BCRB 3I2HA 4XB2A 4DSOA 5SICE 2WTXA 1GD1O 2VSNA 4LOLA 1VMKA 3E7FA 4HYTA 4INJA 4F1WA 2VS1A 2CDAA 1EFTA 2VCEA 4IRXA 1X86B 3TBHA 1RKVA 3LQ2A 2ZSBA 1YS1X 4QVGA 3I09A 4DBLE 3VNRA 2B1RA 3WIBA 5AXCA 2IZ5A 4H1WA 3GVPA 1W73A 3RB8A 5FOSA 2WAOA 4JELA 4RZUA 4PAMA 4HUTA 3E3LA 1QG0A 2DWUA 5KSPA 3AF4A 1XF9A 1URPA 2DM6A 1W87A 3JWIA 2IIBA 1UJBA 5MGBA 5CDHA 1N9GB 4DMUB 2GUGA 2HBZA 1DMRA 1W2WB 2Y2VA 4FE7A 4JODA 4TKUA 4X71A 3V48A 3VR5D 5TQ0B 1M33A 4F4HA 1Q7EA 2ZYAA 2A0KA 1G8HA 2YHSA 3CG4A 1IUPA 4RA6B 3WNDA 1CXZA 1K66A 3N6XA 4EYQA 2J32A 2V6JA 3P9ZA 3BREA 3TNYA 2Q21A 4RTLA 1VYUA 3T1TA 2MWMA 3CH6A 4D9IA 1SCDA 1YQ9A 2FJ0A 2OM6A 2VJNA 3CCFA 3R0JA 3T15A 4LC0A 5IM4A 5K51A 2IBMA 3WKDA 1SIOA 5JQGF 4YC7A 1QV6A 3KVYA 5K3SA 5KYVA 2ZRKA 3RYCA 5AM0A 3QFRA 4EHIA 4QICA 3NFYA 1L6RA 1JBQA 2XZOA 2AC4A 1DRJA 1XC7A 2ICAA 4HP8A 2QVCA 1KFBB 4ZZ0A 5IX8A 1DOHA 2VPYA 2ZAGA 3TD9A 2J3QA 2W2QA 3N7TA 1ESDA 1RQ2A 4Y6RA 5KSOA 1M5TA 2OD7A 4CKWA 4LF4B 3IUEA 4EGAA 1W1WA 4WEQA 2HV9A 5F21A 4B7AA 2P90A 4QNNA 3RYFB 1E7RA 4PYIA 4XDGA 1U2EA 4FSHA 4OQ4A 3AJ8A 5CG1A 1OH7A 4M1ZA 2ZRGA 3WK4A 3C16C 1I6LA 2NM0A 1UPCA 4CKYA 2PUWA 4DRYA 4S0ZA 5E3JA 2MINA 2DT5A 2K5UA 3JAKA 4FWBA 4PU0A 1I1OA 1T5SA 3PJGA 3VZQA 5TRTA 1JNYA 4XA8A 5REQA 3U4GA 1RYZA 1TMYA 1GM5A 3ZWMA 3JQQA 3LFHA 4CDMA 2DKNA 2D1SA 3HBFA 2AMYA 5E0KB 4PNEA 1DP4A 4ARIA 2ZPAA 4BLUA 4HVTA 1P1CA 4J16A 1BX1A 5KX5A 3BH7A 3AL0C 3QELA 2F1IA 4RWZA 3ROMA 1O95A 1SK8A 4BJHB 4TWZA 4G37A 5B7GA 2B7CA 4JIGA 2GH1A 1NG1A 3OE7A 2XYPA 4F1JA 1JX6A 1CIVA 2GGSA 2I03A 3GL9A 3TSCA 4TWRA 1RACA 4DKJA 3U7QA 4E5PA 3EUFA 4BFXA 1KE1A 3ZOKA 4TKVB 4K0KB 1DFIA 4KX5A 1UBKS 4MPTA 1X7DA 2ZSHA 1KZ9A 1SN7A 2BW0A 2I4LA 3TW8A 1NG9A 4F5DA 4MCAA 1SHJA 2H4JA 4MYHA 3WZLA 4YUAA 5KHLB 2O8CA 3OPYI 3MTEA 3GY0A 2QRUA 4DDKA 2D00A 2AV6A 1AS3A 1MC5A 2A7QA 4TKUB 5EJGA 1WU8A 3DJYA 1BHJA 2CJPA 3MWYW 4ZQHA 4WZBA 5C80A 1FJ2A 5LMZA 5J2UA 4LHEA 4HJXA 5IPFA 1CUHA 1RE0A 1K8XB 4R2XA 5IC6A 1VLQA 4GW3A 1B0UA 4DLNA 3R9WA 1AK2A 4F2GA 2QAGA 4KSBA 2FSVC 4PLPA 3UK2A 4RTNA 2JD2A 4KUGA 2GFHA 4NFSA 5EE5B 2YYSA 1XPJA 4MKHA 4RW0A 2FDCA 1A9XA 2TS1A 4KTTE 5ALNA 2H4YA 4BNDB 3E4CA 1K7CA 2QYHA 3TTUA 2G9ZA 3QBJA 4P1ZA 4BCDA 3X1ZA 4UNQA 4Y1FA 5AIAA 5AKLA 4GPTA 2X23A 4YJHB 5FI1B 3RGGA 3VFDA 2IH4A 1H4VB 2KJQA 3WLRA 5A03A 3TLGA 4RSGA 4WJLA 1E4EB 1WDKA 4RNDB 2XYVA 1OBFO 2A2ZA 4I1RA 4M22A 3VC3A 1IAVA 4B3HA 5C3MA 4Z4EA 3ADCA 3GGJA 3DPSA 3JX9A 2I4IA 4OOFA 4UU0A 4EM6A 4G0YA 2QUZA 3BTOA 2Y05A 3IVAA 3PCRB 4QPCA 3VYTB 2BBSA 4MAAA 5KQLA 3BJEA 3UJ7A 3S29A 4OK6A 3SX4A 4ME6A 2AKEA 3VTKA 3AEXA 2H48A 4M99A 3OLCX 2FAXA 1FB5A 1G6OA 2HGSA 1D7AA 1QKIA 1X8JA 2V7UA 1GKLA 3EDYA 3PE6A 1KC3A 2P78A 3AHHA 3SD7A 3IEIA 2G83A 5F7ZA 5MN6A 4AP9A 2X4GA 2Z6UA 1C3OA 2BRUA 4FYKA 1EXNA 2OSBA 5LKRA 3GP8A 1XTBA 1ZGJA 2PKEA 2IGTA 5IXSA 3OFKA 3NV7A 4ENTA 3Q8LA 3LNTA 2D5IA 4XGRA 3DMRA 4MKGA 4QELA 4X41A 1Z8FA 3DVRX 4N0DA 3VYRB 5HWSA 2RE8A 3IURA 4PCLA 4PZEA 3SP1A 3I6IA 1GTZA 2POCA 1ORHA 1P1RA 4AS1A 1I32A 2ZI3A 4ZVOA 5C53B 3F9RA 2V1UA 4KU4A 2R6GA 4M6WB 4QJ4A 1FP4B 5FPKA 4JR2A 2BEVB 4MQ6A 3TLBA 1I2BA 421PA 5B3KA 1XZDA 3EF1A 5JCZA 5DYTA 3SC2B 1AKUA 1BKDR 1XDSA 2CLKB 1OKKA 3GLTA 4OGFA 3H87A 4QDZA 5HOQA 1ZH2A 1YQQA 1Z35A 5JSUA 2D2XA 2IELA 4UDXX 4JITA 4MV9A 1OBCA 5JIBA 4C0HA 1A8UA 2UXCB 1VL8A 2WLSA 3PZRA 5LMCA 3HB0A 1Y9AA 4H0FA 2WJZB 1DO8A 4BTEA 4UVEA 3LK6A 5HYVA 2Y1GA 2YHAA 4HTFB 3V9PA 4ND5A 1J0BA 3LLSA 1JMKC 2JAQA 4UBLA 5AYVA 3AF6A 3UWDA 2P0AA 4GD3Q 1L3IA 1SPXA 1UK8A 2V98A 4JLPA 2WKQA 4I2VA 4MGIR 4G4SP 2BI4A 4OA8A 4Z7JA 2Q1YA 3KOOA 3WL7A 1U11A 1YQEA 3WFJA 5EXTA 1U7WA 3V8EA 4AM8A 2HLPA 5DCLA 3JYQA 1TIPA 2OHGA 2B2CA 2WA1A 4OMFG 4IDNA 2QR5A 4XWGA 1TJ3A 3UYKA 3UIEA 2I6UA 3J81k 5IUNC 1IONA 1T9CA 1ZJWA 3EY9A 4F21A 5G2OA 5IZ4A 3SNKA 3N1UA 1OKKD 3KJFA 4G26A 1Y8QA 4DMRA 2WC1A 3INNA 4RKEA 1PR0A 3OPNA 4CG2A 2W6NA 1R0YA 4CETA 3VUEA 1NT4A 4LV5B 2P5TB 2IDZA 3TAHA 4HFRA 4ED9A 3WKAA 3QVGA 2VOEA 3CKKA 3HY6A 4C01A 2VF2A 1JFLA 1OI4A 4FOOA 4NESA 2PMBA 3P0IA 5LZ8A 3Q9UA 3HYNA 3P2OA 1FDSA 2HU8A 3DHYA 3S55A 1O1YA 2QZ9A 1AGRA 4YAWA 1D6SA 3JPYA 3P2MA 3LUGA 4K6OA 1Y3AA 4FHZA 5ALJA 2R7NA 1QOQB 2JGLA 3FUUA 4IQFA 1UR5A 5ICCA 2XOEA 1UK7A 3COZA 3UXEA 3AKDA 1XN4A 3ZHRA 4OJYA 3AI2A 2FWJA 4W4TA 2XQVA 4PYRA 2AXQA 5H82A 3Q8XB 5ADHA 1U5BB 1IVSA 1O6CA 1O6GA 4EJSA 4PS0A 4RJKA 5KMGB 5GINE 1WNFA 1ZGHA 4QGSA 3WRYA 4IDCA 2QN6A 3KT6A 3ILSA 1XVLA 3T9BA 4AUMA 4EA9A 5JCOC 4M1YA 1DCMA 1DG1G 2QAGC 3G5MA 3KSZO 4J2TA 4OXYA 3ZCQA 1NURA 3KAPA 2VNIA 2ZWOA 4NFLA 3BMNB 3B1JA 2C5SA 3NLLA 3HO1A 4JYCA 1A1SA 4KR3A 5DE3A 1DAFA 3H2KA 3VTZA 4UFOA 3MG9A 1J99A 2JFVA 4AC9A 1A04A 1DG9A 3AJ9A 4LZJA 2XKKA 4NKRA 4EUFA 5K9ZA 4UCQA 4OI0A 1CQXA 2OWEA 2Y1OA 3TLJA 4XR4A 1JB9A 2WJPA 1LH0A 4OUKX 4QYIB 5EKTA 2Z56A 5IJ9B 1JKFA 2NAPA 1EK1A 4XGNA 3W05A 1KO8A 5EIBD 1U9ZA 1P5HA 2XHEA 1E6CA 3QUTA 4PLVA 4CKXA 5CTAA 3EWAA 2CLSA 2V97A 5GJCA 1CU1A 3RTBA 1LJ8A 4O4HF 4IJUA 4Y1GA 6ADHA 2W90A 4ZT6A 3CEPB 5IVHA 5IEBA 5HHTA 3PA6A 2V5VA 4JLVA 3UNXA 5JSFA 1X87A 2GAJA 3NBKA 3I12A 1TGYA 1SBCA 2BFDA 1US8A 3ADKA 3Q8WA 2QUJA 1RPJA 4KVAA 3SHOA 2VHEA 3X44A 5JPCA 1S1MA 1U0BB 2GCGA 2FG5A 2MMCA 4L2IA 3WLQA 3ZVRA 1O3YA 2DQKA 1LPMA 5JC8A 3TCXB 2WAMA 5F73A 1PYGA 2O5VA 2MHCA 3FW1A 3JARB 3SNHA 4WZAE 4NY1A 3HN7A 1H65A 3KFVA 4JJ6A 3C85A 4LHVA 3HKCA 3T3IA 1UOOA 1NBHA 2X1LA 3BMOB 4EA8A 4EL5A 1PQPA 4YMIA 2RK6A 3RJ9A 1ZRHA 1IMJA 1E89A 1MXFA 2Y1WA 1H6BA 1LZLA 2WD8A 5CT6A 1EXDA 3C6XA 1XO1A 4RVOA 1H8EA 2ZTLA 3CLKA 3QG1A 1SCUB 1G42A 1YE8A 2OO5A 1KFJB 2VBIA 4MVJF 4N49A 4DAOA 3FX2A 1D2HA 2C1XA 2W8BB 4FYXA 3AI3A 2GEDA 1F0NA 3NYRA 1B41A 1TCAA 2PK3A 4L6CA 4CZ2A 2QPLA 3H7IA 4J3NA 5JQGA 2O3TA 2Q9BA 3NWJA 2CV2A 4HXGA 5EJ4A 3SE0A 3VVLA 4J0FA 4N40A 2BT4A 1DIBA 3PPYA 1USGA 2O8NA 4G1VA 1Y81A 2I7XA 3ZD6A 2ATVA 1EVYA 5EKUA 5C46F 3L8YA 5JO9A 2CE2X 3LM8A 1EFDN 1Z0AA 3CF2A 3CWZA 2XCLA 2HUPA 3DAPA 3K32A 3L1UA 4P31A 4Y1RB 5FV7A 1UBTS 3MJSA 2PMDA 3NX4A 4PXYA 1UUFA 4ZOEA 3V6LA 4AJLA 3C5HA 3KKEA 1IBRA 2GRJA 5GM1A 2VYQA 3QXSA 1DRUA 4YONB 4D43A 4KH1A 3PT9A 4NS4A 3DP9A 2ODEA 4Y2GA 1D4OA 2P41A 3RNOA 1U9CA 4R8VA 5E1MA 2GSDA 3KXLA 1MX9A 3ZU4A 2H5LA 4AMVA 3HQ4O 2C04A 3JALB 3N3BC 4X44A 3VOBA 4EUNA 4HBGA 1LZKA 3WIOA 2YOFA 3D9QX 3TCKA 3W8NA 1UQRA 3NORA 4ZI2A 4EABA 1HFKA 1R2QA 3HJHA 1KARA 3FNHA 1B0PA 2JHFA 2OMEA 3DEFA 3FTDA 2Q45A 3PU6A 4OD0A 5ALWA 4ZC1A 3TKAA 3OQHA 4G5RA 3UV6A 1SOVA 2HU5A 3VYUB 2PGDA 1G5IA 3KKLA 2M1XA 3RVLA 2ORVA 1N36B 2SICE 4HPWA 2Q2WA 2YIDA 3GJTA 3OD1A 3OESA 4KTVE 4R54A 4YJGB 5T4HA 4EHAA 4EITA 5KYXA 1ORIA 3KS9A 3WL6A 2OESA 5D01A 4KFSA 3CWQA 4MR8B 3G89A 2Q3MA 2EGGA 2ZVJA 4NECA 5E9QA 1CY1A 2FEMA 4X1KA 2WE7A 2VHZA 3K73O 3NKFA 3MFQA 3SZMA 4YUZA 1P2SA 3E15A 3P2JA 3W77A 4PPQA 3LZCA 2LKDA 5BSRA 2Y0DA 3JQGA 4FCWA 2Y76A 1PWHA 3W1WA 3T3OA 1AQLA 3EG9A 3TO5A 5JD5A 1O8CA 2VT7A 4IXMA 2G88A 4QJ5A 4YIKA 2F3QA 2VDQB 3NYQA 5DNDA 5CFZA 1R8XA 2YW9A 2QM7A 3DLHA 2WNSA 2C95A 3B5JA 3U48A 5FD8A 1EB9A 4NBKA 4IHQA 4NF2A 2NSDA 3WMRA 3ZQ6A 1STOA 1OPXA 3HUFA 1QAOA 3R76A 4IGAA 1GQ2A 1KH2A 3V4PB 4EPXA 2IOFK 4UC0A 1J1IA 1AH2A 2GQ0A 1EHIA 1KDTA 2QTAA 2XB4A 1SKBA 2WIFA 3E4DA 3QE4A 2X8LA 5D3QA 3O2JA 2JAWA 1YMVA 4ZCQA 4F38A 1TFRA 3IUBA 5GAJA 2PGAA 1K8RA 1EQ2A 1ODFA 2C54A 2DUWA 2QSUA 3D3WB 4D42A 3THYA 1R6TA 5LL6P 2Z58A 1OZHA 4GP9A 4K46A 4HDAA 2ID4A 2XCSB 1Y4DE 1MB0A 1BQ4A 1HRDA 2ZYGA 3BXXA 4QOGA 5E6UB 5EZ6B 1MIOA 1N1EA 2H7CA 2J85A 3FPCA 4M88A 5K3CA 3V8VA 1I4WA 1Y6FA 3OTWA 3DE1X 3ILXA 3CEJA 2B37A 1SUPA 3O8CA 3H1PA 3RVNA 3ZVKA 1ZM7A 4Q0MA 2SKCA 4XARA 1FC0A 3LY7A 1NA5A 3Q3HA 4MUBA 1HMYA 3U16A 2PH1A 3FA2A 2V7TA 1H4QA 3O31A 1GSIA 5CNIA 4BEJA 1PEKE 4Q3DA 1NATA 1RHJA 1K08A 3RTGA 1J2TA 1CUZA 2EWWA 3P9XA 3RBVA 2BAGA 3IBSA 3LC2O 2NUTA 3NI2A 4OIFA 4AS2A 4FKZA 5KX5B 1YZKA 3RU7A 2ZJ6A 4JYMA 3UBMA 3VH4A 1D4FA 1RMQA 2DJ5A 2C4WA 2EZUA 2HCBA 3G5UA 2WIJA 5JWRA 4DLSA 3QX3A 3SG0A 4IIGA 3EWIA 4A8JA 1HYBA 2XXAB 1M1ZA 1E2GA 2ZRJA 3FNBA 3OWXA 3PQCA 4G0OA 5JH7F 5A5EA 4KMMA 4HLDA 4C7VA 1PKEA 1MX1A 1VA4A 2HDWA 221PA 1Z75A 3BC1A 3P9SA 3QXGA 4JP3A 3SYNA 3RC8A 2I2BA 1IVYA 1OX6A 2O7SA 3DL7A 4CR7A 4IQ8A 4TZ6A 2QPOA 2FPPB 3MS2A 2HA5A 4K9PA 4KSYA 1XWWA 3IRVA 4MUYA 4X3OA 4BO8A 4F2PA 4QAQA 4XYMA 4AD8A 2C2BA 2NIPA 1WW3A 3EF3A 3KJXA 3PLNA 5EMJA 1N5IA 2OQIA 5F4BA 2NYUA 1TAUA 1AKNA 1H3FA 1J49A 3WHPA 1B6SA 3KR2A 3HHPA 4XIYA 2I62A 3LAWA 5FHQA 5JJKA 3OU6A 1U6JA 4WLVA 2FZEA 2B82A 2IY7A 1MBZA 4JB0A 1OFVA 2X19A 2Q4EA 4NCIA 4NYIR 3ICVA 2X0DA 5CD9A 3VH1A 1YZVA 2Q41A 1AZSC 2I6XA 3GJ8A 3N05A 4ND7A 3TX6A 1D2CA 3WLJA 2F8LA 2JGMA 3FWYA 5IKPA 5B1YA 2YXDA 1ZK2A 4HDCA 4PHTA 4RD0A 2FTKE 5G0WA 3MGBA 3FNQA 1L3BA 3A70A 3WLLA 4IMPA 2DHEA 5D6OA 3GMDA 4ZV7A 1K4YA 5EXSA 3RIXA 4X66B 3FYUB 4MHTA 1U65A 4CRWB 1YUMA 1TQ8A 1ZM3A 5FTKA 1DARA 4BE7B 2E1RA 5BQ3A 1E7MA 3JARA 4Q4HB 4DSZA 2HSEA 2A30A 4CV1A 5C32A 1LBHA 4EL0A 4MUKA 5EJ2A 4Q1VA 1K3FA 1XDWA 3GH3A 2JIZA 5AOBA 1GPKA 2E4VA 1ECJA 4WLNA 1P1JA 3NANA 2ZUSA 4HXYA 3AV3A 2ZYIA 3LI2A 5AK4A 4FJ1A 4Y2JA 3K92A 1VYHA 2JGKA 4P92A 2HWYA 4GUAA 5KYGA 3LFTA 2PAFA 4G41A 2IDJA 4P7KA 9MHTA 1Y4AE 4C22A 4IV0A 5G0UA 2HB6A 1GAXA 4LK3A 5C34B 2WINI 3HL4A 4N65A 2PSDA 1AV6A 1IK4A 4P3NA 3MYRA 2XWBF 4GBED 4MYUA 3BIWA 4R8SA 3ZXUB 1HZZA 3ILHA 1NSYA 3RHFA 1P72A 1MO5A 2I2AA 3C3EA 3HLKA 3U7JA 1PR6A 4ARVA 3H5TA 4KSCA 3WSWA 4D9BA 1G3MA 2EKZA 1NVWQ 4CJXA 4DYDA 2BR3A 1Z7EA 1FUIA 3U7RA 5H81A 4C3UA 5I45A 1RC8A 4QDJA 3I5UA 2PU5A 5HBGA 2VYND 2Z2JA 1RAEA 1K9SA 3AESB 4G9GA 2HHJA 1B76A 1CX9B 4NMMA 3SR3A 4CMGA 4LRWA 4RGQA 3HEMA 2RGXA 1KY3A 1I3LA 1O5TA 2QJRA 2X2EA 1TC1A 1LXCA 3HR8A 1E59A 3OU7A 3HSKA 4X24A 621PA 5JUWA 3NHWA 4Q21A 2ZIUB 1IJKA 5B7NA 5KSZA 2A9JA 5DN6A 4F5EA 4ZK2A 1D2AA 4ALIA 3RSOA 4M36A 4HJRA 5DM2A 2MSNA 3B51X 3MA0A 3RYTC 3U81A 3UPUA 1LLQA 3PEYA 4MV5A 2W11A 3PX2A 5I9TA 5ALVA 1NP7A 3CRQA 3JQFC 4RO0A 4YRQA 4TKMA 4AIRA 2G72A 2GXSA 3ENQA 3H86A 2UZ1B 3LOPA 1M74A 3QVOA 1Y98A 3C1TA 5ECDA 4A91A 5JWOA 3RBXA 3HVRA 4YXWD 1Z37A 1KEZA 3DV9A 1QZUA 2M6KA 2P7IA 5FR2A 3RS4A 1NRXA 2VK8A 4ZP1A 2ZE6A 2GJ8A 3SSNA 3A28A 5IUKC 2WYOA 3GLHA 3FNGA 1UWKA 1RWBA 1HMPA 3O0TA 3QLUC 2E0IA 3DEHA 2K2WA 2FETA 4KLZA 2G5TA 2JIBA 2M9MA 3DONA 1EAMA 3AHCA 4ZICA 1RRVA 2GVDC 1YTLA 2J4CA 3FOBA 3QF4B 5A5DA 3CQ9A 1JEQA 3KT0A 3ZS9A 3K09C 4KUHA 1OFTA 3FBGA 3FKSA 2B69A 4LZZA 4IDPA 3P5BA 1I80A 2D74A 3TZCA 1Y1RA 5LZ9A 4ZQIA 4Z53A 1Y8QB 3UMYA 3LRXA 2FN3A 3NIWA 4H9GA 4CQLB 2XYQA 1SEVA 3BFJA 1L5SA 3REQB 3QITA 5H16A 5IM4F 4Q5IA 1G1AA 2D0IA 3JYLA 3AWIA 3P1JA 1XAHA 2ZGVA 3ISTA 4JLBA 2NNLD 3RUPA 3HEAA 4YAOA 4KFTA 3T5AA 1QYDA 1RWNA 3OQVA 4YP7A 4FN5A 4B6QA 4RHFA 3B70A 1GGHA 16PKA 1G5HA 3TIGA 1UINA 2MSWA 5FADA 1M1UA 5DWVA 4NOJA 5DISB 3DCIA 1Q1AA 3HS3A 3A6LA 2QNBA 4OF4A 1NYLA 3AOEA 3MWDB 1U02A 3TLMA 4NXMB 5JJLA 1QIGA 4IOJA 5TF0A 3VNQA 8GPBA 1DJQA 3FCUB 2XB2A 3BDIA 3D1JA 5LA6B 2XZPA 4KQCA 4V3CA 5EJ5A 2WDPA 1CVLA 1KXZA 1RBYA 4P4GA 4UDOA 1L1RA 2A1UA 3OD5A 2P3OA 2X5OA 3E8SA 2E37A 4U2FA 3OIVA 2YWGA 1V9SA 1RCUA 1L7EA 2GM4A 3UCFA 3L6BA 1OLUA 4MINA 5L6LB 4UHKA 5BQXA 2C4VA 3BGDA 3ZIAD 3GAFA 3NTVA 2XCIA 2Z43A 3WIEA 1CCWA 5C8XA 4L0DA 2OG2A 4BMNA 2E7ZA 3CZ9A 1SXJB 1F60A 4C2TA 1VIAA 3F67A 4F9TA 3A6PC 3D5TA 3OM1A 1SC3A 5JZBA 2FE4A 3OMLA 4JVNA 2XUKA 3CNOA 4ZKEA 2VAMA 4RHUA 1CJUC 3MPUA 2PZBA 5CVJA 1KI4A 2C29D 1VSTA 4JLKA 3WVNA 5K0FA 2YS7A 3GT7A 5B3AA 2UVQA 1TU4A 1DUSA 3DG9A 1Z4MA 3EASA 2PBFA 1JHDA 1GSHA 1XALA 2R00A 2RC5A 1TYEB 1Y33E 2PJZA 5HXAA 1DAOA 3GIWA 3OIDA 1WPRA 1QZXA 3HVUA 4FLEA 1UP7A 4QQRA 1YA6A 4Z7NB 2HI0A 4FCTA 1U3UA 4PG7A 1BMTA 2CXNA 3PPXA 3RVQA 3AT1A 3IALA 2EKQA 2X15A 3JQBA 4F2HA 4A9AA 1ZFNA 1PT7A 4HYEA 3TLCA 3ZHOA 1C9DB 4CLEA 3ZVMA 4G0UA 4HSEA 3HBAA 2H29A 1IBKB 4JY7A 3BG5A 4PC3A 1ZMOA 4ZRDA 1GADO 1S2IA 2VFAA 3R40A 4R2WA 3D3EA 1W34A 1QBGA 3A1CA 1ZG3A 3CZQA 5EZYB 3ZY4A 3P2YA 4BO0A 3AU9A 4ECAA 3PGMA 2HRBA 1YZUA 1ZY2A 2HWXA 3LCMA 4JUBA 3TIIA 1IXZA 1ODJA 4TLAA 5ILGA 2CNNA 3L0IB 4DVJA 3JRWA 4HN2A 2IUFA 4YP9A 3H3XA 1N2ZA 3KXDA 5DXJA 2G63A 1G0OA 1V8PA 4MI6A 2OCLA 1NC3A 2PGOA 2ZETA 1O58A 3K9GA 3QUQA 4Q1EA 1GGJA 1YNOA 3U17A 3VMFA 2V7WA 3QTLA 3ZE2B 4NPAA 5AP9A 4BE4A 2PRYA 4EELA 1X0VA 1T0PA 3T7SA 2AOUB 4S3MA 4V0ME 2QUHA 3ZDEA 2HU2A 1WV0A 1V4VA 1NVKA 2ZUVA 1JKMA 2QN3A 3WDMA 3AX6A 4TM8A 2QW1A 3ZWPA 2H2WA 3EZFA 1SA0B 4RDCA 5EE9A 2BZ0A 2XE8A 2VK4A 3KAJA 1K6EA 1S3IA 1XCBA 1XPRA 3BIJA 2QJOA 1F4VA 1Z6AA 3ZN2A 4WKCA 4DC0A 2BKXA 1CFZA 1ZI8A 2OQ2A 3UGJA 2XB9A 3E03A 4NOKA 4TWAA 1TUBA 3ZU5A 4ZVLA 3ZJYA 4RPHA 2CHUA 3ZWBA 3G2QA 1YHZA 2PRJA 5M5BA 3PFHA 3OVMA 1V3UA 4HWKA 3PRJA 1YULA 2FU5C 1VCNA 5IDYA 3LK7A 4Y67A 1FU4A 4EPTA 2YRWA 4JJAA 4EMSA 2R9VA 5AW2A 1GNVA 1IB6A 2DP4E 4OJKA 4C6HA 5IKMA 2JH9A 3G82C 1VSUA 3UJCA 1GYPA 1G63A 4RTKA 1Z5WA 1E1YA 2JFFA 2JA1A 2YYZA 5ETJA 4JEHA 4KNWA 2EFDB 2ZJ8A 3TE6A 4YJGA 1R9GA 4C07A 2RONA 3AUJB 4DJFC 3M81A 3NDBB 2ZAMA 1V7ZA 5K6AC 3UANA 3O4JA 3VOSA 4HQ0A 3EYWA 1AZTA 4TKZA 3X2EA 2IZZA 4KR2A 3PDUA 3QELB 4ZU1X 4AJEA 1SBHA 4I5FA 4LYYA 3TD6A 1OH6A 3A4MA 1Z3CA 4P93A 2JARA 1EXMA 2ZBPA 2PGNA 2BLLA 1WD7A 2FSUA 2N3ZA 3IV7A 4KQXA 3ZHQA 1XVAA 5JDCC 1CUUA 4X85A 4R1QA 4CEHA 1E5LA 3N8HA 3ID6C 3X1MA 1NASA 1R6DA 2VF5X 3S2ZA 5KYYA 2DFNA 1NMYA 3Q9NA 4QOIA 1YFZA 1R9NA 2QD4A 5J2TB 5I8ZA 1XDUA 4LGYA 4JL6A 3EMVA 2XGMA 1RTTA 3N2KB 5TIIA 1U7OA 1H2BA 3RK0A 1JWLA 1SCAA 3D3JA 4KXVA 5KWVA 1UFVA 3NYWA 5JS1A 4BO4A 1CWUA 2QAJA 2R4TA 3AI1A 3LUKA 4JWTA 5BR4A 4HDSB 1ULAA 4DMCA 3I83A 4FEAA 1JPUA 4MKZA 2A5LA 3RSZA 4CM9D 4C0QC 3E61A 1BMDA 4WBNA 1GTSA 1WXXA 4PNZA 2AOVA 4OXKA 2O52A 3ZQJA 2C3MA 4QUEA 3CMCO 1VG1A 2W9XA 4HUQB 3A4NA 5IVPA 1D1TA 2PGXA 3ISJA 3Q7IA 4W1QA 4LJRA 1D5CA 1P7ZA 2ZSIA 3ESYA 3H4IA 2NO7A 3KQWA 3OICA 5DFAA 2QJTA 2ORWA 1SCUA 1TO2E 4JR1A 5BW6B 3DKVA 2AL7A 2BKVA 2ZRFA 2HEGA 1M1YE 2H17A 4TYMA 2R48A 3B1VA 1DKMA 4HQ6A 3EXAA 1VRCA 1AUVA 3R0IA 5IJZA 4YALA 3X1KA 3ELBA 2GN6A 3IAM1 1U2TA 3W3ZB 4K28A 1U7PA 1RLJA 5DHRA 5F1KA 4IUDS 4CQMB 5HCUA 4E94A 1KTIA 2VG8A 1JE1A 2PX2A 3WBFA 5JYBA 3VNVA 4MWOA 2AXEA 3F5QA 4LS3A 4QM6A 3T5MA 2GETA 4R1OA 1RC0A 1YJXA 1XD2A 1QE0A 2YXNA 3OEEA 3BFXA 4RIGA 2IXBA 2Q7XA 1FY2A 1B6TA 3F6PA 3OA2A 4GO1A 2X13A 5B6JA 5F35A 3OTGA 2JJ8A 2FA9A 1PNOA 2WVAA 4OREX 1ZMRA 5FWXA 5AKZA 5J59A 2AX4A 1YH3A 4MYSA 1KXJA 1FNCA 1SUWA 1J6UA 1T8WA 3T38A 5C35A 1HLPA 3BICA 3F2IA 3A37A 4LDNA 4PO8A 5C7IO 2AG0A 2NO5A 5LU8A 4FFDA 2CSUA 5GQSA 1RQPA 4IDFA 4TSKA 4MVJP 5A5FA 3DL2A 3P4XA 2YFQA 1I3KA 1WAMA 1TE2A 4QOEA 5T6MA 4YLEA 3KXIA 2IZ1A 4IO1A 4QUDA 3AUTA 2XGJA 1S6YA 1NW8A 2F1HA 4U2EA 2PKQP 4EI7A 1T24A 1M1NA 1S8FA 1WSDA 3O94A 4HH4A 4TTTS 1H9CA 1VSVA 1ECCA 1NN1A 2WA2A 1YL6A 3TIXB 2Y1FA 4FT2A 1YMQA 1Z2NX 3U37A 5EMMA 1DBIA 4E7OA 2PNJA 1UXJA 4LXTA 3NC4A 4NNPA 3GJ0A 4AQ7A 4KJZA 2DCUA 3MMSA 4LVCA 5JVDB 1EG2A 2QT1A 5A9RA 1A4UA 1UZAA 4ZXPA 1GP2A 1RADA 3ND6A 4MXDA 4RTSA 5CEEA 5FWNA 3ESDA 4H7FA 4DARA 1E2QA 2ZI9A 1O6BA 2P1DA 4JT4A 4GH5A 4CQNA 4HEJA 4GBJA 3V3KA 4F3TA 3OJFA 2GKOA 3N6VA 4ZAZA 2CUTA 2B0JA 3PGXA 1WXFA 4WEOA 4LF6B 2OG1A 2MR5A 2JHPA 2YV5A 2FSVA 2VO1A 4GXQA 4UD2A 1HK7A 4JJZA 4NZZA 4PONA 3EIWA 5NLLA 1U3CA 2C2HA 2VI5A 3I6ZA 4CMEA 5AVWA 4Y6PA 4DCPA 1XRPA 3K0SA 3VKGA 2QIPA 3A6DA 3EZ9A 1CB7A 1VKOA 2XXAA 1Z36A 4YQZA 5AOAA 1APBA 5KNCA 1A8QA 3BILA 5EJIA 1K27A 3F71A 4YH1A 5JYEA 1QFJA 1H0HA 1T3HA 3HY3A 5INTA 1VLZA 4GWKA 2ABWA 2HUNA 5DI9A 5K2OA 2R6R1 3H19A 2UUAB 5KVCA 2A9QA 1BMQA 1DO0A 1TTPB 1EJ2A 2JLAA 2RK4A 5C1BA 2QY9A 4Z7OB 2XWSA 1A1VA 2ZR0A 1SOUA 4GZLA 3A6FA 3HO6A 1E1NA 4QBIA 4XIGS 4FEEA 4YQEA 3Q2IA 5JEEA 4WXRA 1A97A 3BQMB 2XNDD 1G55A 1C0KA 2PSHA 3KX2A 4HWOA 4QJBA 5HK9A 5HRUA 2W5UA 4E32A 4PFJA 1T2UA 2J3HA 3IP7A 1I7DA 2VP9A 2FPGA 3D7NA 4K1LA 1KHTA 3N8KA 1N3IA 4CKEA 3BH0A 4J2OA 4N8EA 4UM9B 4WI1A 3S8EA 1HDYA 1QCCA 3GRVA 2I1LA 1NVDA 1SD5A 1PEAA 5F2EA 4D97A 4XWOA 4JN6B 4UVDA 4EZBA 2PR2A 2HBRA 1QSGA 1RYBA 1K0UA 1TZBA 1N7HA 2IY8A 3FHOA 3PJRA 3C8HA 1LS6A 4KAJA 4AQYB 1E7WA 3TK1A 3WJ2A 3IEXA 1CR1A 5LXTB 2J6BA 1IC6A 2E1PA 2JAUA 3C1UA 4OI4A 3ER8A 1SELA 1XI2A 2YZ7A 3PIRA 1SD1A 4MQMA 2J7KA 4JI1B 4PQRA 5C1DA 1JU3A 4IGKA 1AKQA 3JQ9A 4Q3AA 3C7AA 5COQA 5PNTA 1KAEA 4B3FX 3G8BA 3H5AA 4OGWA 1OQAA 1DINA 1TZKA 2PZMA 3W1VA 2BF7A 2JEZA 2WTEA 1CQJB 3AUUA 3GLVA 1WMSA 1DPGA 1ZD8A 5KOHB 3RTEA 2CN1A 1HDXA 1IN6A 1ZW1A 5I4CA 1S2MA 2E4XA 2PVPA 2WEKA