2BMWA

Ferredoxin: nadp+ reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr, leu 263 replaced by pro, arg 264 replaced by pro and gly 265 replaced by pro (t155g-a160t-l263p-r264p-g265p)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGPPPMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP REDUCTASE
publication title Protein Motifs Involved in Coenzyme Interaction and Enzymatic Efficiency in Anabaena Ferredoxin-Nadp+ Reductase.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
total genus 93
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2bmwA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2bmwA02
1W35A 2PMDA 3LVBA 3U6BA 3CC2B 4R71A 3AGQA 4YALA 2CNDA 1EFTA 2HMAA 4ZCLA 1EXMA 2RC6A 2VNHA 1YJ9B 1GR1A 1A8PA 3CPWB 3A1FA 1QGZA 4AF6A 1GVHA 5EMNA 1K8AD 5TR9A 3OZWA 4YHBA 1YHQB 3W5HA 2BM1A 4BPRA 1S0UA 1VQ4B 1EP2B 3JQPA 3FPKA 1U2RA 2J7KA 4C0SA 3CRZA 2QEXB 3ZZTA 1IJFA 3AVVA 1E64A 2PIAA 4YAWA 4WQMA 3W2FA 4P3YA 1JJ2B 4N3NA 1OGIA 4PC2A 1EWYA 5DSZA 1FNDA 2B5OA 3QFCA 3MHPA 1DDIA 3W2IA 3W5VA 1TTTA 1W2BB 3AVYA 1KTVA 3CCEB 5AN9A 1WDTA 3VNUA 2QTLA 3VMFA 1FRQA 1NDHA 1FRNA 4QFMA 1G7RA 4TN1A 2QDXA 1KQSB 3LYUA 1J9ZA 4PGOA 2R6HA 1TUIA 1VQKB 3CCSB 2ZITA 1K9MD 1QFJA 1TVCA 1Q86D 3ZZUA 2VNIA 4Q7JB 1R5NA 1KC8D 4PC7A 2BF4A 1F60A 2EFGA 5JBQA 1OB5A 4NCNA 3CB4A 2C77A 3CC7B 3QE2A 1DARA 4Y9UA 3MMPA 2XNJA 3OJWA 4J0QA 1K73D 4C43A 2BN4A 3QSYA 2PLFA 2GPJA 2B7CA 1AMOA 4LC0A 3AGPA 2VNKA 1JA1A 1KJZA 2YWEA 1BX1A 2BVNA 2XEXA 3JQRA 2XNCA 3J81k 3LO8A 3VO1A 3W2HA 3LRXA 4G1VA 4F7DA 4M1KA 3WNDA 1D8TA 1DG1G 1E62A 4Y7CA 1W87A 3WYAA 1VQNB 3JQQA 4U9UA 5H5JA 2DETA 2QTZA 2DEUA 3OJXA 2FX3A 4YAOA 3G6EB 1N0VC 1VQ6B 4P6VF 1NJID 3MCAA 4RCYA 1KK2A 1I7PA 5HXBA 3CCQB 1JA0A 4RD2A 3E1YE 4B3XA 1N8RD 1IJEA 3ES9A 4FN5A 4PC3A 1D1NA 2OTLB 1UMKA 3ZZ0A 2VYQA 1QGAA 4ACAA 4LBYA 2BMWA 4RCZA 3AVUA 1M1KD 1VQ9B 1JB9A 1EP3B 3VO2A 4RD0A 3CC4B 2BV3A 1CNEA 4RD6A 1YI2B 3G4SB 3ZBTA 3ZC3A 1QFZA 4MYTA 3I56B 1ELOA 1ZM3A 5H59A 4K1XA 3U6KA 4TMTA 4FK8A 4M53A 1N0UA 4YAFA 1KRHA 3OZVA 4ZGQB 3W2GA 3I1FA 1QUEA 4FWTA 3W2EA 4MYUA 3WBJA 4M2LA 3CW2A 1XB2A 1FDRA 1Q81D 3CMEB 3B78A 1FNCA 4IW3B 3B8HA 1YJNB 1VQPB 2DERA 2YWGA 5TV2A 4LBWA 3B82A 4PC6A 1SKQA 2QA4B 1H42A 5FA6A 5GV7A 4DQLA 2DCUA 2QMUA 4ZGNB 1ZM4A 1R5BA 4EH1A 1ZM9A 2OK8A 1EFUA 1AIPA 4RJLA 3E20A 1KK0A 1QG0A 4LBVA 1SM4A 1KK1A 1VQLB 1OB2A 1VQOB 1GAWA 4G1BA 4QHYA 1IB0A 1YJWB 5GV8A 2BGIA 2D74A 1YIJB 3OZUA 3CCMB 4TMVA 2HDNB 2OTJB 3CXCB 1BX0A 3AVTA 1VQ7B 4NBSA 1B23P 3AVXA 4RD3A 4ZCIA 4B47A 3CCVB 4TMWA 3WXMA 4RD4A 1VQ8B 3WY9A 3P27A 4RD1A 1QH0A 1B2RA 3CMAB 2BSAA 2OK7A 4ACBA 1GJRA 1BJKA 3P26A 3CCUB 2QN6A 4TMZA 4B43A 4ZV4A 1H85A 1FNBA 4TMXA 4B4DA 3CCJB 1FNMA 4HE6A 3W5UA 3FJOA 1JNYA 3QFRA 3G71B 1ZM2A 2E1RA 5KSWB 2B7BA 1QVFB 3ZBUA 3V76A 5TY0A 1QVGB 3QFSA 1G7CA 4AF7A 2DY1A 2NPFA 1CNFA 3SJZA 2X3UA 1YITB 4UAJA 3I55B 3PENA 1M90D 1DDGA 4G5GA 5THXA 4H9GA 1D2EA 3QFTA 2C78A 4N3GA 1W34A 1ZUNB 4HE5A 2EIXA 2YWHA 1E63A 1QX4A 2CRVA 1BQEA 1QUFA 2AHOA 4AC9A 2VZLA 1KK3A 1QFYA 1R5OA 1XE1A 1F20A 3CCRB 1Q7YD 1EFCA 2GQFA 1CQXA 1TLLA 4Y9RA 3AVWA 1HA3A 1S72B 2VNJA 3U2QA 1QGYA 1KD1D 3CD6B 2YWFA 2BGJA 4B48A 4B44A 4YAUA 3CCLB 1VQMB 3OW2B 4M4SA 3WNBA 4DQKA 1OGJA 1VQ5B 3WBKA 1EP1B 2RC5A 2BM0A 4ZCMA 4M0LA 3WNCA 2BPOA 1G7SA 1G7TA 1Q82D 1GAQA 2HCJB 1GO2A 4PC1A 3VNVA 4LBZA
chains in the Genus database with same CATH superfamily
1JHZA 1QV6A 2Y1LA 3AX6A 5K2OA 4X1OA 3VHQA 3AGQA 5CDFA 2FOLA 2IITA 3F4KA 3KXLA 2I3DA 2GKOA 5G2OA 4WX2B 3NH9A 4QDTA 3OTWA 1L5KA 2QTFA 3A37A 1RI5A 1Y5RA 1ZN2A 10MHA 1HVXA 4EGJA 3MUEA 2GDZA 4DUZB 4PZUA 3W9BA 3EGXA 3H8VA 3Q1LA 2UYGA 4X93A 3C3XA 2ONKA 3I1JA 5JS6A 2R8OA 1M6NA 3SYRA 3NH6A 4QYWA 1GUAA 2OV6A 5TVGA 1NRKA 4RAQA 4X8IA 4JXKA 4UEJA 1GDTA 4AF6A 2VDVE 3R5JA 1E2KA 1QLHA 2F3UA 3E3LA 4ND4A 1V5EA 2CNKA 5LLSA 4TUYA 3TNFA 2GNAA 2QIPA 1B6TA 1BOOA 2QT1A 4U2FA 4F91B 3FGZA 5EINA 1S3IA 1QCZA 1UMCA 1I5RA 1F6BA 2NZ8A 2AKAB 4DAOA 1FQWA 4Q3EA 5CDUA 3HK2A 2A5GA 2UZIR 3PS9A 2EQ5A 4JI6B 2RDMA 5ERYA 4DMHA 1TUGA 2J7KA 4PPYA 4BASA 1HNNA 1P91A 5ECDA 4YUAA 2I78A 2D2VA 4C0SA 4CPDA 3PI6A 3EGXB 1KS2A 4X95A 4LWZA 4B2LA 4JT9A 4WH0A 1SU7A 2FUCA 1G3IA 1NP3A 2I2XB 4FHFA 4TX1A 4GZ3A 4X61A 3ROKA 4V2IA 3PLAE 1U8UA 1I1HA 2VK1A 4FFBB 4HG2A 4DNXA 1OIWA 2EJVA 4CUJA 1IZ0A 1QP4A 4WWHA 5JSHA 1CS0A 5M34A 4JXZA 2NO9A 2P7HA 3CTMA 2DTXA 2PKXA 4P5EA 4NK5A 2ZWVA 5AUPB 1LV8A 3QEBZ 4WTOA 1DO8A 4JBWA 5T5QA 1J49A 3WKBA 2HHHB 1HV8A 3I0MA 1KSGA 5JD4A 3DAOA 3GLIA 1GAXA 3RD5A 4YJFA 4IHQA 3DBLB 1UBEA 2V9PA 3Q0EA 3E22B 5BXYA 2PL1A 2PV7A 3HDTA 1NPTO 3DWIA 4RYLA 2BDEA 3T3DA 4ZJPA 3GA5A 4BKQA 5CYPA 1YZTA 3PWKA 5CNKA 2RG7A 4K46A 3VMFA 1YZYA 2P4UA 3VUEA 4NTZA 2WTBA 4E1BA 1J1ZA 1JSRA 3B7PA 3RIYA 1T36A 2WD8A 2JVIA 2GJ4A 1IHXA 5F4JA 4IV0A 2XH8A 1WLSA 1WOYA 4LMRA 4NZPA 2WJGA 3M1AA 4XVRA 5BY2A 4TZ0A 3AP1A 2Q41A 2IYVA 2EEPA 3PGLA 4BO8A 3CR8A 3LE8A 4NCIA 1QH1A 4Y2TA 2JCXA 4LI0A 8MHTA 1WMAA 2WIAA 4LVNA 1AGXA 4MRPA 4NYJR 2YWCA 5AJWA 4B2YA 2OKGA 4K9OA 2A35A 3P4YA 3NHRA 1AQUA 2ZXIA 4OATA 1V0JA 2FWIA 2HNBA 1DKUA 2F8MA 3L92A 5KI6A 1U7UA 1RHJA 4GYYA 2J7PD 1ABFA 4OMUA 1PYGA 1Y9EA 1W6UA 2G8NA 2RI1A 4U2CA 5E7QA 1XFDA 1DG9A 5SV2A 3DCJA 2QJTA 2VSFA 4ZAVA 3GCXA 1LA2A 1NA5A 1OIVA 1WMBA 3KT6A 4OL9A 4RK7A 4U7DA 1O96A 3I6ZA 2W6IA 2OAP1 5ALJA 2P6OA 1MHTA 2X6WA 1AQ6A 1SVUA 3L4BC 2ZJAA 3UICA 3HJAA 1G2QA 2OCGA 1PKEA 2ONZA 2QTRA 4Y2UA 5EIOA 2IH2A 4CEHB 3L6EA 1FB5A 4IM7A 3ESZA 3UBTA 4KLCA 5HIMA 2V6MA 4ZP1A 4ZAYA 4BO9A 4YTEA 1AK2A 1UD2A 1UM9A 1WVIA 1GA6A 2R86A 2P6MA 2XCQA 1BXZA 3NHZA 3WGTA 5IAAA 1K73D 4CG0A 5T67A 4KUGA 3U0BA 3LW7A 3LW8A 2IY8A 2VPQA 3QSYA 2AJTA 1NXXA 5EJFA 5ADUS 3FPPA 1L8XA 3WGUA 3A26A 1TJPB 3DL4A 3OLQA 4MYDA 4YGXB 3UJPA 3DQZA 2X5OA 4ASUD 4ZT2A 1GPYA 2OBXA 2X58A 2RJ3A 2AG8A 3B3QA 3N2KA 1E9CA 1J0AA 1E94E 4Q16A 1CY7A 5L4NA 4IMIB 3EGDB 1EU1A 2D8AA 2IYNA 4IINA 2O54A 3J81k 4U0JA 4A2CA 4DMFA 1Z06A 1K4YA 4AKGA 3KEOA 4EYGA 2PXCA 1VCIA 3CURA 3QEMA 4LEIA 4UHBA 5ALNA 3RK0A 4AJ9A 3WRYA 1OLUB 3L0PA 1VCHA 1V1JA 3DQQA 3I28A 4HNAB 7MDHA 2AMFA 4O02B 5I6DA 3C3BA 4ZCPA 1YIDA 2J4CA 4YHHB 2L82A 1ONPA 3F3YA 2H4HA 2BTQB 3IPYA 4GS5A 1N1GA 1M2EA 2XVYA 4RTJA 4JJ4A 5ALSA 3JQQA 1MRNA 3C3MA 4IGAA 1QPGA 3INYA 3G8DA 2QN2A 1UODA 3DCNA 3H5LA 3PV0A 5FBQB 3RWBA 2V59A 4AZ0B 2JJ1A 4QE3A 4WK0B 1C9YA 2OR3A 4IHJA 4D8TA 2CKDA 5JY6A 4MJ3A 4B75A 3JQ8A 3AFNA 4QDOA 2G6TA 4K2AA 4QWMA 2B4TO 1G5TA 4GZLA 1KPIA 5HM8A 2IIVA 4ZZ0A 2GFHA 1BJTA 2F9MA 2P1ZA 3C39A 4OOXA 3IQEA 3PUWA 3U9LA 3A1EA 3FNFA 3UK7A 3VR5D 2KJQA 1XVIA 3W0LB 1HQDA 5KYTA 2ZB3A 2JJQA 3SLGA 4WCDA 1XXHB 4HN4B 5A3JA 4KOEC 4FMCF 3NBAA 1N8RD 3ES9A 3LUDA 3KR1A 4MYSA 2I8CA 3KZOA 1JR4A 3N0RA 3NHPA 1E89A 4BP8A 3HRHA 3L6RA 1XOIA 2BIFA 3KM0A 5HZAA 4JQSA 1BEZA 1FTWA 1YOVA 4YI5A 5FADA 4ZDJA 1DPGA 2GHTA 4KDEA 4F4FA 4DCNA 4JA2A 4COKA 2C9ZA 4LBYA 1KZGB 3EYWA 1MAUA 3V6LA 1VPWA 1PGQA 2O2HA 3FRIA 1V11A 1EQUA 1M6VB 1WXXA 3VO2A 2RK4A 4CGZA 1NG1A 2EGGA 3R0ZA 1M2HA 1TGYA 2BV3A 2BFEA 3CBQA 3LOQA 4CYMA 1CNEA 1V5FA 3MT9A 1J06A 3ON5A 3B1ZA 1RS0A 1C4WA 2XIQA 4JLKA 5GM2A 3V8NA 4FC7A 3ROFA 4MKFA 5INTA 3Q6MA 5MFZA 1X1RA 5LJIA 2CXUA 1ZP6A 3J81A 3BD6A 4JVLA 2ZAOA 3DB1A 4O2RA 3QE4A 3TSZA 2WV7A 1UDWA 3OPOA 3HADA 3SIPA 4QGFA 4BLOA 3SXJA 4Y6OA 5E7MA 5LZ2A 1A1SA 3EW7A 3IUYA 5IJ0A 2UVPA 3GFPA 4GKJB 1GZVA 1LI5A 3GCDA 3I61A 2WJAA 4A73A 3ND9A 3VPSA 4GUAA 4REOA 4WVFA 1PZNA 3D43A 4NNOA 5LYJB 3QTLA 1YTLA 2WE7A 4TKMA 4ZJUA 3NBZC 1BDBA 3GEGA 3KE9A 1M1ZA 2PUTA 4GVPA 4J9UE 4FJ2A 3WK4A 4BUCA 5EWJB 4R7TA 1YBMA 5A9SB 5KNBH 5H68A 4PAOA 3PEWA 1IRXA 1XZFA 1J20A 1IOWA 1Y9ZA 2V7XA 1DBIA 1KEEB 3TX2A 3ULKA 1G20E 3ASSA 1K28D 1QIFA 1KYVA 4YAGA 3RVRA 3GGCA 4KFCA 3EQ9A 3WE7A 1OOEA 1QONA 2H4YA 3H2ZA 1G55A 3LKDA 3U61B 2JGLA 3X1YA 2ES4A 3RFVA 3WNZA 1OWOA 4TWIA 5BWNA 1QQAA 2F3TA 1G66A 2REBA 5CRIA 1EHIA 3S40A 4ESHA 1M73E 2J9ZB 3V00A 2XD9A 3CXRA 3E81A 5BUSA 4L3OA 2BR5A 4GQIA 4RHXA 3BCSA 4KPEC 2I91A 3ENQA 2XCSB 4N01A 2OE2A 1SHZA 2VG8A 4EH1A 2V7PA 1G8FA 5FOSA 3UTCA 3KQPA 2HB6A 3MWDB 2PBRA 4F9EA 4BFYA 1XZCA 3CTAA 1JDVA 1HOXA 2A1TS 3COVA 4FINA 1A7UA 2NSLA 5J4HA 1C9EA 3G0BA 3HWSA 5EQTA 2ZZNA 3F3SA 1MH1A 2WYUA 2AN4A 3Q10A 1Z5ZA 4ITUA 5FD8A 1EIWA 3KIPA 4Z4UA 1N34B 5C53B 4LBVA 4GX1A 4WCFC 4LZLA 1VHJA 3S4YA 3SQDA 2AMVA 1IIBA 3W5JA 4A8TA 5JDCA 4BLWA 3UAYA 4RORA 1KQNA 3U1VA 4UVEA 1ZLYA 2DBRA 3IOMA 1NVWQ 3F9IA 4LMBA 3DE2X 5CH8A 5CT8A 1Z26A 1L7XA 2P9YA 4KQMA 4PONA 3K0EA 4OYLA 5D51S 5DN6D 1MC1A 4KI0A 1A9XB 5AM5A 3LVQE 3BH4A 2ZXEA 1BRTA 4XL9A 1Y8QB 1ZJJA 2X22A 4J1TC 4EFMA 3D8RA 3NBQA 1YXMA 5UKDA 4QT4A 1YBHA 4NCJA 4RGVA 5J2TF 3WKAA 1GCIA 3OCWA 4BWFB 5I4CA 4Z4GA 4X0CA 2DJ5A 4KR7A 3CXCB 13PKA 1KYIA 3ILHA 3ZTWA 1N8NA 1Q7BA 1UMDB 2NV0A 3VKWA 1RPTA 2X41A 1PTKA 4IRMA 1EB9A 2PL5A 3H1AA 4PVCA 2DULA 1JIUA 4UVGA 3TN7A 2PHZA 2V1UA 4W5NA 3MIZA 4B2PA 4EEXA 2EV9A 3JQAB 3TAHA 5A3QA 1AHIA 3R0XA 3KG2A 2CLMB 4ZVPA 4N5MA 3WSVA 1OI7A 4DWWA 4TMWA 3TIGA 1TMGE 3RPEA 5FR1A 3TR0A 1SQGA 1C5KA 3BGDA 2PX4A 4IF4A 4U7GA 3B1JA 1JDJA 1WPXA 4EHHA 5COBA 1N5JA 2O2GA 3SSAA 4B6GA 3SXUA 3OJEA 4MW4A 1EFHA 4UUAA 3A27A 3ITKA 2PGOA 2WM9B 4MCIA 4QUGA 2C54A 1Y6QA 5DBIA 4QLAA 1E6UA 3RY8A 2R1VA 3A9SA 3EGWA 4EEKA 1IXZA 4ZREA 1H05A 1BJKA 4LK3A 4P98A 4CF6A 1OKKA 1J2TA 3JQ7A 1YS2X 1UZAA 2BGRA 3HP1A 3NYIA 4WZBB 1J4AA 2IL1A 3EK2A 4LDQA 1H85A 4HWTA 2JRCA 5L3QA 4O0LA 3A8IA 1T4GA 1HEIA 5KWIA 1I2CA 4GMXA 2G1PA 3AVOA 4NOLA 4KXNA 2DPYA 1C0PA 1O3YA 2IHZA 4YMTA 1KXJA 3VPCA 5J58A 1SBYA 1JIVA 1T3LA 3Q6QA 5AFSA 3I39X 3EARA 2P41A 2CXQA 3E05A 3IUMA 2IHNA 4QOSA 1KZ9A 1VJCA 2HRDA 1OREA 2P2ZA 2VHUA 2O9JA 3H65A 3K6RA 2X15A 3NR2A 3LCMA 5AJVB 4RDJA 1VPVA 3FROA 2YJGA 3BXZA 1Z6GA 4TKUA 2BOVA 1I4TD 1LS1A 1EE1A 1WAMA 4BKRA 3NDJA 1U3DA 2C5FA 1DKLA 3FCAA 3SVTA 2P2GA 2X42A 2VXCA 1XTVA 3EY9A 1Q21A 3T7IA 3QI2A 1AU9A 4Q1FA 1CNFA 2AG5A 4MQEA 2P3QA 3PFCA 5EY5B 4UAJA 2VCYA 3HVIA 5G41A 3FDZA 3DHYA 1Q92A 5BSYA 3IIMA 2GLXA 4UJ3A 5E2BA 5AHKA 1FJHA 3SZMA 4D8VA 2EP8A 2QB5A 3PNYA 1V7QA 4X1IB 5C4MA 4OCZA 3MAJA 4D3FA 4E5SA 3TW4A 1Q7GA 2Q29A 3VKHA 1CUBA 4H7FA 3OPYB 2AJCA 1IU9A 4K86A 5IJZA 2H2HA 3DJYA 3PD7A 4XI9A 4DWJA 3GLGE 1U1DA 4BATA 4YDQA 3L79A 3TRKA 4B09A 4KYIB 2IUYA 3IIKA 3F6SA 3FNEA 3K8QA 5TQ2A 2VWGA 3DE0X 3KYCA 4KRXA 2X2PA 2JAUA 4IYRA 5FBRB 2XMPA 4BYMA 4PW0A 2OYRA 1YJ5A 1PJQA 3QQPA 5CGZA 3UK0A 4N6GA 5LOVA 5KMGB 2WKSA 1Z7YA 1ODLA 2G1JA 3OOCA 1PYDA 3AF5A 4H4DA 3TLZA 5E4JA 4AP6A 4B87A 4JLMA 5B57C 2XGSA 3ZV4A 1RWNA 3U4AA 4GOND 4DBLE 1Z2AA 1OIXA 2LCIA 2ORVA 5KX5B 4Y9RA 1C2YA 3EPLA 1RLTA 4NXMB 4P2NA 1DOZA 2IIBA 3I32A 3PYLA 5KJ6A 4RELA 3IAXA 4BQPA 2NVUB 3BSSA 3HI4A 3VFDA 2EU8A 5KCMA 3AY7A 5HJEA 3MJDA 1RXEA 4FMPA 5KYYA 4EKIA 4WZAE 2C7RA 4LF5B 3S81A 3OFND 4LUCA 1K6JA 3IR6A 3PQ6A 2UUAB 5CDGA 4FUTA 4PPNA 4B44A 4XQEA 3L0IB 1UP4A 4X65B 3N39C 3QV2A 5G0VA 4RPKA 1KP9A 3NTQA 5HJ5A 5KNLA 2DE0X 4HLNA 1ZIDA 2C5SA 2XCLA 3PNBA 3R0VA 2FZ4A 4MS1A 1OD6A 3TTVA 2ATIA 5KVSA 5KKNB 5TMPA 2J9RA 4B8ZA 3EF1A 3P0HA 5KTNA 4CEHA 2DR0A 1TXGA 3HBNA 5I7EA 3T5AA 4KKXB 1XJCA 3EUAA 1Z68A 1Y1PA 1U0JA 2HA3A 4G5XA 4DEXA 3AL0C 4NIMA 1NQ5A 1JEAA 2BHTA 1OI3A 1SEPA 1IBKB 3PFFA 5JAZA 2Y27A 1FIUA 4W4TA 2X14A 1JBEA 1GV1A 1ZJZA 2EZTA 5T4FA 3K8ZA 1TF5A 4PWYA 1FMTA 3I12A 3HN2A 4MMXB 4MR8B 4N3BA 2XXJA 5DIZA 4AMZA 1W9MA 5B2ZA 4DADA 4E46A 2CNDA 5DNYB 1YFLA 2BHLA 1NU6A 3D2BA 2DIEA 2Y1OA 4XFKA 5FNVA 3AFIA 5AWFC 3QLUC 2YJ6A 4DIBA 1L7RA 4W1PA 3M49A 5MFPA 1LWOA 4FFDA 1UC4B 2Q6TA 3ADCA 4DR5B 2ID4A 2Q1XA 5T4EA 5JZMA 2OFXA 4HFRA 4CR8A 4TS4A 2E5WA 2FLWA 1CIJA 3AI2A 1A76A 5CFOA 3ABQB 3IEPA 4YREA 1S2DA 5K0BA 3QUTA 2FWMX 4BJ1A 2WTNA 4U2EA 5IDVA 2DFNA 4LWOA 3IODA 4PRYA 4OI0A 4EL0A 1Y34E 1WUHS 1N2XA 3M33A 4YYEA 2YWDA 2H1LA 3Q7EA 4JZYA 5BP7A 3IL2A 4UTRA 4XQ9A 5TR9A 2YH2A 2ZT8A 4RLZA 1LD3A 2NU6B 2DR2A 2W98A 3BORA 4XGKA 5TEVA 1E1QA 2Y8EA 4FDAA 4UZSA 4PHHA 2EKQA 4G4JA 3IOYA 3DPIA 2O50A 1ATIA 2DRIA 4D1YA 2WHEA 4FMCB 3GA0A 4JITA 3L6DA 2P27A 1WG8A 3GY0A 2R47A 4YJFB 1ETHA 1Y1SA 1P75A 2WLTA 4B5LA 2FCAA 4C7MA 2FMIA 1OVGA 3F47A 3OY2A 4JMPA 1HMPA 3FFTA 3FYTA 1E18A 3N8HA 4BZWA 2AXEA 2DQ4A 4WN3A 2DF8A 5CCEA 5EHZA 1PNTA 1MZPA 3UVEA 1P2BA 4DLNA 1USKA 2ZR8A 1VG9B 5J23A 5H9VA 1CP2A 1MQ9A 5FQOA 3QPAA 1S2LA 3EEQA 3NAZA 5BPHA 1JLHA 1TT5B 3Q5EA 4AN1A 1AA6A 1KOFA 3CTPA 2ODQA 1FY2A 4TMKA 3RS7A 1T5EA 3C70A 4K9NA 4UNRA 2NXEA 2IH4A 2C7PA 3BB1A 2IPMA 2Q8NA 1H2XA 1ST2A 1PJ6A 3KWJA 4ZVRA 5LP6F 4ZV7A 2Y4OA 1ZSYA 2XUFA 2H92A 2W58A 3GZJA 4GR5A 4IJ5A 4QUBA 3PD0A 3ANSA 3I45A 1KTVA 2Q3MA 1TQ6A 2HIMA 3PDIB 3FI9A 4MTCA 2IY7A 5EKXA 1WDTA 1FSSA 5U1PA 4BEVA 2WSBA 3UH1A 1NX6A 2J5QA 1FRQA 5ICGA 2GETA 3B38A 3B2EA 2HPVA 2IYEA 2Q5OA 4CQJA 2VRNA 3FPJA 4RO0A 2OILA 1YR2A 2ZI3A 2YHUA 3OWXA 3UCEA 4PVDA 1ZWKA 4LW8A 4M1WA 5REQB 4MQ4A 2PLRA 2ZUCA 1QLWA 4KXUA 1NC3A 3PNLA 4LOIA 3L7NA 2OYSA 4Q4DA 4QAJA 4N0MA 4ZGBA 2UXCB 4C20A 5B7GA 3ZDBA 4P7BA 2PR2A 4X20B 1YASA 1J9ZA 1Q0ZA 1QHHA 2BCEA 2CMKA 2SNIE 4O4HB 3C7CB 1G6Q1 5F1KA 3P7MA 4TLCA 4A0GA 1A4RA 1TUIA 1UKVY 3RS3A 4C0XA 1KDPA 3CW9A 4UUQA 3ZCXA 5AP9A 2FQQA 4CR6A 1YQTA 1QIDA 2QQGA 1OZGA 1RVDA 3OWOA 1ENOA 2RAVA 1QVAA 2B4RO 2DHRA 4AJOA 4EGFA 1I33A 3EUFA 3H5RA 4F3CA 4ZFNA 2QEQA 3VQTA 5AVQA 5KVCA 3L07A 1XP8A 4IOKA 3K1ZA 2RGEA 4PTLA 3QU7A 3T1NA 3WLKX 2DYIA 3FVWA 3ZKWB 2PBLA 5EJAA 3WHPA 3CUUA 3FYDA 1N2EA 2EX4A 1WM1A 2QX7A 2TMDA 1CZLA 4FNMA 4AF8A 3D4OA 3GELA 4KQGA 1Y4ZA 3JWGA 4CMHA 1OB5A 4RA9A 3WLQA 4E2FA 2X1HA 1VG0B 4P4TA 5B12A 4CMJA 5JJLA 1KR2A 2X76A 3L8CA 2VZ8A 1B73A 1NBHA 2BMAA 1HI9A 1QU2A 3KLNA 4GEGA 4DLXA 1A8SA 3NE5B 3FXAA 2XKJE 1A5SB 1NFQA 3LU1A 4IDQA 2NSDA 4LY6A 4OUKX 2F3QA 3IHLA 3RH0A 3K0KA 4M1EA 5D1NA 1AJEA 2JB9A 3GJ4A 1SIUA 2PKYX 1JA1A 4KYVA 4O1MA 1FZTA 1ZMRA 2P9ZA 1V1MB 1SXHA 1PJ5A 2FLKA 1O08A 3P4XA 3PPVA 2O14A 2VHCA 3TQQA 1EI9A 2NLOA 3ZCUA 1LGYA 5AH0A 2XI4A 2IEAA 4PXAA 9LDTA 1WCWA 3EXHC 3OOYA 3Q3AA 3A6EA 4BVJA 3T4UA 4EY6A 3RHFA 3ZV7A 3B70A 3OH8A 2GBGA 3MTDA 3PE3A 3GVJA 2W7TA 3QEKA 4RJ2A 3CRNA 4L74A 3OZRA 4BNZA 5B2EA 4WA7A 1ND5A 5KJFA 4L0MA 2HF7A 4YH1A 3M1YA 3GLIE 5FOUA 2MCFA 2H29A 4WLOA 3UZUA 3MINA 1QQTA 2CLEB 4HEHA 4JROA 5K3DA 2JKVA 1X2EA 1CLEA 2DP4E 2XCIA 1KL7A 2AFVA 2G9UA 4LN1A 4PFSA 5D3KA 5EIBD 3W5DA 1BCSA 1SUAA 3NM5A 4JLVA 3T3PB 5EN4A 1SFRA 3EE6A 5IKEA 5JADA 3F98A 5LZ5A 1WCYA 3ZNPA 2Q9AA 4I99A 1GGHA 4RMJA 3QEJA 4LRUA 4L9AA 4KFSA 2P3SA 2PRKA 3S2FA 3T5PA 4NP6A 4KGZA 4LHSA 4TROA 4EB0A 1UJCA 1W8DA 2DWCA 3KX2A 3NAQA 2IY9A 4FZ3A 1KH1A 2EBHX 4N0DA 4MVYA 4O4IF 3E48A 4WY2A 3Q6RA 1RJ9B 4YRKA 2GI4A 1TCCA 4M0MA 4WNYA 4AS2A 1DBPA 3H42B 5KO2A 5KIAA 1O6GA 4W5OA 3ZCTA 1R8XA 1XIVA 3EMDA 3NT2A 3VHRA 4EW3A 4IXNA 4MS3A 4MLDA 3HJNA 1D1NA 1ESEA 3BK2A 3FDXA 4B6QA 2FF5A 3T06B 4BQOA 5L3SA 1G63A 2WVJA 3ZR4B 4R0NA 4TOIA 3A2MA 5EIEA 1SD2A 1EP9A 2VC2B 4OYYA 2PT7A 1GG9A 2HF2A 4UDNA 4UTZA 1BDIA 2YJ4A 4BP9A 5TS2A 1UPXA 3HBFA 5FOWA 1XVUA 2VPYA 3CZMA 3R41A 3SDBA 3VU9A 1IEQA 4QU0A 1M5TA 2X0EA 4LZWA 1A9ZA 3JVUA 4R6XA 4UHDA 4IVRA 3MTGA 3K9GA 3ZCPA 1CR1A 3TIFA 5B4VA 1ZL2A 1TMOA 3FRJA 1V1RA 2QZPA 3FMPB 4LQDA 3RC3A 5C1BA 4UFPA 5KYUA 1EINA 5EKUA 5IDWA 3SZLA 1CUYA 5D5HA 5B1YA 4ZYUA 1ZNQO 5FWYB 1IBSA 4LQCA 2XWBF 3INNA 1U2TA 4AU1A 3N0WA 1GYRA 2AOUA 3BWDD 3JAMA 3WQBA 1ZICA 3TTWA 4QC2A 4OQFA 3GIRA 3OZVA 3VDMA 5AW6A 1IDN1 2G06A 5K1ZA 3EFEA 3K72B 3WLFA 3OLCX 4GI3A 1C0LA 5TJ9A 3SI7A 4OAOA 4KVGA 4EG7A 5A8AA 3U7QA 5J9FA 2PRSA 2NQTA 2RGYA 4RY9A 2XVXA 1P72A 4OHKA 4DV6B 2YFKA 2Q2QA 4JNCA 4MITA 1BA2A 2P5TB 2CC2A 2V6IA 5BRNA 2NV4A 4MW1A 4WECA 2VQSA 1XZJA 2O3TA 1KARA 5IEJA 4R1UA 3OCYA 1RQXA 4ZDWA 1K92A 2O7NA 1U5AA 2IYPA 3I2FA 3MXOA 2IUEA 2DERA 5L45A 1IY2A 4N48A 4Z6KA 3VYSB 1YB6A 3KKKA 1FP4A 3T7JA 4QOEA 1TAHA 1BQ4A 2QX4A 4HLQB 1XJWA 1B41A 1KMCA 2ZS8A 3AYZB 3CR3C 3FWYA 1MX9A 1OY1A 1PZHA 2YQZA 3U3DA 4NRDA 1KEEA 5AQ1A 4P12A 3VM6A 4ZGNB 1JHRA 2GPNA 3RUFA 2PN1A 1XTPA 4F2GA 3PQ7A 5LMUB 4CL8A 1BPLA 1L7NA 4IXTA 3IIEA 4XGIA 3V8VA 4AW9A 4HV4A 1C81A 4CDMA 4MJ7A 5GONB 2EHDA 3RSHA 5DLPA 2X8WA 1FDWA 5FF9A 2O8BA 1CJUC 3TOXA 3M6XA 3L8YA 2OCAA 3QOYA 3GRCA 1GTRA 3THXA 2B5WA 3OIVA 4G5OA 4O3MA 2J67A 2WUVA 3K73O 5HFJA 1D4ZA 5HK9A 3L41A 5ITSA 2OV8A 5A0TA 2R60A 3OZDA 1GD1O 4BNDB 1I9CA 2YYYA 3MJHA 3WWEA 1LJUA 1UF9A 1BMFD 1E3XA 1CHNA 1Q6YA 1GHTA 1UOEA 3MUNA 2G72A 1HE1C 3FYUA 5JZBA 2JLWA 1A7JA 4ZVQA 2YQ4A 5E1DA 2R96A 1Z63A 1XDWA 7MHTA 1SZDA 3GLGA 1FJXA 2BEVA 4EVSA 1ZYUA 1NW9B 2OTJB 5FIUA 1TYCA 5KJEA 1V41E 1GTZA 3F1LA 3ZDAA 2VCHA 2CLDX 1Q15A 4CFZA 1XCBA 2VPXA 4WN9A 4QIHA 3AVXA 3REOA 4OMCA 2ZYDA 1XDGA 2C4MA 4IDNA 1YMVA 2I62A 3ELYA 3MMNA 2Q3DA 1WKVA 3MYRA 1Q0PA 1ZCAA 4EATA 2QM8A 2AW5A 2QT9A 1WWKA 2PKWA 4G1UC 1S8FA 1T2UA 3RFFA 4B83A 2GBLC 1NL3A 5KHLB 3WC4A 2NYVA 5DCWA 3K5HA 3TR5A 1CV2A 1R15A 3C4QA 3HKEB 1FQOA 5L40A 4O2AB 3IERA 1BHO1 4BO3A 4FDVA 2DPGA 1GGEA 4RD1A 4HDOB 2DGDA 1GARA 4QDJA 2BP7A 1HZEA 3QENA 4J0DA 1TCBA 1ZH2A 5HE9A 3GLGB 4V0MA 3VV2A 2QQ0A 4PS1A 2OK7A 1X7WA 2HD4A 3PG5A 2FHSA 4OGKA 3TSWA 3Q8WA 3QP9A 4N5IX 2O2IA 4KQFA 1FYWA 1KEWA 3QY9A 5ALHA 1QCDA 3J7TA 4TMZA 2XZOA 2BHSA 2XR1A 3JSXA 3EFHA 2XGJA 3DBVO 3QVGA 4A10A 2H5JA 4UOEA 1E1CA 1NRXA 2VF7A 4JK3A 5E3JA 1T26A 1UT8A 4YRRA 4AG6A 3TLMA 2VAMA 4TMFA 4JJ6A 4MRRA 5D5QA 2B78A 3G71B 2ZJZA 3RTAA 4P38A 4J6FA 1SU8A 4OX9B 3ELBA 2ZL5A 3KQQA 1TTPB 4MI3A 2Z5VA 5C7YA 3QA9A 2QSZA 1W0KD 3LPLA 4OI4A 4J16C 3HBMA 4FHDA 1Z2OX 3TTYA 3FZQA 2DFKB 1S8NA 4XYBA 2Q07A 3DDCA 4P6YA 2PDAA 3FWPA 4C7KA 2OMEA 3LTEA 5JFGA 3M6WA 5TXGA 5FUMA 1XALA 5BT8A 4FT4A 5LP6B 4GM0A 3T9FA 2NPFA 3G23A 5E9WA 1F4VA 4KXXA 4H0NA 1N0HA 2J5RA 4B3DA 4JJ7A 2FW0A 2IZOA 1TPYA 4GXRA 5C8XA 4ZXPA 2XY4A 3I3OA 3IEVA 1EVZA 1TZJA 4G5GA 3R3UA 4MTLA 1JQLB 1P5JA 4NESA 3KU4A 1BMDA 1PT8A 3BMXA 5CW2A 1Z28A 5BN4B 4JLBA 4HGNA 2TMGA 1UXIA 4P22A 1Q83A 1C3LA 4HP8A 1E66A 3B60A 2JJ1D 1YS6A 3PL1A 4C22A 1XDDA 1SN7A 2ADMA 3ML1A 3VZPA 5ERXA 2JVKA 4Z4TA 2E48A 3G05A 5D7NA 3AUAA 4MK4A 3HVHA 1JJVA 3LP8A 4GEKA 4RPIA 1PWXA 2CVQA 5E38A 4DYDA 5EXPA 1NY6A 4HZUB 2AHRA 4U1RA 4ZEOA 1KQGA 1YS7A 2EBWA 4FWBA 3SZRA 3C0KA 1QO7A 1K6MA 5DVZA 3Q7QA 2P9QA 3HI6A 4GMKA 4X1KA 4BGDA 1G21A 3H9UA 2Z43A 2I6GA 3JR7A 1T0IA 3PT5A 1GGKA 4H3KB 2DLDA 2I7VA 3KEGA 1I3MA 4WFKA 1N8SA 3CC8A 3I5UA 4PYRA 3RSFA 4Q9LA 5CFMA 1U7WA 4DPKA 1AH2A 2YOFA 2NWQA 4IDCA 3G6KA 3KELA 4IQ8A 1PIWA 1UKYA 4LA4A 1Q14A 2QGNA 4GF5A 4KGXA 4ADSG 1MNQA 4R8KA 2LZ0A 4I1RA 3WMFA 5JU6A 3IEMA 1UAYA 3DV9A 2GN8A 1CUVA 2ATVA 1GUDA 2DFVA 4Z4VA 3DXZA 3ZXSA 4KQ6A 4X8LA 2CXOA 2GTHA 4ZI5A 1VQMB 2VBIA 4ZYVA 1NLFA 2GZHA 1H8ED 5D84A 2H0RA 4BNMA 4X66B 1ZH6A 2GERA 4C4RA 5I4IA 5B3LA 2K5UA 1DWOA 2JI9A 3PC3A 3MJFA 4KLAA 4M9CA 1YQXA 2BZGA 4LMPA 4W1RA 4ZQGA 1IZ8A 2J6CA 5PGMA 4CMCA 4EZBA 1PVVA 3O47A 3T35A 2B8TA 4Q1CA 1JI3A 4DBLC 3HUFA 1R6XA 2XBUA 2OD9A 1IC6A 2EWMA 3BXOA 4N49A 4AJKA 1WZ2A 2XV1A 1DDOA 3A8TA 2JI8A 3P9RA 1NYRA 1B15A 5I3ZA 3E22A 3G5AA 5CIYA 5HP4A 2ZIXA 1NF8A 2YHSA 4NBLA 1W5EA 3E1KA 4JS0A 4P31A 1RBZA 1GFZA 5ADWA 1XPJA 2H7YA 2J31A 4PC1A 3VNVA 1EK5A 4OPOA 3CZ9A 3KTAA 1DV1A 4RQTA 2WU4A 1Q44A 2OM2A 3FCOA 3MLAA 2Z04A 3EGEA 2ZIZA 4YT8A 4YX9A 3MD0A 3CLKA 3GUZA 3BERA 1NQWA 4L75A 2MYUA 5DMHA 3I0ZA 1JHDA 3K9HA 3TXAA 1HXHA 2F00A 1ZA2A 1FW8A 1RLJA 3KLMX 4GQNA 1NBOA 2CUZA 3ECAA 2G4VA 3QX8A 4MRMB 2VDQB 4M8IA 5ANRB 4BBAA 1Y3CE 1DIOB 4RH3A 5C2JB 3G7UA 1N25A 2EC5A 1Q95A 2OCDA 2BKVA 3GJRA 3HB5X 4XN0A 3RS8A 1RJWA 3EVFA 4DZTA 1R8QA 1AS3A 5E9JA 2QN3A 5B55A 3OPQA 5REQA 2OO3A 1OX4B 1ECBA 1DZIA 2W83A 1QGZA 4PYLA 3RFCA 8GPBA 1H9CA 2ZYIA 3HXOA 1K8AD 3O7WA 1BN6A 1FFXA 1KVRA 3R3YA 5AKZA 3TEFA 1SBHA 3AHGA 4F4JA 5LQCA 1YHQB 1SK9A 2I03A 4BO7A 3X1KA 1DQZA 3EZ9A 1U7HA 3DDYA 4XOPA 1CR0A 4RXUA 1K3TA 5FYQA 2WF5A 4I9NA 1SRQA 2VP9A 4NAUA 4ZVKA 1HDOA 3WMXA 3R7LA 1EP2B 1L7EA 1T2CA 1D2NA 2F1OA 2VYCA 3DR3A 1DL5A 4IV8A 2DOGA 3EZ6A 3COWA 1LPSA 4KPUB 1KIMA 1S01A 2QD5A 2C99A 2QP9X 2YRFA 1CFJA 2JZOA 3QEOA 4IZIA 4CKCA 5ALYA 5GY7A 1NXVA 1XWFA 3FKSA 4R7ZA 2WPDA 1WXQA 1I3CA 4BAGA 4PM4A 1FYVA 3W6NA 5L8VA 4C9BA 1HEUA 4WQMA 2JCSA 1E92A 4N3NA 4YASA 3BGWA 3TLAA 4NFHA 3RVNA 2EATA 2PD3A 5K0GA 3AI3A 1HYGA 4N41A 3L82B 4BLRA 1PT5A 3I8SA 4II3A 1U1GA 5HS4A 1RTKA 4CN8A 2PEYA 1NVFA 4CMAA 4TYMA 4FNOA 1SVMA 3K3PA 3THOA 3H94A 3ZIAD 2G5TA 1JPJA 3MVEA 3REGA 1PZMA 3R6WA 4X92A 4Q4AA 4CL3A 3GVKA 1QOQB 1RAIA 2QD4A 2UYOA 1UBUS 4MGYR 2ONCA 3C1TA 4MUAA 1B2LA 1L5ZA 1ZEMA 4UE3S 4ARCA 2EAUA 1XROA 2O6LA 2BSQA 3LXXA 4U7JA 1UZUA 1SCJA 4BVKA 4QPJC 3FWZA 1PJ7A 3DWEX 4X90A 5KOJB 5LZ8A 4MRVA 3WFIA 4C2BA 3VC7A 1NPYA 4Q4HB 1LPNA 4L85A 4WESB 1ZI9A 1X7XB 2WYIA 2J33A 5BR1A 2ILVA 1YKSA 2XYRA 3MOSA 3CA8A 3LVRE 3QWHA 1Z18A 2HA5A 3QVKA 1MPXA 4OUDA 1H2AS 2H48A 4HQ0A 3C6KA 5FNVB 4P35A 4XVQA 5JAPA 3RRNA 2Q3JA 4Z9YA 1K9MD 2MSKA 3FPGA 3OMWA 3SM9A 3ZJ4A 2X53S 4BFXA 4D92A 1AQJA 4BFUA 2WHYA 3HCNA 3Q72A 2GK6A 1SEVA 1HNWB 1GLGA 3E1SA 3DMDA 3PPIA 3FLMA 2V4MA 2DYKA 1CUAA 4XUGB 1RBQA 3FDJA 4RSMA 5HUQA 3PC2A 2GHRA 1JN0A 3L7YA 4YRQA 3M2PA 1IN1A 1MUUA 1TZCA 1S7GA 2A9OA 4HAUA 3E6AA 5FEMA 3D4NA 3P97A 4H60A 5JCJA 4WJKB 4X07A 4M6WA 3VDNB 1ESZA 1N4AA 1H2WA 4CIYA 3WLRA 2OB1A 4II7A 1AOXA 4K9QA 2FSVA 3THSA 1QRAA 5DCUA 4MS1B 2QVZX 2QVYX 3VKFA 3ZGXA 2QYOA 2PRYA 4IDHA 2Y77A 1L5HB 3LDFA 2AWOA 2KQUA 1E3IA 2B35A 4OHPA 1JGTA 1T2EA 2C7VA 2CFCA 5E6RA 3EVCA 5ECYA 3RS4A 4ZEWA 2XOEA 4J3FA 5ALPA 2BC9A 1YRWA 3VV3A 4TM7A 2B4AA 3IYLW 4DRZA 1E43A 1F17A 1VCOA 5LL6P 5LA6B 5K7SA 3NWBA 2VF8A 4UKDA 4UDXX 3SHVA 1IBCA 1TM7E 4MIOA 3LA6A 1UBLS 2XITA 3O38A 1OT3A 4OA5A 4ZQCB 1DCTA 2GJAA 4KX3A 1BX1A 1UPBA 3RK4A 5KQPA 5F78A 1KGSA 1EMDA 1ZD3A 2PAAA 3OIUA 2EFDB 3JQRA 3CBGA 3MB8A 2DBYA 4GU5A 5IC6A 3BUSA 2C42A 3SX4A 4TQGA 4EG6A 2NPOA 3JALA 3ZYCA 1YIOA 2VUUA 1EUDA 4FCCA 2ZANA 4OP7A 5DH9A 3BK7A 4TKLA 1OI2A 3KPWA 5AJXA 4BFZA 3Q5GA 3HXKA 1EX6A 3DSRA 3U7EB 2NU8A 1LDBA 1NQVA 1ZBQA 2H5IA 2JGAA 2NYRA 2BHRA 2PMBA 1H1LA 2WJ3A 1S96A 3AERB 4UCFA 5CB4B 1W87A 2AQIA 4P32A 2AYZA 2VOEA 1G4HA 5JZSA 1JHQA 2CV1A 4KUHA 3IUJA 1JA9A 3QQ5A 3H2JA 1SC4A 2DWOA 4KDCA 3QVGB 1WVGA 4HGYA 4BU0A 3OCCA 1KMIY 2IOHA 3G17A 5DJ5A 3BYZA 3HYTA 4KXWA 4O2AF 4YONB 1ORWA 2GD1O 2JLQA 2WFLB 4EMUA 1X7WB 4LFBB 1X1EA 3H7IA 1YI8A 4OFZA 5CVCA 1M0TA 1REQA 1WB6A 4HI0E 4D99A 4EEZA 1SIBE 3PFIA 1DLJA 1W5SA 1R16A 2P79A 3AHIA 3HKCA 1LSJA 2O8VA 5HXBA 3AR5A 1T5DX 1ZQ9A 2F3RA 4R83A 3SYNA 1H9BA 3IUEA 3A7DA 4ZC8A 3W3ZB 1UM8A 3DBHA 2ZSEA 4KW7A 3B9RA 2AH5A 5FHRA 1K6EA 1K06A 1XQ6A 3EHDA 5I3CA 2WIGA 3HJGA 3HKEA 5CXQA 2HU8A 1INLA 3PR1A 1GVNB 2FOIA 3GWGA 1G4AE 2LDXA 4XWTA 2II6A 3I0NA 4PCVA 1GPUA 5BSFA 2B4QA 3SFTA 4BUJA 2OTLB 3KPYA 5CX1A 1QLJA 4D3ZA 4FKMA 4U5QA 1EVQA 1RE0A 3TPCA 2P77A 2ZT6A 4CV0A 1POXA 2YOGA 4JBHA 4RJIA 1PD0A 2H5LA 2XUHA 2EZUA 5I8PA 2FUG1 2H1CA 4K2HA 4WN9B 4BVLA 4JR0A 4MI6A 4CLRA 1EP3B 4KITB 4M0PA 3GK3A 2IHTA 1RKQA 3E9MA 4FJ0A 1DJOA 2L18A 4L8WB 4LGYA 5FI1B 3S28A 4AN4A 2FEXA 2J30A 4D3YA 1P18A 3ZVKA 2XDQA 2QW1A 1A71A 1D5WA 4H7KA 1CRPA 1O0SA 1UOQA 3OIFA 1KYQA 4JUFA 4POAA 2ZSDA 2RH5A 4PGAA 4OHBA 2NT4A 3I56B 4ER0A 3LS2A 1R8JA 3RBXA 1ZM3A 1U0FA 2AZDA 1R4NB 1E5TA 5DLEA 4TTJA 3ZHRA 3VKUA 3CKKA 1DAFA 3OD5A 1L5GB 4AJ4A 3LGSA 3FCCA 1YR9A 5H4HA 4OHFA 1RTTA 1WL8A 1XRNA 2R87A 3UQYS 2UYCA 1SUBA 3BX1A 1YBFA 3TR6A 3THXB 4OLBA 1SXJD 5L3VA 5KOYA 1UBCA 4OQZA 2JBHA 3EODA 2WZCA 2WINI 3GO4A 1U7OA 4HL6A 2CJYA 3D8SA 5JAQA 3L8GA 4IS3A 4MVJG 5LD2B 2BCJQ 4CFSA 5D85A 3VYUB 3CPJB 1JFTA 1BYUA 2I3AA 2PYIA 4K9RA 1V0FA 5LUBA 5DE3A 2DBZA 3E8XA 2ZRIA 4KRYA 3VPXA 4QXMA 4ND7A 2Y0CA 3G0DA 4PSVA 4BGVA 4JU9A 1S9HA 2NP6A 2OBYA 3E2PA 3E3AA 1PSWA 3GPDG 4P3PA 1YQWA 3ZY5A 1U3GA 4B4UA 3QKTA 4ZI7B 2XUZA 3W90A 2DC1A 3PI7A 1UMBA 4NJMA 1NLYA 5JXJA 3IT1A 1GTG1 3L0YA 4WKPA 2I7CA 3D1VA 4ZYLA 3CF0A 3N3BC 2C07A 2O57A 3A7EA 2B0JA 2GZ2A 3PDJA 5F4OA 1DRVA 1T5LA 2B8EA 2HWWA 3X0DA 3STHA 4V0KA 1C3OB 4BMXA 2QF7A 3C3CA 3E18A 3HPRA 4IGEA 1JIXA 1WZUA 5C7OO 5C9ZA 3RS2A 1ULSA 4AMYA 5JYBA 3DFMA 3BG5A 4Y2XA 4PSAA 3VZQA 4CHGA 1PR3A 4R2IA 4Z2YA 2HV9A 3GUVA 3HYNA 4MGZR 3LDHA 1OXKB 3MM4A 1ZL0A 3TSAA 4ZWNA 3O8DA 1ZZEA 2CVHA 3BE5A 4GX2A 1X7HA 2WU0A 5BN1A 2OP1A 3ZOZA 1CJKC 5AIBA 2GKSA 2BAGA 5ICEA 1C7FA 1KFEB 3PIDA 4WGFA 2A7XA 3JQGA 4XX0A 4HX5A 3L3BA 3MGBA 4JBGA 2Z30A 3LUJA 1CB7A 5HX7A 1UWCA 3EDRA 1CTQA 4YLYA 1N78A 5C5EA 2OENG 3BCFA 1MIOA 3QTBA 1W4CA 1UMBB 2RONA 4NJMB 4G01B 1E4VA 2L42A 5IN4A 1VLQA 1CUDA 2VSXA 5DN9A 3TVYA 3A6PC 2HRBA 1XNQB 3DOCA 4BMPB 1Z3CA 3OEYA 4BQSA 3DW1X 1OVMA 5EAIA 1C3EA 1GRQA 1M33A 4NBSA 1QYCA 1ZD8A 3L7BA 4MKRA 1D0IA 4ZO6A 3CLSC 5AI8A 2ZCUA 3RJTA 1Z5NA 3CF6R 3DVAA 3AUKA 2C2GA 1XR3A 4IOJA 2JDIA 2EDCA 4CGYA 1E3ZA 2QUKA 1SURA 4Q3DA 4GI2A 3SLNA 4GDFA 1BXGA 1M7HA 3JVIA 2IHKA 1P60A 3VR5H 2IBTA 3PJDA 4RFLA 1E3MA 2VJJA 1XRLA 4R1LA 1PWEA 3PQ2A 2O8EB 2UVPB 3RYHB 4YFYA 4ZCSA 1VQ8B 3WY9A 4CEIB 1SR8A 2NNLD 2F43A 4K3UA 1KAGA 2O5RA 3W6ZA 3GU3A 5D7BA 3GPIA 4Q3CA 2BGLA 5ER9A 3SYLA 2AI3A 3X44A 4U2KA 3TNLA 1KHHA 2ZJBA 3VR5A 3G79A 3K53A 3GCZA 2Z3VA 3OW7A 1U31A 2ENWA 4ACBA 2E85A 2IU3A 2NVBA 3RNOA 1JHAA 4KN8A 3P26A 1YCGA 3JYHA 1SUFA 2W6JA 1J5PA 3L7LA 3LF2A 4GNKA 4OFXA 1WMDA 5D01A 3ZBPA 4HEA1 4Q93A 1JILA 4CBVA 2AXPA 3LQYA 2XTAA 2GYWA 5HQ3B 4R8RA 1SCBA 4I1VA 4DY4A 4F2WA 1M6VA 2RHBA 3A1TA 1D1QA 4M0UA 5HMLA 4AY4A 4Q01A 3HCAA 3I62A 4IH4A 3C43A 3I2KA 4KBGA 5AO9A 1G0OA 4RTMA 4YCBA 1NXTA 4TVOA 1TAGA 3GMDA 1TEHA 1DEKA 3A1SA 4OH7A 1FTNA 5CX1B 3TQOA 3VMMA 3QUBA 4Q21A 4EYOA 1N9KA 4XD7A 4MVJH 1QF7A 5BNWA 4WSOA 3K0AA 3N7UA 4YROA 4BO4A 4AJ1A 5JD5A 3AKZA 3CPXA 4Z3KA 1YRAA 3SCZA 1E2FA 2BFCB 2YN0A 2XUQA 1T9GS 5B1HA 4EQ6B 1LF5A 4X71A 3ZJUA 1BH2A 1JKMA 1NZFA 2FRDA 1WOPA 3PUZA 5FPYA 4MVJE 5HIJA 5I8WA 4IFEA 2WC1A 2BE9A 4N3GA 3NW9A 2WFLA 5IXYA 1RHRA 4F5YA 1W34A 1U7PA 1PGNA 4IHJB 4QODA 1SD5A 2HDHA 3LFHA 2GRJA 3U48A 2CJPA 2AGVA 3ADKA 1E63A 1YQ9A 4R9NA 2ZWPA 1BQEA 3BM5A 3GJ8A 1OYVA 2WM3A 4IIFA 2AOXA 4LXTA 5ALRA 3RBAA 3VR4A 2FWJA 3VR3D 1M7GA 1KJWA 2GNPA 2IOQA 2VH1A 4PQYA 5IUNC 2B99A 1Z6QA 5TSDA 2HC9A 4H1TA 5CT6A 2BTQA 5KVVA 3EBOA 3S44A 2V7EA 4RIGA 3ZCRA 2RGBA 3NKVA 2PQ2A 1VIYA 3PX2A 2LIVA 4G0QA 4P33A 4M0FA 3CMMA 5LQJA 2ZJ8A 1X39A 1W0KA 5FA5A 2QUIA 2D3NA 4TT3D 2GQFA 1P80A 2PZLA 3FZNA 1L1FA 2FRVA 2HU2A 5I5EA 5IS2A 1LK0A 1LUAA 3VX3A 2O7SA 2QN7A 4PFQA 4X97A 4DLVA 3O74A 3T9AA 3ORFA 5DNEA 1KVSA 3LOUA 1AHPA 3LDAA 4XDGA 2IKSA 3RSCA 5IEBA 3FKQA 3BMQB 1A4IA 2DSTA 4QUDA 2XOKD 3UIEA 1V6AA 4ENUA 3TEJA 2VP4A 3EGCA 2ZTVA 3N5KA 4G7XA 4R69A 4XJSA 4LQLA 5BW6B 2G0AA 1UKZA 3CRRA 4XVHA 1KRWA 2D4HA 3ROTA 4DV5B 5DNWA 2BSXA 4PG5A 4PINA 3A6DA 4C4ZA 1Y4DE 3NC4A 3DWFA 3N8DA 5IARA 4YAUA 3PITA 2YHIA 1JHXA 1I6LA 2PZGA 4LYJA 5AK6A 3VSCA 4YAIA 4FHEA 2WDZA 3IX7A 3RIMA 1XCLA 2XIJA 1THZA 1Z73A 1QIHA 3P45A 4EDFA 1KC3A 3NRJA 3T52A 1RPNA 4HGZA 1XA0A 4M7PA 2UZ0A 4LGCA 2X6YA 2PV0A 3KJXA 1BZYA 3MB5A 3QJGA 4XB2A 1B0PA 1GTMA 2ECFA 3EZYA 3TINA 3CXUA 3PQ8A 2V8OA 4WXMA 3WNCA 3GDHA 1H3FA 3VKVA 1ZXBA 5AOVA 3WGMA 2H0QA 5KU7A 1G7TA 1GA4A 1GTSA 1YVDA 4FW8A 3S2YA 1ZRMA 4BX3A 3G8AA 3HCRA 1W4AA 2B30A 2X9NA 5DBOA 1Y1QA 3VH2A 1OFVA 3ORSA 3RVKA 4RV4A 3H87A 1GQQA 1ZR4A 2XHZA 2PMDA 1JHMA 3FPHA 2BRUC 4KB5A 4M49A 1QGDA 2G77B 4FX2A 4M83A 1T4BA 5T64A 3ZH2A 5EI5A 3CLUC 3TS1A 3U4DA 5AVUA 3GFVA 3Q85A 1SAYA 3T56B 4BTVA 5JVDF 2FFBA 3THRA 4IEEA 3UW1A 3BJMA 1QF9A 4MUHA 3NB0A 2F2TA 2QZJA 4MULA 4QQNA 5DX1A 3URMA 4UFOA 4BWVA 2IF0A 4GECA 4Q4JA 1Y6RA 2Q6OA 1NE2A 5KQSA 1NXQA 2XQIA 3NGXA 4FIZA 4Q7MB 5LP6C 5JS8A 4R3UC 4X7FA 3CLTC 3GDOA 4XKJA 3A1FA 3EJ6A 3IUBA 1C1DA 1E3EA 3R3XA 3NUGA 5K0NA 3S1LA 3S68A 4O5OA 4HRYA 1EUCA 2SCUA 3JW8A 3IALA 1KZ1A 4R01A 1XAHA 3KJNA 1NYQA 4Z7QB 4XLFA 3K16A 4G6IA 2VJYA 3LBFA 1PWZA 4OQ4A 1QHNA 4BE4A 4NLLA 1OTYA 3X1MA 3IBSA 3DBLA 1EJ0A 2X7XA 5CBKA 4X6UA 4I50A 4BEWA 4MPJA 3JQPA 5HPYB 3NYWA 2VCEA 1KJNA 3TCKA 1HL7A 2XCUA 3CRZA 1XE3A 1YJXA 2GF2A 3U13A 3HYCA 2IS2A 3C8UA 1E61A 2CL5A 4OJTA 3IAS1 1BHQ1 1YMQA 1O57A 1F38A 3QJYA 5KTSA 3DBRA 3QOWA 2H65A 3PEEA 1X14A 2VRCD 3L4EA 3W2FA 4MINA 1NBEA 4LJ7A 2VT3A 4PC2A 4OJMX 2OEPA 3LRPA 3U3JA 2H18A 3I5MA 4MOWA 2QVCA 4P25A 1D6NA 3LYLA 3C3YA 3L7MA 2ZETA 4KO2S 4PLCA 2XUGA 2IFTA 3I64A 1VIAA 2GQ0A 2QMZA 3KQTA 1N6OA 3MNFA 3ZI7A 3AVYA 1OH6A 1N36B 2O1XA 1C30A 3VR6D 1YL5A 4IKOA 3BSYA 3L5OA 4PABA 4M88A 5BSKA 2G9RA 1KQOA 3QV1A 4BNNA 1IN4A 4N9QA 2C7OA 1CEXA 3MA0A 4RPLA 1IQPA 3EWAA 3CX8A 1E2PA 1FFXB 2OM6A 3BICA 4Q02A 2DPLA 3CUEF 3D7KA 3F6PA 4ZTBA 1KI6A 1GUZA 1OFUA 4BNHA 4BQRA 1KO4A 4Y1FA 2V96A 4R0VA 2PZEA 1NBMA 2QKYA 4Z0HO 5IULC 3M9WA 1GQRA 1Q1QA 2I8LA 3INTA 4YA6A 1G8PA 3G2NA 2E4XA 1P2VA 5CVVA 5DHFA 1TU4A 4Z3OA 2ADFA 3FPAA 3FPSA 3O83A 3Q7IA 3DC2A 1AF7A 1V5GA 3ODGA 4G3XA 1T6NA 4QEKA 1NMQA 3VNAA 3UH0A 1SNYA 4KGDA 4DCVA 1UJMA 3H4MA 4JI5B 4DYVA 5JRJA 2ISSD 4I6GA 1LRKA 4Z1OA 3P1JA 5IYZF 2HT1A 1SOWA 1FXWA 1N5MA 4F5DA 3EYAA 3ZEAA 4E6EA 1Q7RA 1RIIA 3KTAB 1UC9A 1EUQA 2HGSA 4LMAA 3KZ1E 3F6EX 4D8YA 4EHLA 3VPHA 4FOLA 2X6QA 2QTTA 2QG6A 3CX7A 3W34A 4OHXA 5IANA 1NC1A 3CNLA 1GILA 2A2ZA 3H9EO 1N6RA 1I32A 3O2SB 3M81A 4FGLA 3VOBA 2BEWA 4C03A 5KSOA 1A4XA 1L4FA 3E9EA 3GGOA 4I14A 2PSEA 4RVHA 1CEEA 4M22A 3KYCB 5AVJA 4V03A 4MCAA 5KWJA 1Z83A 4QG3A 2YXBA 4HB4A 1DXQA 1VI5A 2B25A 4HUQA 4OGLA 1IWBB 2QGGA 3GD5A 3ZWBA 1RRMA 3BH0A 3LHIA 1YOBA 4MKZA 5CEJA 4HQFA 1N06A 2ODAA 2R8RA 1KDVA 4J0KA 1T8UA 3AHCA 3HH8A 4AZ3A 1VSBA 3DDNA 3ZNNA 3I73A 5FUVA 1W4BA 1U02A 1NU8A 4M8SA 3ITEA 4P93A 1U2PA 5JECA 4HAVA 5GGXA 1XLWA 1JKFA 2XNCA 3IE2A 2QM0A 4OB6A 3HZRA 2SHKA 3WICA 4HFJA 2CLIB 2GSWA 3LPNA 2XT9A 3FSEA 3L1HA 4TKUB 4X1KB 3LK6A 5JS2A 2IU4A 3WNDA 3K05A 1HSZA 1NW4A 4XXHA 3ZWPA 1T24A 3IKLA 4BVFA 3Q39A 3ZY2A 1LY1A 1Z5VA 3G2KA 5KAMA 5EZYA 2A86A 3CUSA 3FM9A 3GZNA 2WIKA 1XGKA 3R1IA 2IYWA 3TLCA 1ZW6A 4CF3A 1ULTA 3HDYA 4K03A 5AKYA 3ZS9A 5AKXA 3UATA 3K6JA 3VZBA 1QQ5A 1YQGA 3CNOA 1NB9A 1W4RA 3P2JA 2CCGA 1PGJA 2VHYA 3FPBA 4PPFA 4RTPA 2FR8C 4I9GA 4W5QA 1ECLA 2IIPA 4WAUA 3SY8A 2HF8A 1PGPA 2IXEA 2LP4Y 3GD7A 3LT1A 3O0DA 3QKUA 1T0JB 1T9DA 4RKWA 2C4TA 1LX6A 1ORHA 3R9XB 3EPKA 3BEDA 3WRWA 4MP3A 3OF2A 1L5WA 3HB4X 4X9XA 2QUZA 4FS8A 3A05A 4RD2A 1V25A 2VFAA 3CWZA 3DOIA 1OR8A 3ICPA 2P7IA 1GPH1 3JRWA 3T7RA 4B6OA 4E2XA 5HWSA 2QW0X 3I8OA 2J3DA 2NTYC 4H59A 3AILA 4KQ9A 2O8EA 5JAOA 1PL0A 1C7QA 2VK8A 5KS2A 3GFFA 4DA4A 4PO9A 3C7AA 3F8TA 3QVOA 3QF7A 2ZXUA 2YC4C 4NZOA 4WHMA 1UD8A 2Q7DA 2HNKA 3JQAA 3KFLA 2VYQA 1DFIA 1R2QA 1ZH0A 1UT5A 3MGCA 1BDMA 1X13A 5AVTA 1R6UA 2WF8A 5BUZA 1Y9AA 4P1ZA 3Q6NA 1KYZA 1YZNA 2IE8A 3WK6A 1YDMA 4TTSA 4B76A 3PVDA 5T7BA 4KE6A 4DCJA 1OFIA 4JGGA 2PS1A 1HL3A 2VRWA 3LHFA 2QXTA 4A5OA 2RHLA 3B2NA 5BMOA 5IUKC 3KWFA 1BE6A 3KXIA 4H7IA 4PIVA 2HJ9A 4GICA 3M4NA 1J33A 2OXEA 1XI2A 4NV1A 5E2IA 1W7AA 2J9GA 1JVSA 3ASYA 1HFWA 1EWVA 1TRHA 4HZIA 4XGRA 5BSWA 3BIFA 1B6GA 1PR5A 3JYQA 1NKSA 3COZA 5DYYA 2I1WA 2O23A 3PCRB 2H1SA 1G0NA 4EELA 1KRHA 2GB4A 3PUVA 7REQA 5IX8A 4URZR 5JBIA 1B8UA 2PQ0A 4IILA 3ONUA 4AJPA 1OASA 3UJCA 3ZEIA 4H18A 2EG9A 2J46A 4QGBA 2ZQZA 1OFUX 4F92B 5IAKA 4CTNA 2O8DA 4KFRA 4OJNA 5C7IO 4JI2B 3VHXA 3HU5A 1C9JA 4JAVC 4LRYA 2LNDA 5IKXA 2V7BA 1M8PA 2QVBA 2R7KA 3ETJA 3B78A 1ZGGA 3GOHA 4UNIA 4GMGA 2QMHA 2REQB 1Y8CA 1I3NA 2HF9A 2UZ4A 1IM5A 1I24A 3H5OA 4NI5A 1D7OA 1K6IA 1SOVA 3QKRB 2IYTA 1QAQA 3G9UA 3KB6A 4OKNA 4RCVA 4AWXA 1E1MA 1O9GA 4E0FA 5FBKA 2Y0PA 2AYYA 1AXEA 1XG5A 2SICE 3TZBA 1A77A 1LSSA 1SU4A 5EYPB 2WIFA 5KNBD 1G3RA 4BPBA 3JX9A 4HPWA 3PHCA 4IFIA 4RQAA 1I8TA 5ENZA 4ZIRB 4YJ3A 1OE0A 4E51A 1U3VA 1UCFA 4JC4A 2W6QA 1H2EA 1RCFA 1KMNA 1VL2A 3D3WB 1H69A 1NMEA 2NUPB 4HQOA 4J4TA 5JSUA 1HYEA 2OCXA 3DVRX 1ODFA 2D5BA 4GRAA 4MUYA 1R5BA 1SPXA 3VR1A 2B20A 5SZHB 1AV6A 2HMYB 1DO0A 1G19A 4MVWA 2J6IA 2COKA 2I33A 2IVZA 3BAZA 3BTOA 3JQDA 3LUPA 5HS6A 1AHNA 3OZTA 5LYJA 1KNQA 1T2AA 4EARA 4MV6A 2PE3A 4V0OA 4NDAA 3CPEA 2VYFA 2H3EA 4HWSA 2P8SA 4O8CA 4CEJA 1J42A 2G70A 4FFPA 4OQDA 5CVTA 2BZ0A 4G97A 3X1JA 3E2IA 1CYDA 3RUEA 4F04A 2VUTA 4CI0B 4M9XA 1IY8A 1EA7A 1TX4B 2NUPA 3KKLA 4RIHA 2C92A 1JJBA 2ON6A 1R0YA 3GLUA 2D0DA 3F67A 4GBGA 4N8DA 2DWPA 1D7AA 4EFDA 1M10A 2IXTA 3B36A 1XTBA 3IMFA 1CJTC 1PJ2A 4LHWA 2FMUA 3RTGA 5EYPA 3TD2A 1AKEA 4OHWA 2YMLA 1FSGA 2CN1A 2HK9A 4EAAA 5AW3A 1XEXB 1FQKA 1VYUA 2XUOA 4NBNA 3JWIA 2PUEA 4RGYA 4MKIA 3U1TA 5DMXA 1CF4A 2B1RA 4C6SA 2R65A 3QKRA 3RDPA 3EVDA 4ZAWA 4AXBA 4DA7A 5U4QA 4ED9A 5J2UB 2ZROA 3SJBA 3AVTA 1XKLA 3S99A 2REQA 5E6SA 3VR0A 3GP8A 4F0JA 1X7YB 4B4OA 1FDSA 1IPHA 4RHUA 2A4MA 2CK3A 2W8BA 4MV8A 3MJEA 2I1LA 2BMVA 1AKNA 3CF4A 3L0OA 3O3NB 4UHCA 1DZ3A 1R66A 3SC4A 5A03A 3AFGA 4DTCA 4ZCIA 1SK8A 1U2GC 2QNBA 1QZZA 4OGFA 4WDQA 5CXSA 5GM1A 3TGWA 4EHJA 5EJ7A 1UWKA 4EBBA 1A98A 3TOSA 5CDTA 4MGHA 4A6DA 2V6GA 2GEUA 2JFQA 4TV9B 4M9SA 3UKJA 2QT0A 3CNBA 2WTMA 4YT5A 5I9IA 1D2RA 1K86A 1LSUA 4LDNA 2ZUVA 2RG1A 5DS0A 4LYEA 3WLHA 5KQLA 1GL7A 3KJZA 1M8GA 1SXJC 1CUIA 2WQZA 3AVPA 3FFXA 3N87A 1BFKA 4G8JA 2OPBA 1Z47A 1U0HC 3ZD6A 1G3UA 3CMCO 5A2GA 2QTGA 3KVYA 1QAMA 4QICA 4RACA 4P58A 1XT6A 2LV8A 5KYUB 5KTKA 4KRGA 2BTEA 2X8AA 5K3FA 1XTJA 2RH8A 1UBSB 4ZN6A 2ACWA 1A96A 1FNBA 2CGEA 3ELWA 3CCJB 1DVRA 2AX3A 2BI8A 3L84A 4GYKA 4H1WA 3W5UA 4MQLA 4JR2A 2FSGA 1HM5A 2H3HA 4NMWA 4X6XA 2SBTA 4YRIA 5LWQA 2O3UA 2VI5A 1LEHA 4Y1GA 3BH6A 3WNQA 3I76A 3HCFA 1GTL1 5M04A 3PSHA 5CB4A 3PQ5A 1DSSG 1P81A 2DUNA 3ETCA 3K32A 3KXDA 5HF8A 4DSZA 4QBIA 6ABPA 1CJVC 4PZ0A 4CLOB 3UFBA 3WTCA 2G82A 3GT4A 1VMDA 1BU8A 1P3DA 2NACA 2OV4A 1WORA 1TO6A 2POQX 1UBRS 2XMQA 4MMZB 2ALJA 1K7XB 5F2EA 5HKLA 3W5BA 1BS1A 2MYPA 4XWWA 1OLSA 2X4DA 2A14A 1EK2A 4KUEA 4RX1A 4OAQA 1FDIA 1S2OA 2A1TR 2ZULA 1Q77A 1LFDB 2X3UA 1ZMTA 1QG2A 1UBGA 2RIPA 2V54A 5FLEX 5IKOA 3WMEA 2EJBA 3UG6A 1P4MA 2H2AA 3ZWVA 4AXXA 1HLFA 1A9YA 3B9PA 1ZRNA 2PU7A 3DAYA 1YK1A 3BREA 2O0MA 1ZU4A 4TYNA 4DV4B 1JEYB 2AE2A 1WSAA 2W48A 2ASVA 2DKOA 1V71A 1N5OX 1BCSB 1F1BA 2JC3A 1KBZA 3IEXA 2D1TA 2E5LB 2R4TA 1MJFA 2JW5A 4W1QA 2I4IA 3T4PA 3UG7A 5K5EA 5IRCD 3JU3A 3PUKA 1M6HA 4YUZA 1T1GA 5K0TA 2XGGA 2VZLA 1B16A 4GOMD 1NMYA 4HB2A 1L8OA 4P0TA 3G0HA 3O9ZA 4ZO4A 2GZRA 2JBWA 3HA2A 3GT7A 4HRXA 4NAHA 3DE4X 4J1NA 1KVTA 5AKGA 4KKSA 1QIMA 1TCUA 2WJJA 4ZVOA 2I6QA 2J0SA 2FZGA 1QS0A 4OPSA 1P0MA 1XQXA 4ZPJA 1TUEA 3A9RA 1I7DA 2V0GA 3N6RA 4UBOA 4I5FA 4D5GA 3H0CA 1VPEA 2WMDA 2PKQO 1QVWA 4Y2VA 5KJCA 4RWEA 1M2GA 4F5EA 3UEOA 3S2SA 1VFPA 5DGHA 1KYYA 3AYXB 5F5XA 4LX8A 1I18A 2BI7A 4JLJA 1NR1A 1VPLA 8OHMA 5AVOA 4NBWA 3LC2O 4Q9IA 3X2FA 1U1EA 5DWQA 2HU5A 1OYWA 1GGVA 4AYWA 3OW2B 3KCQA 1U8TA 1UH5A 2PT9A 4KKVA 2FYTA 1KPGA 2ZI7A 5H4GA 1M8FA 2HX1A 1X80A 2YZ2A 2ZIUB 3CUVA 4PLHA 1KA9H 4R2XA 4R9VA 4CKEA 1OZ0A 4PX9A 4PYKA 1RMYA 4X63A 3K35A 4B85A 4RLHA 4HF7A 1OW3B 1AV7A 2M5SA 3LUGA 4I5DA 2ZYWX 4MDEA 1RYHA 2XUAA 4M0LA 5LNK6 3GJSA 1RJFA 3HYRA 3USZA 4RF2A 5THKA 2J0QA 3TL3A 3GL9A 3GLIB 3A8KA 1EUZA 3HS3A 5LMNB 2IX9A 2Z8ZA 4HXEB 1XL1A 3BL8A 4OQYA 5B7NA 2P4EA 2NGRA 3EMBA 1CX9B 2IYYA 3TFQA 1QB7A 1CS0B 1WCV1 4HH4A 3R44A 1CJCA 3VYWA 1N0WA 4MLCA 1XMOB 2H4FA 2AC2A 1QHHB 1EXMA 1KI7A 1Y7TA 1O5IA 4B3MB 2IXDA 1AZSC 1FNSA 1YUBA 4G5SA 4RFSA 5AKJA 5DDIP 2AZXA 4ND6A 4ZMBA 2IYOA 3ZE6A 2W37A 3SPXA 3KUUA 1LBTA 4RK1A 1NNLA 2Z5FA 1NR5A 3DH0A 3KSMA 4WNCA 1V2HE 4PICA 1MA3A 5F64A 4BHTA 2IH5A 1WZEA 2BM9A 1EVEA 2E6KA 1E0KA 3AEQA 3DZKA 4PCAA 3U3KA 4B6RA 1SPBS 1R8YA 2ENUA 4URWR 1EGMB 1K7FB 4G26A 4Y2GA 1S0UA 1NUTA 2C94A 2HSWA 1MV8A 4JVMA 3V9PA 2C5LA 4ZVNA 1JDPA 2R6JA 3LQKA 2FRXA 1KAMA 1MEJA 3NTXA 4GLFA 3IOEA 4Q3OA 4HAYA 1OU0A 2B3DA 3GNSA 3L6UA 4I4CA 3UPUA 2XPCA 3PQDA 2XMDA 3ZWXA 3FB4A 2RHGB 4G89A 1C8KA 2C5BA 1F9AA 1IN8A 1T13A 3WWOA 1T0PA 1JEOA 1U8FO 4Y6SA 2IYZA 4PN7A 3EA0A 3HL4A 2VNAA 2P3MA 3TL2A 5F2KA 1LX7A 5A6SA 4TYQA 2MJLA 4AK9A 4REQB 4TWBA 3I53A 2XCTB 1NG9A 2I3GA 4FTWA 2QA5A 3FE2A 1VMEA 1SKYB 4K7JA 4MWBA 3EAFA 3G0OA 4ZU3A 1J5XA 4HHEA 3VOAA 1FFDA 2IWRA 1DDIA 2QLJA 2ZLBA 3ET5A 1IHOA 2MSNA 3FNRA 4G4IA 5AW2A 2H1VA 4BNWA 3GDGA 4AO8A 4BY9E 3STUA 3K0BA 3P20A 5D6NA 1ZLXA 4JLAA 4FQ8A 1DWPA 4INZA 4DYHA 3G9ZA 3DXXA 3UHJA 4K6FA 1RC8A 2XT0A 1EUCB 2SCUB 1TAQA 3B6IA 4IR7A 5EZYF 4E32A 4WK2B 4EYQA 1SXJA 3A3GA 3I04M 3LGAA 4P4UA 4QJIA 1DPFA 3PGMA 4RSGA 2BFPA 2P9TA 3AU9A 1YI0A 3PT9A 3WYEA 3T4EA 4PFJA 4L4XA 1GPDG 2AJ8A 3ASZA 16PKA 1G7RA 5J1TB 3RW9A 1HQKA 1IHUA 1Y5NA 1ISMA 4L5AA 3T61A 5BV2P 5IC5A 1YDEA 3ZGYA 1CZUA 1L4HA 1JIKA 1PQPA 3E7WA 3RHZA 5HVNA 5F5NA 3HUTA 4L51A 2HEIA 3LX6A 4RSHA 3ZPXA 4WBNA 2KW5A 1YB5A 2R6CA 1C1YA 3G2PA 1Q1GA 4JJGA 4CKWB 4FE3A 2EZ8A 3IURA 1NI4B 3FY4A 1NXSA 3NGMA 3FJ1A 1H2ZA 3HWRA 5AJYA 3H9CA 3WADA 3CISA 3EY4A 3OP4A 5A7GA 4GVLA 4RWZA 1H4SA 2OCBA 4H7HA 3TE6A 2ZTSA 2V1XA 3BIWA 3AZPA 3GMSA 4JQZA 4W5TA 1T5IA 3E1GA 5DTJA 1F60A 1GU1A 1XCPA 5JXGA 1WXEA 1K5PA 1LF0A 2APJA 4PBTA 5JTTA 3OZEA 1BU5A 4FLFA 1APBA 1VL8A 3I2JA 4GBMA 4KR9A 3CY6A 2P6NA 3DZHA 3JTMA 4F4UA 4V2UA 4EB6A 3HLYA 4PZAA 2EFEB 2ADOA 3IVXA 5CDHA 1YV9A 2O06A 3H2GA 1MW9X 2FMTA 1WSVA 1J8FA 1C0IA 5IYPA 3C45A 1WPCA 4BLSA 2G1KA 4D2IA 1KQ3A 4JB2A 4NOJA 4TZKA 3W7BA 5IMSA 5L7WA 1H0KA 3U3XA 3SBOA 3P9YA 1KJZA 1M67A 1O58A 2VEOA 4L6CA 1UBNA 4IZ6A 1G64A 5JE8A 4M7RA 5JIBA 4XRRA 2G4LA 5TPWA 3SF8A 4FGSA 2C5AA 1TVEA 1SKAA 1US8A 4GZ6A 1FX0A 1LKZA 2B1GA 3RS0A 1AXGA 1IFXA 5A3VA 3AF2A 1GGFA 5BYBA 4QYXA 3W5CA 3OECA 4H4CA 4IY1A 2PYZA 3OE4A 3OX1A 2IEZA 4HTFB 4LOJA 2YX1A 4E09A 3CX3A 4Y0NA 1DG1G 4Y7CA 3QLUA 3RHSA 4P8RA 5COQA 5SYMA 5JOQA 1UR5A 2ZR7A 1FVOA 3CEAA 1ML3A 3PQCA 1ETUA 2FE4A 2FFJA 5DHUA 4EWLA 3OSZA 5KNDH 3G8BA 2I99A 3OHPA 4HDNA 4ITRC 1E1CB 2AFHE 3TZ6A 1EFAA 1KEUA 1X8KA 2GCEA 4AUEA 4O3FA 2H51A 2GVZC 2NVWA 4ND5A 2QHXA 3DFZA 4HDSB 1JT9A 4BX2A 1G4UR 3FGPA 1VPDA 4U3JA 4UU1A 1FJGB 1I1OA 3TKYA 2JG3A 4EO9A 2H4WA 4KYTA 6PFKA 2WTXA 3UF0A 4DC1A 1LPBB 4RQBA 3DLHA 4PQRA 1BX3A 4EI8A 1DKQA 1UJNA 1VLZA 3WP1B 2JFFA 4BOYA 1HT3A 1Q16A 5KJ1A 2MYNA 3E5NA 1HYQA 4X3OA 4M55A 3QPCA 4MV5A 2WQ7A 2XMRA 2BFCA 2VSYA 1Z8FA 1KKMA 3AJDA 2BLLA 2IHYA 4OVKA 1GM5A 2W9XA 2BKUA 5I7OA 1LPAB 1RVV1 2YJTD 5MN5A 3ZDCA 1PV1A 3N2EA 3MPUA 1LLDA 1BNCA 5JRZA 3H17A 4QXRA 3GEEA 4BKMA 1NQAO 4JQYA 2R79A 4EKNB 4F06A 4OB7A 3QELB 4MYCA 5JDIC 5DHSA 4ZRNA 3MRSA 1GGMA 1H6BA 1COWA 2A9QA 2IDMA 1QGAA 1IHYA 1YB7A 4YJ3F 1X38A 1QE3A 1X7YA 3A70A 2J7PA 1VBNA 2E4YA 3HV0A 2XWQA 1U81A 3PXDA 1FDOA 3O1IC 3PSAA 3BXPA 1AGRA 2GLUA 2FG6C 1RI1A 2BF7A 1IHPA 2G9VA 3SOPA 3V3KA 4LF8B 1EFLA 1BVYF 4OQEA 4F3KA 2VQEB 2VF2A 4MQBA 2RGGA 2GLTA 2CEAA 2CHFA 2DXIA 3AC0A 1U98A 4NOMA 5FOTA 5EZ5A 4F85A 3EDOA 1SQFA 3AOEC 1Z2CA 1XU4A 5CVEA 1IXSB 2ZUEA 3BGSA 2HK8A 1MXFA 3EIUA 4K1XA 4LOKA 1FYEA 4EQ6A 1QZXA 4AJIA 3WIOA 1U2DA 1S5PA 2BISA 5JZ9A 3EFOA 3ISVA 2A59A 3HUDA 3TMYA 3QVUA 2RH4A 4N6OA 2V58A 3W2EA 1QB8A 3PC7A 4MYUA 2GPWA 5GP1A 3FZEA 3BJZA 3N75A 3RC9A 3AUSA 1JHVA 3WLOA 4QLBA 1BE8A 1R6TA 2DBVO 1ZJ4A 4LYDA 4YRGA 1O87A 2OXFA 2YMMA 4EGAA 3D6AA 3FPCA 2PUGA 1WW8A 2Q5QA 5CA0F 1GV0A 4G37A 1OT5A 4QU8A 3Q9SA 1MH9A 2KBFA 2A5LA 3H75A 3MWGA 3T6KA 4K6CA 1VE9A 2OB2A 1RM3A 2H00A 4Z54A 2L69A 3PPWA 5DF1A 5SZKB 1ZPDA 4G1CA 3GW8A 5BVHA 2HDWA 5B3KA 2D8MA 1TQDA 3E82A 5DM1A 5SZIA 3AUUA 2Q9CA 4IDAA 3UT0A 4GX0A 1YA8A 4HWOA 4MJXA 5ALDA 3GFTA 1Y8QA 1X87A 4W63A 3NRBA 3B7WA 3PWSA 5ALIA 2JJYA 4KMSA 1RC1A 2WD7A 1TEVA 2PJUA 2YZMA 1VDMA 1O6BA 3LDUA 5BR7A 3FOZA 1H42A 4EQZA 1AGPA 2QE6A 3O8NA 2IKQA 3F90A 3QMMA 4H3HB 4HAWA 5B58C 4GOLD 2Y1CA 3EFBA 2C84A 4D46A 2GZ1A 1AQLA 2EZ9A 3GRUA 3NIDB 4MPTA 2G5PA 4D0LB 5JO0A 3H5IA 1T5BA 2P90A 2NQ8A 3ENZA 3HB7A 4DBVO 5BSEA 5AVKA 4DA0A 4IZOA 2RGUA 2ESRA 3IELA 1Q74A 4FCVA 4UQPA 3DD5A 4RJLA 4S24A 5TX7A 1QR6A 1N5IA 1ZD2P 5EFOA 4OLHA 1J6UA 1J7JA 1O95D 3MWDA 3SU8A 1AKQA 2C7BA 5AI5A 3WIDA 2D5LA 4N18A 1ZK1A 1P2TA 4YMWA 3ER9A 5BNTA 2NAFA 2EKDA 2JIZA 3N0TA 3E27A 5IYNA 2PLNA 4GX5A 2WF6A 3QJ5A 2R97A 4B3CA 1UIMA 3G2OA 4RVCA 4PLGA 1G98A 2PUFA 3FB1A 3HDHA 4ROSA 2BZ1A 4E33A 2J32A 3BXHA 3HVJA 2DFTA 4XJXA 2ODPA 5KNCD 3GRRA 3WKCA 1SO8A 5GV8A 4EHKA 4XM2A 1P2SA 5CFPA 2GPTA 1NTOA 2CYCA 4G41A 4HYTA 1NVUQ 3EF3A 4DM7A 3MMSA 2BHNA 3KZMA 1XF1A 4LECA 1WIWA 2CJFA 5AR1A 5EMMA 2RGNA 3WOHA 5F33A 1CR4A 1KJJA 1ZGBA 2Y6VA 4HGRA 1DBQA 4INPA 4KNWA 4L0DA 3RIGA 3V5NA 4BC1A 4Z7JA 4NXNB 4YP1A 1D5CA 2IYLD 2DLCX 3B89A 1W8IA 2HJGA 1T25A 3DKKA 4FMDB 4HLUC 2W2KB 3RODA 2QG9A 3BRQA 1PR6A 1I4WA 1W0CA 1Q7EA 5B58T 1L8LA 3FZGA 3RJZA 3V8MA 5C1OA 5LQUA 1II0A 5F2OA 2YNMD 1IZZA 2GAOA 3N2YA 4LDJA 1KZHA 4XM1A 2PCJA 2Y2VA 3EVZA 3G7NA 4MVJM 3LV8A 3O03A 4CM6A 3X2EA 3T3OA 3SEJA 2XMZA 4K28A 1TQHA 2I6FA 4M8NE 4P7JA 3UGTA 4KKUA 3V7AA 5K20A 1KWKA 2H1OA 5EWMB 1YHZA 1WHSB 2V98A 4I08A 4MZXA 1R0XA 5JC1A 1P2DA 5B6PA 4BXOA 2XJ9A 1M2KA 5JZOA 1U8AA 1G8HA 1P19A 2SKCA 4KZPA 1KC1A 5AM3A 5LD2C 2VF4X 4B43A 4G23A 4I1UA 4B82A 4B4DA 3NAMA 5CXXA 3WJ2A 1ODCA 1Y42X 1GRRA 1GL3A 3I01A 3K09A 3OO0A 4RY8A 5DW0A 4L8VA 1NULA 1M8KA 4W99A 3PX3A 5DCYA 4L3VA 3OF5A 1V8PA 1HBJA 1SU6A 3BCRA 4WE3A 3V76A 2Y68A 4Z86A 4M1YA 1P1JA 3TJMA 4EJ6A 1E2HA 1E4EA 3FOCA 4F5ZA 5EKTA 2B6NA 5HFNA 3S3TA 1P7CA 1WDKA 2OD7A 1E3TA 1SG9A 3WG9A 1JLKA 1J8QA 2ZKIA 2YXEA 1Q84A 2Z2ZA 2YZ7A 3D6FA 4TKOB 2GM9A 2IYSA 3DBHB 1MDBA 3OUUA 1JU4A 1Z45A 2QJFA 2WTAA 3L8ZA 6GPBA 3RAPR 1U80A 3WGQA 3I55B 3QH4A 4GI1A 5EQFA 1KOJA 4OHCA 4C4PA 2CDAA 1Y48E 3ANYB 1RWPA 2AMYA 3CIOA 3QFTA 3ASUA 6AT1A 1RWVA 4E11A 1FFYA 3KZKA 3ZGLA 2HLNA 1ZUNB 1UKEA 2IYFA 1QNLA 2INGX 1L5LA 3I2GA 4QM7A 1BKYA 2AUNA 4OSEA 2GK7A 2OCLA 3DTYA 3RBVA 3VPDA 5B30A 2NMVA 1ISHA 2EGHA 1HSOA 5LCXA 3BY2A 4B3RB 5T41A 1AN0A 4FXUA