2D2VA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp.pcc6803 in complex with maltose
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
244
structure length
244
Chain Sequence
MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein slr0953
publication title Crystal structure of a cyanobacterial sucrose-phosphatase in complex with glucose-containing disaccharides
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Hydrolase
total genus 94
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2d2vA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 2d2vA02
3OPXA 4GXTA 2JAUA 1L8LA 2I33A 3B9RA 3AR8A 3WK8A 4DCCA 1TJ4A 4HGNA 3OCZA 1XPJA 3PDWA 4Y2TA 3BWVA 4UMVA 4Y3UA 3QU2A 2CFSA 3AR7A 2HX1A 3QNMA 4UATA 4ZEVA 2GMWA 2YMLA 4PNHA 4KNVA 3U7GA 4AS3A 5ALJA 1QYIA 5AK6A 3WKBA 2R8YA 5AM3A 3N8GA 3QU4A 3N28A 4G63A 2P27A 1JUDA 4EZEA 1Q92A 5AW7A 4UU1A 3FVVA 4YCMA 5FP0A 1U2SA 1Z4OA 4OD0A 2WF5A 4BNDA 4BBJA 2C88A 3N5KA 3A1EA 2G1AA 1LTQA 1RKVA 3KDPA 5IT4A 2Q4RA 2C4NA 2RARA 3SHQA 3L0BA 4L6CA 2HEGA 1L7PA 4L6AA 5AW1A 1Z4QA 5AESA 1RLTA 3WK5A 3P96A 4CF4A 4KX5A 3U7HB 1RC8A 3I76A 4QQFA 3L1UA 3QGMA 1J97A 3UM9A 2RBKA 1AQ6A 2ZOSA 1RQNA 5ALHA 3NALA 2B30A 1T5TA 3IRUA 4XE5A 3VAYA 3OTQA 5AVSA 3WKAA 2EATA 3E58A 3L0CA 3HLTA 3QU5A 5AI9A 2MSNA 3HYCA 2IA5A 5ALUA 1QH9A 2WF8A 3J7TA 5ALPA 2WHEA 1Y8AA 5AKZA 4CF5A 4KYTA 3A1DA 2ZBGA 4L57A 3W5AA 5AI8A 3ZVLA 1N8NA 2D2VA 5AVVA 3B8EA 1RDFA 3EPRA 4NAVA 4QJBA 5ALRA 1NRWA 4UAUA 3WKCA 1Z4KA 4YCLA 2B0CA 1RMTA 2I6XA 4G9BA 2CFTA 2R8XA 2AGVA 3ZX4A 2WF6A 1YNSA 2FUCA 2W4MA 4OFZA 3UMGA 5AI4A 4C4SA 3WK4A 3AR2A 2HHLA 1ZD5A 2EAUA 4J03A 4UMEA 4AS2A 2HOQA 4BEVA 2HSZA 3ESRA 3U7FB 3R09A 2BDEA 4IG4A 4MWOA 3E81A 5ALOA 2FPSA 5ALNA 5AK5A 2VKQA 3ZVNA 2P69A 3QUCA 1L7OA 2YJ5A 4FYPA 5ALGA 5AW3A 3AR4A 5ALIA 1Z4JA 5AIBA 1Z5UA 2RB5A 3MN1A 5AKLA 5ALSA 5AVQA 1WPGA 2R8ZA 1Z4LA 2C8LA 3QU7A 2YMPA 3ET5A 4UW9A 2GHQA 2FPWA 2WFAA 3S6JA 2FPXA 4OCZA 3E84A 3AR5A 1U02A 4XPZA 5E0OA 4F72A 3A1CA 2IYEA 5AW5A 4Y2UA 5AKKA 2B1RA 3GYGA 2O9JA 1ZS9A 4O8CA 2YMMA 2YY6A 3ZUPA 4KNWA 4Y2JA 2NO5A 1WVIA 2G80A 3M9LA 2QLTA 1Z5GA 1K1EA 2EARA 1Z4NA 5AKJA 4C4TA 4EX7A 4UMDA 4KN8A 1Z4MA 2OA0A 3W5DA 3MMZA 1RMYA 1ZD2P 4NABA 5AI5A 2BDUA 2FEAA 3ONNA 4JDPA 4ZEWA 1EK1A 3L0YA 2I55A 3DV9A 2P9JA 3FZQA 2HI0A 3SLRA 5AK3A 3ZX5A 2FPRA 4Y2QA 3OCUA 2ZBFA 4EENA 1RQLA 1Z88A 2JGAA 1QQ7A 4YCNA 5ALFA 4Y2RA 4JB3A 1SWVA 3L8EA 5AW8A 2WF9A 3TLMA 3KD3A 4NWIA 3QUQA 3QLEA 3OCYA 1WR8A 3NAMA 2YBDA 1L7NA 2P11A 2ZG6A 5AVWA 3L8HA 5AICA 5AVUA 2C8KA 1L7MA 3KC2A 3WKDA 2HF2A 1QQ6A 5ALXA 3EF1A 2B82A 4HAIA 5A3QA 2YJ4A 4CE6A 3QX7A 2C9MA 5ALDA 5AKXA 4MUMA 4KX3A 4CF3A 3U7EB 2FUEA 4XOUA 3WK7A 1S8OA 1U2TA 2G06A 3U19A 1ZOLA 5ALYA 4UM5A 2RAVA 4Y2PA 1S2OA 2AUTA 1EK2A 1NF2A 3OCWA 4UAVA 3SKYA 2G07A 2FI1A 3ZTWA 3OCXA 3M1YA 3R9KA 3I1YA 3ED5A 1U7OA 3UMCA 1SU4A 4EEKA 3CNHA 1RLOA 3L1VA 3NANA 1VJRA 2I7DA 5AKIA 4HYTA 5AW0A 3RFUA 2YN4A 4NFLA 3FPSA 1CQZA 4CNQA 2AMYA 2O2XA 1ZRNA 4BKMA 4BX3A 1F5SA 2ZBEA 5AM5A 3NUQA 5AHXA 3NASA 5AKYA 1RRCA 2NO4A 1RMQA 1ZRMA 2JAOA 4UARA 2MU1A 1XP5A 3QU9A 2ZXEA 3RF6A 4DFDA 1X42A 1TE2A 1U7PA 4XQ0A 3MPOA 4YH1A 2I54A 4ZEXA 4I9GA 5AVYA 2I34A 1L8OA 5AKGA 2Q4TA 3ZW7A 4J2TA 4IFTA 3DNPA 2HCFA 5AI0A 3AR9A 2B8JA 3EWIA 2R8EA 1MH9A 2PQ0A 2OYCA 5AVTA 1YV9A 3FPBA 1PW5A 4BX0A 2HF7A 4GIBA 5ALTA 5ALQA 1T9ZA 3ZU6A 4BNDB 3L7YA 2CN1A 4HGRA 2YFYA 5AM2A 5AW6A 3L8FA 2G08A 2BY4A 2Q5EA 3ZWDA 1O03A 1TJ3A 2WM8A 1TA0A 3ET4A 1QQ5A 2IOHA 1VJ5A 5AIAA 2B8EA 3QYPA 3QXGA 1YJ5A 4DWOA 2PR7A 3PGLA 3WGVA 2GFHA 5AVRA 5IS2A 1XVIA 2OBBA 1RLMA 2ODAA 3KOOA 3L5KA 3N07A 4B6JA 2JARA 2X4DA 3AR6A 4UM7A 2NYVA 5ALVA 3R4CA 2IOFA 2ZBDA 1Z4IA 5AK4A 3NIWA 4FFDA 1YMQA 1Z4PX 3IJ5A 5T41A 2JAWA 4OHFA 4Y2YA 3NRJA 5AM0A 4H1WA 4YIHA 2YJ6A 5A3RA 5AM4A 1VFPA 3AR3A 1YS9A 2W11A 5AVXA 1RPZA 4UASA 1CR6A 1Q91A 1L6RA 4HGOA 3WGUA 3WK9A 4YIKA 4Y2XA 4BYGA 3U13A 2IOFK 4RETA 2HDOA 1J8DA 4F71A 2G0AA 5A3SA 5ALMA 2OM6A 3PCTA 5ALKA 4BEWA 1ZD3A 3E8MA 3SF0A 1T5SA 1YDFA 4EELA 3BA6A 3MC1A 3PGVA 3W5CA 1IWOA 3FGOA 2PKEA 2YJ3A 1O08A 5AW9A 3FM9A 4Y2SA 1SWWA 2W43A 4RESA 1FEZA 3DAOA 3W5BA 4UU0A 5AM1A 2WF7A 1LVHA 1NNLA 2YMQA 5IT0A 4NV0A 4BX2A 3SMVA 3ZWKA 3CZ4A 3D6JA 2CFRA 2GHTA 3OCVA 3QUTA 4AP9A 5AVZA 2DQSA 3ZVMA 2FPUA 5AKEA 5AW2A 3KBBA 3KZXA 3A3YA 5AKHA 3SKXA 4YGYA 1ZD4A 1KYTA 3K1ZA 3B9BA 3ESQA 2GO7A 2B1QA 3F9RA 3QUBA 1RKQA 3U26A 4E88A 4HGPA 5AI6A 3DDHA 3SD7A 3L8GA 2QYHA 4EX6A 5ALEA 3ZI4A 2AH5A 1ZJJA 3IB6A 3I6BA 1TJ5A 3WKEA 4Y2VA 4UMFA 4C4RA 1RKUA 5ALZA 2FDRA 1WZCA 4DW8A 3ZTYA 4I9FA 3I28A 3EF0A 2G09A 5ALWA 3N1UA 4FE3A 5JJBA 3UMBA 5AW4A 4HGQA 1N9KA 5ALLA 2HO4A 3WK6A
chains in the Genus database with same CATH superfamily
1G42A 3BIFA 3FTCA 2DFDA 5DHSA 2UU9B 4BB9A 2VYFA 1N0UA 1TJ4A 4ZKDA 2NUBA 3HACA 5A9SB 1K7SN 1BNCA 3D6AA 2XCRB 5H3CA 4KWHA 1FW6A 4M9SA 1NN1A 1RP1A 4OHYA 3RH0A 4R9UC 3ZCPA 4JBYA 5K3FA 1MJHA 1FVXA 1TFRA 4P82A 4F8JA 2YXNA 5DXFA 1HDZA 3FCOA 3I30X 3UUWA 1U3FA 4JL5A 2N1MA 1UXOA 1G8AA 1I10A 5I8WA 5T7BA 3AUKA 5F35A 1LRJA 4NLLA 1AK9A 3QU4A 4GBJA 1Y98A 3HXOA 2QE7D 3O4RA 3LLVA 3OAAA 2IEZA 3B5JA 2C1ZA 3CINA 3D31A 3DBIA 1PNQA 2WT9A 3RYHA 3K6RA 2GN1A 4DZZA 1QYVA 5IEBA 5I3ZA 3I2IA 3DP7A 2CJYA 1QHSA 5BUQA 4H17A 2CL0X 2BGKA 2QK4A 2BHTA 4ZDJA 4XWGA 3GRCA 3S99A 2UDPA 3A3NA 3OECA 4HS9A 2O3JA 3C16C 5LUBA 4JI6B 3ASYA 2DX7A 3KKNA 4KXXA 2ZTSA 4TMTA 2GN0A 4X6UA 3GRFA 3T4EA 1DKMA 1Z2EA 5ICEA 1C0IA 5HKKD 4AJIA 3MCVA 4AZTA 1IXRC 2QU8A 3JARB 2ZB7A 3IT3A 4URWR 5EC8A 4DRZA 5JPCA 3ZQ6A 3QPDA 3R9XB 3D0KA 3U31A 1T43A 3WNVA 4B7ZA 2ZR7A 1XAHA 1VE7A 3P96A 4EVQA 2YIDA 3L0IB 2VQEB 5EP1A 1RC8A 2JVIA 4YAKA 1AURA 2ZPTX 4IG9A 1J97A 1KIMA 2EG9A 3PQ8A 4M0MA 4UUOA 3CRNA 2B5VA 1JEEA 2NVUB 4CM9D 5JWHA 3NAQA 2G4CA 3I01M 3EVFA 2SHKA 1RQNA 1E2EA 4TYPA 4CMJA 2OEPA 4NJMA 1T5TA 1IVNA 1P8JA 3ZEAA 1E9DA 1R5JA 3SC6A 5AVSA 5C34B 3LQFA 3GJ4A 3BRWA 2WYHA 3K9BA 4LN1A 4IYJA 3E58A 3AZPA 4RIHA 4UEKA 4YFVA 5DK4A 4BECA 5J4LA 5L51A 2QY9A 1ML3A 3QPAA 1N25A 1DSSG 1XKQA 2A14A 3TI9A 1CY0A 1DQYA 1JBQA 1GYRA 1J9GA 2B1JA 2C7BA 1VCOA 2JAQA 2JIBA 2QL6A 3FPGA 3GGSA 3K94A 4Z8YA 1IC6A 3SZUA 3ENVA 3T5DA 1PR6A 3W7VA 5HP4A 2AFIB 3D6MA 5KNDA 1LWOA 1NW5A 4KWIA 3WGGA 3PR2B 4QDUA 1C29B 1G66A 1GUDA 2D2VA 4MVJP 1DQSA 1UAAA 3I4CA 3BJEA 3I2FA 1XD8A 1ZINA 4MWSA 3UNXA 4PGMA 1SKAA 4OA8A 2RBGA 3BERA 4A3DB 1XT6A 4M8KA 1E8NA 2P4UA 4R1UA 2Q7XA 4YCLA 1C8KA 4IWXA 4LOHA 1RYDA 1J5EB 2E85A 3M9WA 3IEVA 3CKKA 2AV6A 2PT6A 3GVHA 1QHHB 1YI8A 2FHPA 2XNDA 3HH8A 2WP0A 1UJ4A 4WJKB 4MCJA 1VRWA 2R8BA 3E3LA 4RENA 4IV5A 1JQ5A 4G8CA 5EIBD 5HTOA 3ND8A 1GPDG 1O58A 4XIIA 4ZQCB 2QKYA 2B1IA 2R7NA 1ORVA 4AS2A 3HL0A 3OE5A 1A2QA 2IBMA 5EOVA 2SCUA 3ZJYA 2VTBA 4RNCA 1SD5A 1OASA 4FZ5A 4KI7A 5AK5A 3RZDB 1NNEA 3MXTA 5FQOA 5KNDH 1CIPA 1KAQA 3PWKA 3BEDA 1IG0A 2HBRA 3EOZA 4BNNA 3F4LA 5A4JA 1R10A 2UVPB 1FX0B 3FDZA 3TL6A 3PC4A 4MQFB 1NF3A 4MVJA 2NSYA 3OSZA 2B7BA 3JQAA 3NBQA 3ZHXA 5FPYA 2QTBA 4FEAA 4TTQA 1M8FA 1FYVA 3SXPA 1EX1A 5ELMA 2CKMA 5A9RA 2YMPA 1L3CA 2QA5A 3OOEA 5KHAA 2IV7A 3WNCA 2NZUG 1E1KA 5BW5A 5C18A 1G38A 4DLKA 1N33B 1NHGA 1DPGA 1GR0A 3HO6A 2IFTA 3H9JA 3L9WA 3NWPA 2ZSBA 1GUBA 2FMTA 3P94A 4YAIA 3GLVA 1J8FA 3I39X 2PNJA 3T1TA 4FC6A 5J63A 1B00A 4JYCA 2IZ5A 3LJKA 5HOQA 2O8EA 3RSGA 3ACDA 2DTEA 1CQIB 1I4EB 1BJKA 1HDCA 1PKXA 2PMCA 2RGYA 3D3NA 1FXWF 3QY9A 1ZS9A 4M9RA 3WB1A 2J3LA 4B3GA 3C5WP 4P93A 1DQPA 4EB3A 2RGNC 4AROA 1U80A 3O1HB 1UPAA 4BKQA 1XDZA 4OLJA 1K1EA 2CEAA 3MM4A 3GBSA 1QF7A 4MV4A 3X2SA 1KJ8A 1U0GA 1GTMA 1M1YE 3GEBA 4P7GA 1YOVA 3T5GA 3PEEA 2VP0A 3CEAA 2IXBA 3QKRB 5EKSA 2P0AA 2X1VA 4AMZA 3MB8A 4RTQA 1UODA 2QHXA 1RMYA 1VIVA 1EWQA 1LDEA 3W9UA 2GERA 1GQRA 3PUYA 4MB0A 4TWBA 1LJUA 2P7IA 3R7NA 4RK0A 1PV4A 4B7AA 5HIIA 5BN1A 2H54A 1T1IA 2RGWA 4DZTA 1WCXA 3DV9A 2PYDA 3E5HA 4QATA 2WAMA 4YS6A 3KFVA 3WNQA 2OZEA 1BGVA 3EC2A 1HFEL 2LVBA 3H3XA 3QYFA 1JFSA 4QGAA 4EBFA 4F56A 1GEEA 3EQ8A 1X92A 4J1TC 1QPZA 4YCNA 2QTHA 1DWUA 3AF4A 3FWNA 1GHTA 3DD5A 3JQ9A 3LK7A 2D1YA 3I8XA 5ALFA 1U99A 5KREA 1JMKC 1KO4A 1JSRA 1JLMA 1PWEA 1IOZA 2ICAA 2WD7A 1O7JA 3CBGA 3G5TA 4GI1A 2DLNA 1KFJB 2RH8A 1DHTA 2CXTA 1YB5A 3BAZA 4IQ8A 2B4TO 4U2BA 5TJ9A 3PE3A 4U5QA 1BH6A 2HFKA 2JRLA 5CB4F 3PXXA 3TIXB 1UR5A 3WGQA 3WIEA 4BPRA 5CCXA 1Z6ZA 5HPYB 1L7MA 2BJVA 4P7KA 2G3YA 3I05A 1S2NA 4BMXA 1Z3CA 1E3LA 4PZYA 1XPRA 1T4DA 2B82A 1CB0A 4B7UA 4LPSA 3EA0A 5B58C 4ENTA 1UINA 4F12A 3IUNA 3GBVA 3MS7A 2O8CB 1E6MA 2VDVE 3H2IA 3IQFA 1NJSA 5BOSA 2SICE 1ECCA 4DLRA 1DIHA 1KXJA 5CRIA 5THQA 2EW1A 1ZGCA 4Y8VA 1YI1A 1XXHB 1K8XB 3MFQA 4KQMA 2EG5A 3MGCA 3ZXYA 2W83A 3IVXA 3R5SA 5I7WA 3PC8A 3HP4A 4TKUA 1ID8A 2CNBA 1S8OA 1TQ6A 3E3AA 2QD1A 3FUXA 3NIFB 4NFSA 3MMXA 4FHFA 1J9ZA 1XCJA 1NQTA 1ADJA 1XAIA 2GZSA 3Q2KA 5ALYA 2YV2A 3HB9A 5KKAA 3KQSA 2QJTA 4UM5A 5DNVA 3FCSB 3C3WA 3WYBA 2BI4A 2UYYA 3MD9A 3JATA 2J32A 3N59A 4OXKA 2G72A 5CCBA 3BMQB 4N47A 1VGQA 4UAVA 5F4ZA 1T36B 3A6FA 4DV7B 4OG2A 4BNYA 1NI3A 4AMUA 3W6NA 1FQWA 1CJUC 1G2PA 2LCFA 2XQVA 5LQNA 1DKUA 1T1SA 1R0WA 4FEYA 2QM0A 5ECYA 2C00A 2JIZA 1SU4A 5BRNA 1PNRA 2PLFA 2ZJ0A 3LTEA 4YDSA 4NMHA 3CNHA 1HKHA 5DMXA 4CCWA 5GZ6A 4DPMA 4DUGD 4J9VA 4F4FA 5LU9A 1OI2A 1H4SA 3F9CA 3JWGA 1Z28A 1S96A 1JV2B 3ZE8A 1JQ3A 1RWNA 1MTOA 2VXBA 1ECBA 3G8BA 4R8VA 3G8CA 3LSTA 2TECE 3LWDA 3UW1A 1LXCA 3WZMA 5AW0A 4LHVA 2W4IA 3KDAA 2WD7B 5EIBC 1QRDA 1TO1E 2XD9A 5HHTA 4HX2A 1L5QA 4EBBA 2WLSA 3M6XA 1DAEA 3P1JA 1UZLA 4WRRA 3ER6A 4CM6A 3IRVA 3E05A 3PQ5A 4BLSA 1T2DA 3HJCA 3FYSA 1RZRD 4FFSA 2JGRA 4OFBA 5DHFA 5AKYA 4NEHB 3ZLBA 1QC5B 2O2IA 3QU9A 3D8UA 2ZFUA 4JJEA 2HU8A 5BOSB 4B4VA 1FVOA 2D74A 3EGEA 3QENA 3V7FA 2HIGA 1OROA 3RVSA 4JB2A 2GUWA 2OAP1 1GP2A 5FOVA 3UV6A 6Q21A 4WDQA 4XGIA 2W8BB 3WFJA 1H6CA 2B2CA 4G0MA 4C0SA 4C29A 1KQ3A 1X8XA 1FYEA 1NJ5A 4IFTA 4MV3A 5ECDA 2HCFA 1SIUA 1G8GA 2OCAA 4RULA 2B3DA 1XRJA 1QDLB 3EZLA 5FOSA 5T4FA 2EYQA 2GM5A 3QWIA 1RWMA 2FK7A 2M98A 5E4FA 4CV0A 5IASA 1JEDA 4G4SP 4E1AA 5IKMA 5AQEA 1USVA 4MRMA 5I9TA 2AG8A 2KLHA 1Y1SA 3HHEA 4UBNA 2F1IA 4NCBA 2WUEA 1XP8A 2Q2QA 5H59A 4IHJB 4NSNA 1PW5A 2YZ7A 4EKGA 5F3WB 1W93A 1YVUA 3J80A 1VKHA 3DUFB 2J3DA 2NV0A 3QTLA 5ALTA 1GPBA 4GZ3A 2C61A 2I4LA 4HXYA 2GYUA 4DXAA 4WNYA 1OVGA 2RIRA 2HWXA 4XVQA 2YFYA 2GVDC 1QKIA 1WVMA 4TTVA 4KR7A 4L28A 4OY3A 3OJFA 4N8EA 2J9YB 3OQ6A 4X41A 4ZOAA 4FS3A 2AL7A 5JLJA 1FW8A 4CIXA 5F64A 4CMBA 1E0SA 3LA8A 2WEKA 1MX5A 4G5FA 5EIEA 1YAJA 5GVSA 1TA0A 1EQUA 4M76B 3T7EA 1L7BA 2Z5LA 2OWEA 4K05A 3SE0A 3QXGA 3JV7A 2ZI9A 4ZEMA 1G3MA 2AS0A 4UVHA 1ZHHA 5KSPA 1NKVA 1USUA 2G7ZA 4G0QA 1JTVA 1DWQA 3DQPA 1KTVA 2ISSD 2I1QA 4X93A 4W5OA 4ZALA 1UPCA 1Y34E 3P0RA 5ITWA 3FVTA 4PYNA 3WWEA 1V8ZA 2OVBA 3L7KA 3RS9A 3ADDA 5G4KB 1N7HA 4FGKA 2PWYA 1G7RA 1BDIA 1TZKA 3E70C 3I9OA 1QLJA 2W8BA 1FYDA 3O2JA 4KVGA 1EVIA 3NRJA 3OWOA 3JXEA 4H1WA 4X90A 4PAQA 2H7YA 4CKYA 5DTJA 3NJRA 4KGXA 5IXYA 3R5XA 3CUUA 3N2EA 1C1HA 1WS6A 4EA7A 4CL0A 2GKOA 2ZBQA 3MELA 4W8GA 3BGSA 2HMUA 4LI0A 5K0EA 1Q91A 2HB6A 3NVDA 1XEXA 4R7TA 1GD1O 2HRQA 2QX7A 1K4KA 4FR5A 5GONF 2R93B 4BYGA 5JV5A 1WUJS 4PM4A 1E79D 2XUHA 3O47A 2BC9A 2XLCA 2Z4SA 4BY1B 1S6YA 2EBFX 5U1PA 3VPAA 2FWNA 3UWOA 5KWSA 3IKTA 2VZEA 1BN7A 2ECOA 1ULBA 1YDFA 1NNUA 2PWZA 1UWVA 2BFCA 4JFRA 3SF0A 3VR4D 2BFFB 4NHEA 5B7GA 1D7AA 2C4KA 1NLUA 5BWLA 3PD1A 5BSVA 4FJ0A 3OT1B 2OFFA 4AN4A 1XPUA 1PZXA 3VR5H 3A1NA 2DPXA 3CX3A 4QUKA 3PRJA 4HQOA 1G21E 3LMKA 4N0EA 1K5GA 2BSXA 3A1SA 2CLKB 4GOOD 4JA0A 2PUAA 1WWKA 2VCYA 4DMHA 2Z43A 4MVJH 1FFHA 3TL3A 1FDWA 3WLKX 2F9LA 2ZIXB 3WMRA 1UKZA 1MEEA 1H8ED 1YQDA 1ZO8A 2E9SA 2OBXA 3G1TA 3PEFA 1KEEB 3KKOA 4G8JA 4H16A 3OICA 1ODSA 4HVTA 4MMYB 1T2FA 4BX2A 4J7UA 4IHJF 1CQWA 3N87A 3TQQA 4DR6B 5IMSA 3JWPA 3LFUA 2DQSA 1F9AA 3JR7A 4NYMR 4MW7A 3KBBA 5F1KA 4CM1A 1E0AA 2XKJE 5K3CA 3CLSC 3DCJA 1PS9A 1PJ3A 1U5BA 3TRFA 4BAGA 4E5KA 5CVDA 1AN0A 2YZKA 2O8DA 4LVOA 1OHHA 1U2PA 5L4LA 1SVLA 4QDZA 1SFOB 4YVFA 4FCWA 4C0BA 3F9RA 1IM8A 2VT3A 3ZZUA 2P9CA 2WTXA 5TVKA 1KS9A 1I9GA 1KA9H 4FDAA 2FGKA 4I9NA 2VNSA 5EMMA 3VYWA 2Y1WA 3JASB 3ZNQA 5IAJA 2JJQA 3FKJA 1IHUA 1PVDA 3GZTB 1ZK1A 1PS8A 2WD9A 3R20A 1SHUX 2P78A 3WNBA 1CJCA 4ALKA 4DBVO 5T6MA 4C3JB 5DHRA 1JKFA 3KPWA 5ALZA 2C9ZA 3R8CA 1PEAA 4E70A 3JRXA 3T7AA 1OIWA 4N03A 4I9FA 3ZGZA 1SPXA 3PRKE 1OAOA 1EVYA 1UPFA 2BFMA 2J5RA 3DE1X 1QNFA 2I3GA 3M5DA 4HGQA 3VTAA 4JJ8A 1SQ0A 2E4XA 2VTDA 2X7HA 1RZVA 3OPXA 4LBZA 5E6SB 5CG1A 1Z8DA 4DWVA 2V7WA 5E3IA 4EJSB 4PQYA 5JLAA 2IHJA 1U0JA 4UVDA 1IN8A 4QJ4A 4YQEA 1U7WA 3U62A 3IJPA 2WSYB 2BM9A 2QX9A 5L7WA 1C9KA 2ZSKA 2YY5A 4TT3D 3ER9A 1EDDA 4K6CA 4UE6A 1Y9AA 3UC5A 1V6SA 4NV1A 1L5HA 4GKBA 2JRCA 1COZA 3OE4A 4C9BA 1F6BA 5CFRA 1Y1LA 1CEXA 2HFJA 5ARBA 2HEIA 3N8GA 1N8TA 1K6XA 1ZPDA 3A28A 3UANA 4QAJA 4PN3A 1XTRA 5A6VA 2XE4A 5DXJA 3IBCA 5CPBA 3ITDA 4EI8A 1N8SA 1ZJ6A 3FVVA 2X8BA 1DXQA 5FP0A 3HFJA 4TKVA 1OLXA 5EE1A 5LLDA 3MT9A 1O94C 4Z9XA 5A6SB 3CLUD 2HW8A 4B6SA 1FSGA 1JVSA 1UZUA 1RKVA 1FLVA 2MSKA 3MINB 3P9RA 1BX1A 5DNUA 1FCJA 3EIUA 3KT8A 2Q4RA 4XEHA 1K7XB 3PF8A 5JVDF 3LOPA 4A2PA 5FIUA 3JD4A 3T3MB 4CM8B 1AXEA 4V02A 5CA0F 3HKZB 4RE6A 4U9UA 1ZC3A 4PCLA 3UOAB 1CG6A 1SD1A 3OC6A 4HB2A 4M9CA 4R1QA 3IOEA 4XPIA 3JAMA 1I7SB 1H2BA 2MJLA 3WLFA 5JQGF 2HJWA 4RHUA 2AX3A 2X0FA 4BGUA 4KO1S 4O2AF 4WIAA 4F3RA 1I2CA 4XVUA 4RSHA 1GA4A 2GK7A 2PYZA 3A70A 3CB4A 2QD4A 5F78A 4GR4A 1NLYA 3IRUA 4NJEA 1FJHA 4ZDWA 2IBSA 3ZBPA 2XCUA 1PLKA 1NPTO 1NXPA 4NYIQ 3G5MA 1LSOA 3D3JA 4YCDA 3DLIA 2P35A 1U7XA 3Q10A 5DIFA 4EJSA 1H1DA 5IXJA 1KJYA 2BFNA 2G9UA 3DMDA 2NWQA 3CH6A 3HYCA 3HRIA 1ZJ5A 4OHOA 4YCBA 2OILA 3WV5A 4E1VA 1A1SA 1KJJA 3LBYA 5A0FA 2BLLA 4ALJA 4I55B 2JW5A 1TYBE 4HNHA 1OBVA 1PNTA 3P0EA 3ELYA 4AVYA 4C89A 2E4VA 2RK4A 2CXXA 4QHSA 5P8WA 2QRNA 4R2KA 5IVPA 4Y6QA 2P90A 3EARA 1H69A 1V5IA 4Z86A 1ETHA 2C5GA 4MJ7A 3EPRA 2BTEA 1QGED 2ZIUB 5BUCA 2OP0A 4FJ1A 4F9TA 3TZLA 1H93A 1Q21A 4UAUA 1Z4KA 1G64A 3OQHA 4PS1A 2RH9B 4WCFB 1YKGA 4YGXB 4IL5A 2H3EA 1LU9A 1N78A 4XFJA 1I6MA 3A4MA 1H2WA 3PQ2A 1V9LA 3TWOA 2W4MA 4EARA 4FXPA 4UNQA 3KZMA 3KVVA 5E7JA 1NBMA 2HADA 1G19A 2HF9A 2OGTA 1XVUA 2AJBA 3R0JA 5K5EA 1E2GA 2HHLA 1NQXA 2Q6OA 1FY2A 5JFTA 4RKWA 1DP4A 2GCIA 4XR9A 3V4SA 1AKVA 3VJMA 2Q5FA 3NXSA 3L7CA 4XXHA 2B7LA 3FHCB 1TTHA 1VHTA 4ZK2A 2E87A 3DFMA 4PGHA 1R0BA 4MWOA 4EG0A 4HUTA 2MSCB 1WD5A 1IULA 2NU7B 2QTMA 4HN2A 1KKMA 3DBHB 5JARA 4Z4IA 3ZVNA 4DB2A 1W6RA 1QGDA 5EXSA 2G28A 5ALGA 5AW3A 1W5AA 2DUJA 5FBKA 4KXVA 4DSNA 4YAWA 3FDFA 1V5FA 5E4YA 1II8B 1W48A 2G76A 2CXSA 3B9QA 4EI9A 1E2IA 4CKBA 4RV5A 4W82A 2AG1A 3NEPX 2X0EA 5CNMA 4DDMA 4NJEB 4U2EA 1OXTA 2Z8YA 1MB9A 2H2FA 4ZOLA 1VHLA 2FPWA 3F9IA 3HABA 3BC1A 5JH7A 1F4PA 1WVGA 2J3HA 2VYQA 3E9MA 3K20A 3EIFA 5GOTA 2XXJA 2JFXA 3BF8A 4GQBA 1KHHA 5LD2B 5EZYF 3ZDYB 4WZ6A 3HY6A 3U9LA 2IYFA 1ISFA 3O2QB 3QKIA 2XUJA 3MTQA 1T0UA 4P8RA 4RGVA 5E9AA 1XMXA 2JJ2D 4CLRB 4NXMB 1Q22A 2OFWA 4DT1A 2G04A 5SZJA 3WA6A 4BLUA 5DNDA 4JV5B 2VL7A 2JJ1A 3ESAA 4ACAA 1H22A 1OFGA 2PZ8A 1A4XA 1IJKA 1BE6A 4I8IA 1HA3A 3OZFA 3PDIA 1NJGA 4GSYA 1D6NA 3Q87B 1NVKA 7MDHA 2FLWA 3F0TA 3SDSA 4I5FA 3PRYA 4WXYB 1HE5A 1ZIOA 2FPIB 1P73A 3IAS1 3KQLA 1E4OA 1F6DA 5DBFA 4HUQA 2JA1A 5EKUA 3P4YA 4B4DA 4CV1A 3WGKA 1SUPA 2XCQA 3EUAA 3MLBA 3RC3A 2H06A 3EAQA 3SX2A 3R3HA 3Q12A 1TW2A 2IEIA 3B2NA 4FE4A 4WH0A 4FYHA 3LFHA 3UT5A 3QIAA 1XWFA 3ONNA 3SZLA 4ZOQI 1F6WA 1C80A 2ZUUA 1FUYB 3DMYA 3GLFB 1B76A 4Y7NB 1EHIA 2FA9A 4B79A 1N9ZA 1B42A 1XN4A 4L9WA 4CGZA 3G2HA 3FIJA 4ZCQA 4ND1A 4PGAA 2EWVA 1BVYF 1G7CA 1TZJA 2R1TB 4TKMA 3WYDA 1YIOA 1DTWA 1YULA 4WJZA 1MEOA 1E64A 1YZHA 3ST7A 1PBNA 5L53A 3ZE2B 4RHXA 1P60A 4C2BA 3F8SA 4E22A 3P5SA 1O94D 2Q4BA 2W6OA 5FWXA 3QELA 1S01A 4F1WA 2AC7A 1PRYA 3PQ7A 2FDXA 1H4QA 4CKBB 3L8EA 5JJLA 2R7ZB 2YVAA 3TLMA 4O08A 3R5TA 4NWIA 3RBZA 3MBOA 2ZWIA 3R2JA 4BNVA 1EFHA 1F2DA 2ZG6A 1IDOA 5AICA 3QF4B 1Q83A 2H65A 1UC8A 1Z15A 2AE1A 2ORYA 4RY2A 4D8UA 5U9CA 2YU9B 3TBKA 3U4GA 4F4JA 3H4IA 1QQ6A 3A1VA 3KTAB 4DEVA 2GXUA 3NHJA 4Y9RA 2GYVA 5JCXA 1R6AA 2PZAA 3V8RA 1IAVA 2ARKA 3CB2A 1DMSA 3R3VA 3ZBUA 1EXMA 3VO1A 4BVFA 4EL5A 1EHYA 4ALLA 3ISJA 3Q3IA 1LF5A 2ZB2A 4N40A 3PDIB 3P9YA 1XROA 2ZDHA 4AJNA 4IRUB 2NPIA 3AM3A 3N2GA 4JCOA 3TLEA 3ANTA 3NFRA 4D3XA 2HSJA 3PEWA 1GG9A 1LSUA 4B84A 3CPEA 2O57A 3C6BA 4UE2A 3WSTA 4DKJA 3D5TA 5I9IA 3FNBA 1NQ5A 4ZKEA 4N7MA 3IQGX 1ZICA 3OCWA 1H66A 2BGMA 4EPYA 5L3QA 4NK4A 4UDNA 2Y4NA 4E7PA 1G8HA 2FI1A 5DWDA 3NWBA 1PFGA 4XKJA 2OM2A 4A5SA 5DTRA 5CW1A 3QRWA 3I1YA 1YXMA 1ZH4A 3JWIA 2AFIE 3LUDA 4OXQA 4HT3B 2AB0A 4HDMB 3O8RA 2R1TA 2EW2A 4BLRA 1UZAA 3GH3A 3H2JA 3O9VA 2UYCA 1DIGA 3B20A 1VKNA 3DULA 2DM6A 3ZHQA 2FF5A 4GOND 1SBIA 3PJDA 4MJLA 5EUBA 4QHYA 2JHFA 2C58A 2WYUA 1ZZEA 3LC2O 4JL8A 1GQYA 2YN4A 3DBLB 1KO1A 1U3WA 2G71A 2WAXA 2I1VB 3VYVA 1L8QA 3VR5D 2PO7A 1Y48E 3MRTA 3SXUA 3L4JA 1R1DA 5JD3A 2B83A 4NZZA 3K7EA 1V26A 1GPYA 2RHLA 4CW7A 4ESEA 2NVBA 2IHZA 3IC5A 2ZI5A 3KPVA 3A25A 4OHKA 2BV3A 5F2OA 3TN7A 5BR4A 3RSZA 3NASA 5I7FA 2KYRA 2QLMA 5CLGA 1G8MA 2C2WA 1J24A 3TPFA 4GOKA 1U3GA 3GN1A 1U2GA 4RY9A 2E4YA 3IT0A 1XP5A 1LA2A 1LX6A 5ERXA 2ZXEA 3MWEB 1UJNA 5JMPA 3TLAA 1CUDA 3B12A 3BMOA 3DM5A 3VZPA 1ISRA 2HIAA 3AH8A 1BZYA 1NF8A 2NZXA 3OFJA 3KQQA 4H4CA 5ICFA 2BM1A 4ZP1A 4B35A 2I34A 2QTWB 3WLRA 3EK2A 1P1IA 2VK4A 2KLBA 3LV8A 3N2GB 4PU0A 5CYFA 1ZN7A 1F0PA 2WYOA 1XWIA 2WYIA 2E4ZA 2QBYA 3DLCA 1VI6A 1XCBA 2B8JA 3TDKA 1L4YA 4CKEA 2BL4A 2ZRQA 5JDCC 3TW8A 4F5ZA 4CM9A 4C7OA 2JZNA 4ASUA 1OFVA 2XAAA 1ORTA 3AETA 3PC6A 4E2ZA 2XUQA 4RTMA 2GD2A 2CF6A 1KTIA 4F2PA 4BFWA 1TO6A 2J0EA 3AKZA 1NIPA 5LYJA 2QB5A 4ZQEA 3WL8A 1B14A 2O3UA 4EKEA 1NDHA 1XVTA 3C1OA 5JSZB 4G1BA 1QKKA 1OFIA 4HDMA 3HM2A 1Z0SA 1H9CA 1HRKA 1LQUA 2DHRA 3DMPA 4FU0A 4MAAA 4JLAA 3BD6A 4NBVA 3ZCVA 5TLSA 4US0R 3HJTA 5K0ZA 4G4GA 2XZDA 1CS0A 1SQ5A 3OMLA 3KJXA 1Q0UA 2WABA 3OFKA 4MW1A 3ZWDA 1O03A 3LGSA 1L5GB 2AG5A 4IH1A 4GM1A 1MJ5A 3JYPA 1CUSA 4UBIA 2OXIA 4UZFA 3EGDB 1ZYUA 3H5WA 4S12A 1M2EA 3LY8A 2NN3C 1GPMA 3KVOA 4X71A 5HA5A 1OXKB 4N3AA 3H75A 2RHGB 3CT6A 5TGZA 2PXAA 4PICA 2Q1WA 2G88A 3IAAA 2EGGA 5EINA 3KUCA 2ZRLA 2IYTA 4H3SA 1H3EA 2P9BA 3PGLA 4DN6A 3WGVA 1T25A 3ZK8A 5CTAA 3WMXA 4E2XA 1YDMA 3RYFA 3HOZB 1M3SA 1BS2A 2OBBA 1RLMA 1FRNA 1XQ1A 3M6WA 3HN7A 1T3HA 3VC2A 2XEDA 3S2EA 1A7JA 3KYCB 4DQVA 1J23A 4LNUA 1YZKA 4P84A 4F2HA 4IZOA 3C3YA 2WDPA 3T3EA 3K9NA 4R5MA 1HNXB 5LN1A 4LAFA 4MI6A 3GRRA 4GP9A 3CH4B 3D6TB 4XASA 1W5EA 5FF9A 3BCUA 1SCNE 2BI8A 3NRCA 1W47A 4B82A 2QBYB 4JGIA 2WB1B 2J09A 2RK6A 3AR3A 4JX8A 1PQ4A 3E4DA 3JAKA 1P4RA 4ZZ2A 4GPTA 2JC3A 3QVVA 1XLVA 2Q6KA 2HRRA 3DMTA 5FI5A 2AN9A 4MVJD 1JS1X 3QVOA 5JADA 1BDHA 1Q7TA 1UMBB 3QLJA 1OWMA 2ZJ2A 5TARA 1OFHA 3G2LA 4TV8B 4CUJA 5GIOE 4RETA 4ZVTA 4JROA 5HSGA 4HXFB 4M38A 3SJAA 4E46A 4QGSA 3P2YA 4G0VA 4ZO6A 5A3SA 2EWWA 4LOKA 3H17A 1CZLA 5JD6A 3RRNA 3B2QA 5JROA 5KSYA 4B5KA 2OM6A 4RDHA 1VTKA 2P3SA 2VNHA 2C7GA 3HJFA 3KTOA 2ZIEA 5CFMA 2VHXA 5M2QA 5CDYA 1XLTA 4MUYA 5CUQA 2NOAA 1LGYA 4EABA 3WIVA 3FMVA 3WGJA 2A9KA 4PGGA 1EBBA 1UZMA 3PGVA 4B5LA 1BQ3A 1E1QD 4RLHA 5KNLA 2GTPA 3FVWA 1ZEJA 2HV8A 3WBFA 2JHCA 2BAGA 1P19A 3EQ9A 2UVDA 4KRXA 3QPUA 4LIPD 4HQ0A 4PAOA 5D8DA 8ATCA 5HBGA 2Y1OA 5E6RB 1KY2A 3RBAA 3BL5A 1UAYA 3HMQA 1LFDB 3NKVA 2AMVA 1A8HA 1ONSA 3I34X 5FORA 4D0GA 3PYLA 4WERA 5EHIA 3FKQA 5H02A 1K8QA 2R00A 4MMZB 4MS3A 3O74A 3ZHBA 2HPZA 4GR5A 4GMKA 1RC0A 2PBFA 4RGYA 5EXPA 5I7OA 1MN6A 5CD1A 3UKJA 5G40A 2Q21A 2GAFA 1JJIA 3KYCA 4H7EA 3QVSA 1R9JA 3OIYA 1TF2A 4OBBA 3V8PA 4KCGA 4OP3A 3EODA 3AEUB 3WYCA 2AFHE 3DF9A 3CVWA 4YGYA 4UVGA 2RAFA 3D02A 1HR0B 1W0KD 3DVRX 5JRJA 1JBEA 4MI1A 3T94A 2CFCA 3DPUA 3UMJA 3NEAA 3ORFA 4G5RA 1EJ0A 3QUBA 2XT0A 3D8BA 5K3AA 5PNTA 1PDWA 5T5QA 5FTKA 2VJDA 2OB2A 5DHQA 2A1UB 4QQRA 1PEKE 4CCSA 4R51A 1L7QA 4HWGA 5A4KA 3AEQA 2IODA 3UBMA 3WKEA 2PZFA 1LBTA 3I6IA 4P35A 5BN4A 3W4JA 1LVGA 3TIVA 4P4NA 1I3MA 3C3CA 1KIAA 2QTLA 4TT3A 1GKYA 4B6OA 1A77A 1E0JA 1UKCA 3C48A 4MKFA 4MLDA 1Z73A 3PDHA 4WA7A 2UYQA 4G07A 3OWHA 1A8QA 4E4RA 4HNRA 4CZ2A 1WQ1R 4E12A 1NM5A 3VYTB 4QBKA 3DOUA 2JFZA 1NVWQ 2WTAA 1MX9A 1Y6JA 4QPZA 2CZGA 1TVKB 5M3BA 4IHAA 1JW9B 4DCCA 3RT9A 2B9EA 4QYSA 4AIIA 3K70B 1CY1A 1IN4A 3DJYA 1J5XA 1FL9A 2W70A 2FNAA 3DGFC 2FWBA 1TUEA 4KV9A 3CMCO 5CA0B 3MBIA 3AR7A 1DINA 4XJXA 4LXTA 4NULA 5FFNA 2AOUB 1EUDB 2HMSA 3UAYA 3B9PA 3CUEF 4TSFA 4AMVA 4PVCA 3THYA 2QR3A 3PFCA 1P7WA 1X14A 2FK8A 1X74A 2NSLA 1X1DA 2ZKIA 1QHYA 2FSSA 2HSWA 4V24A 1CRLA 3LT0A 3L02A 4MS3B 1DKOA 4TL7A 4WOPA 2WA2A 3TR5A 4EZEA 4ECAA 4UBMA 2IHNA 4DCJA 4BQQA 4QXPA 1RHUA 3P7MA 4I6GA 4TV9F 3R44A 1VE9A 2FQXA 3UWDA 3EMVA 4IGIA 3FAZA 3SS7X 4DLLA 5I5EA 3WQRA 2NNWB 3JWJA 2JFHA 2X0KA 3ADOA 4RXUA 3QLUC 4FDVA 1NT4A 2QD3A 2VF8A 2OV8A 3L0BA 2VJQA 3W5HA 4WN9A 2AFHA 5D86A 4AO6A 5DV9A 1Z8NA 2DQYA 4EO7A 3QIVA 5AW1A 3N6XA 2PHZA 3BEOA 1HK7A 1KZ4A 4J7CA 3U39A 2IC5A 2PGDA 4J0HA 4D9FA 2PS9A 1YZTA 4EYKA 4C0LA 2A59A 3P9CA 4NYJR 1HYBA 4F60A 3EA4A 5BN4B 4AY5A 4OHMA 5BT8A 5IZ4A 2YDXA 4NOKA 3NBAA 4LYDA 2CXRA 3O0TA 2DGDA 4UBOA 4Z6KA 2LCIA 5BUSA 4ARCA 2Y05A 1N34B 2VDUE 1E18A 3A37A 4PZAA 4B48A 4I81A 3RHTA 3BK1A 3LKVA 1DAMA 2BPOA 3V9AA 4QVIA 1NFRA 1Z74A 1BQEA 2ZJAA 4MUKA 4WFKA 4KQ6A 3KK0A 3ZD9A 1T3LA 4HB3A 2ZUSA 1M8PA 1WXWA 1SN7A 2OK7A 2R6FA 4CL3A 1CRQA 4AKSA 4PHHA 2B63B 2QJOA 1YS4A 4UXHA 3BWDD 5HYVA 1D4FA 3WO1A 5KKCA 5KWVA 3M1AA 10MHA 1NVBA 5JY1A 4O0LA 4UVIA 5ALUA 4EMTA 3HK2A 5E3JA 3ETGA 1FRZA 3HY4A 4EHHA 1Y8AA 1C81A 4GOLD 2VH2A 1YF3A 5KBYA 1EESA 1RBZA 1D2AA 1C7RA 2JDID 2MMGA 3RU9A 1DJOA 4A3JB 1YA4A 4QXMA 1GQFA 1J2EA 4RY8A 1FRFS 5LKRA 1GV1A 5F5LA 4HNUA 1DAIA 3TD9A 2C4UA 2R2GA 2RGXA 5E7QA 5C2JB 2D1QA 1OAKA 3BHMA 4W8OA 3VX3A 4JMLA 1N2CB 3ONDA 4Q00A 4FN4A 5TEWA 4QBHA 3NAGA 5D3KA 3RIYA 3L1JA 3HN6A 1UJBA 4JCCA 1P1HA 1Q1BA 3SQXA 4BNLA 3W6OA 5K0GA 3SYNA 5B64A 5J58A 2I66A 4C88A 5A1TA 3EG5A 4GUDA 2QG6A 4KXUA 4EYQA 1PK9A 4F6RA 1QJ4A 1EFDN 2AMLA 5HCUA 3GT7A 4GGOA 4U02A 4FZRA 1A9TA 2RKWA 3MJSA 3T3GA 3WADA 1GKUB 2ZS7A 3ZV7A 4FILA 2BDEA 1C14A 5DWQA 3W5JA 1Y6FA 4IDFA 4DEXA 3OX1A 4OA5A 2AMFA 1K6IA 5ALOA 4Y2GA 1CZKA 1KPHA 1ODCA 5FPHA 1YZFA 2GUGA 2YL2A 3I53A 3OU7A 4L08A 5T4HA 4LHYA 3LCJA 1QCCA 3WL3A 1JDNA 2Z08A 4W4TA 1A8UA 1CC1S 2XGSA 4GEGA 2G36A 2Q4DA 2E5WA 2VWHA 1QIIA 2Y1DA 4HZUA 2Y2VA 3GPDG 4NRDA 5AKLA 4V2UA 5E9WA 1PBTA 1MG0A 2YXEA 4RCYA 4QO8A 5ADHA 4ARVA 2H18A 2FMXA 2X9LA 4K9QA 2YHSA 3INTA 4AMBA 1XTKA 1YR2A 2HNKA 2GHQA 2WFAA 3ND9A 3GA7A 4CG2A 2Y66A 1FYXA 4URHA 5HRAA 3B6KA 3I4FA 5K3SA 4EPRA 3FLMA 4B2YA 3PEVA 1T9AA 1NI4A 4LK3A 1E98A 1J6UA 1ZY2A 2A58A 2R7MA 3KXPA 2QV0A 1Q44A 3AM4A 3LUHA 2BFEA 3OIVA 3PKJA 5KNCD 2FEKA 1I1NA 2H1FA 3EW7A 2CFOA 1MRSA 4LMAA 5J2UB 4AY3A 1A8IA 5D51S 4JI4B 3K05A 4IDQA 5DYTA 3GYGA 3BMXA 4TS1A 5FBHA 5LKAA 3RJ5A 5FPQA 2YMMA 4JLBA 5BWOA 3A10A 1MKYA 4MPPA 1QONA 1A5SB 5DCYA 1ZHOA 2JS7A 4K2HA 3C5CA 2WZDA 2XPCA 3OJWA 2NM0A 3MCUA 4JLJA 3BWXA 5J4KA 2O2GA 1O87A 3JRWA 4OFXA 2FWAA 3QOFA 2V6IA 3NHFA 1LDBA 3RG8A 3OLCX 3TPZA 2EZ8A 4YR7A 3CSSA 1U6KA 4KSYA 4NOJA 5HMMA 4RS4A 4CU5A 1WV0A 4DIBA 5A04A 1JE0A 4LXHA 1D6MA 4EB6B 3H3VC 3FPAA 2PV7A 3OQOA 4FVTA 4ZTBA 3LD9A 4F8YA 1MOZA 2DFNA 3EUEA 3FWKA 4MUBA 2GK4A 3NHAA 1EK1A 3O1JC 3DB1A 3L0YA 3HCWA 4H1UA 2TS1A 4BMPB 2FPRA 2PLWA 2J6BA 4LTDA 3PD7A 5DHUA 4RDIA 4QDKA 4WK2B 2YJNA 3FE2A 1T3GA 3IQXA 3IX7A 3OEHD 2FG7C 3OLYA 5EP4A 4KOEC 3ZDBA 1DBSA 1MMFB 4D8TA 1FE8A 3FJOA 1ENYA 1MEJA 3L6CA 4UBLA 3WGMA 4B43A 1I1QB 1ZP6A 3S3TA 1Y3HA 2Z83A 1O4WA 3OIGA 2PS0A 4WGFA 4ZCSA 2ES4A 4NCJA 4B83A 3O21A 4PG7A 4C78A 4YYZA 3FZGA 3L7LA 4DADA 2QX8A 1G20A 4P38A 4JVOA 5JC1A 1SG6A 4N6GA 1KFKB 4TN1A 1ANKA 4CR7A 1TM7E 2VHEA 3AUUA 4BC0A 2P11A 3B89A 4AJOA 1JR6A 1XDUA 4L1KA 2CSUA 4JNCA 4MUGA 3EZYA 1GPAA 1PL6A 5FADA 1W44A 3DO8A 4Z9BA 4R2IA 4TXHA 1P2BA 5CVCA 5FLXA 3ZCTA 3K35A 2NX2A 1O6FA 2G5PA 2SNIE 3EF1A 3TEFA 4CEJA 1GO2A 4U7GA 3R0VA 5D87A 2QQGA 1B1CA 3HVJA 1A4IA 3ORSA 2P2CA 1GTRA 1K92A 2FP4B 2KW5A 1JSZA 3KR9A 4R54A 1NJFA 3P9SA 5CPFA 2E55A 4IDCA 2WYVA 3GBPA 4S0ZA 1CY6A 2HH9A 4RFSA 3D3WB 4DA6A 3KV1A 2GN9A 3UO8B 5CEJA 3PK0A 3RODA 4J8PA 2EDAA 5DYIA 2PUGA 2Y1KA 2ZSUA 3L4BA 3UAXA 4L02A 2RDMA 2OSBA 2ZBPA 1VYVA 2OCKA 4LQCA 1OX6A 1TT5B 4HNTA 2PJRA 1SXJD 2H4JA 3ANYB 3AUSA 2Q3FA 4XWAA 4EUEA 3K92A 2XUPA 1BE8A 5TMDA 1WE2A 3C97A 4H1VA 4LYJA 3JQDA 5T4EA 2YXBA 2GHIA 4XLLA 1K9VF 2XMCA 1E3TA 1JI0A 3OCXA 2WHYA 1GYPA 4MGZR 5FOQA 4TKZA 1U8YA 2NVQB 1XZMA 3QPVA 1V48A 4U2KA 1ODKA 2NTNA 4UNRA 1CHDA 1FTSA 1DBQA 3WRYC 1H1TA 4XYBA 1CUHA 2Z3VA 2XQGA 4BNTA 2L69A 3GJZA 3NANA 4PXAA 4F84A 5JNRA 2H63A 3BREA 4L27A 4BNHA 2FR1A 1FTQA 4RTLA 3DMFA 1TYCA 3AI7A 3DEYX 1K0UA 2XBLA 1M6HA 4K7JA 5F51A 2NMVA 5F9FA 3FPSA 2CYBA 4F45A 2QRQA 4Q4AB 1YBVA 3ID6C 1FP1D 2KBEA 2VJYA 3BA1A 3R7AA 4RHCA 4FFVA 1PSDA 4WUVA 5ULLA 5B7NA 4P5DA 1T5OA 4U1RA 3N76A 2P30A 1TK3A 2FXVA 1RRVA 4FUTA 1PT7A 1P4GA 4JLKA 4RUKA 3HOWB 1ZJ4A 3WLHA 2A78A 4EGAA 4D25A 1T3TA 3KEOA 3DLHA 2XUAA 3G5AA 4PZ0A 1WY5A 4DYDA 3GLFE 4JLOA 2A3RA 4DFDA 3TAHA 1J2JA 2PH1A 2ZITA 1UPXA 1JHMA 3WWYA 1FU7A 3ZHTA 4P0TA 4PO3X 1CCWA 4XQ0A 2KMLA 2QTNA 1UDCA 1Z68A 2WA1A 3AUYA 4H0FA 4M7OA 4ZEXA 2R5FA 3ZWMA 4BFYA 3GJ8A 4BAZA 2WSMA 1UEIA 4IIXA 1IEVA 3M6LA 4XM2A 4YUXA 2YBEA 1FMLA 3G9ZA 3C8ZA 2VAWA 2YZ2A 4U7WA 1G6Q1 3C1TA 2V74B 4PQFA 1NU8A 3EVGA 4NDAA 1PL0A 1KK1A 2BEKA 4OKIA 5AVTA 1J0XO 5IDWA 2XB9A 2UZ4A 3I4NB 3NTLA 4HWRA 4JP3A 4YRLA 3ROMA 2PA3A 5G4LA 1KYWA 2HF7A 4WI1A 5KWIA 3KQUA 3GEIA 1NONA 3HSSA 4GIBA 2JFGA 1PZGA 1T9ZA 4GS5A 2A2ZA 1I8TA 3FOWA 3D8NA 1U1EA 2EGHA 3QFRA 4QNRA 3RK4A 1ARZA 1RPAA 3BD8A 3CW9A 4ZC8A 2P5UA 3UMVA 4BX8A 5GIPE 2Y0PA 5C4IA 1T6YA 1EFRD 1M10A 1I3LA 2K2WA 2H92A 1GPWB 4Y1GA 4B7CA 4UPEA 4PNPA 1KEUA 2FR8A 3UHFA 2OFPA 3G85A 2RHRA 1E60A 2IOHA 5SZIA 4RXMA 1HE8B 2I87A 2W6IA 2WJIA 3QYPA 4IDAA 1D9XA 1PX2A 3FSGD 4JKYA 3B48A 4BFLA 1R6BX 1MB3A 2PU7A 2W2KA 4G0OA 2FAXA 3H86A 2DHEA 3K8ZA 4QFMA 4U3JA 2VXYA 1L5KA 3R7LA 3LUKA 3RC9A 3GUHA 5DTMA 721PA 1Z5WA 1XU9A 1JNXX 1LTHR 1ZCZA 1FB5A 2D1TA 3L6EA 3O4HA 1DRKA 3PCRB 1OBHA 1H8HD 1NASA 3BFPA 3P9IA 4DNPA 3K5IA 5HQ3A 4JB8A 4Q1BA 2WZBA 3R3WA 1U3DA 5GOZA 4QASA 3M3YB 1YMQA 2HL6A 4OJNA 1NUAA 3IJRA 3EQ2A 4FYXA 3IT2A 4Y2YA 3VKFA 1U4OA 3WLNA 5KYXB 2OMKA 1HLPA 4HEHA 3VI3B 1G9SA 3GEMA 1KOLA 4N5LA 1VFPA 2ZBRA 1TA9A 4KVFA 1US8B 2IP1A 4ND4A 3UC9A 4OK3A 1FFYA 4QTUB 2IYWA 1LW6E 3D5EA 3QW4B 3IFSA 1XDBA 2ATVA 2JIMA 5B4UA 2OCGA 2I6QA 3Q0IA 5B7PA 2R96A 4GEKA 2RGEA 3AVVA 1DVRA 2QM7A 3FWYA 3NHZA 1JJ7A 3ZU5A 2N46A 2NUAB 5EZSA 4RAOA 1AQIA 1BHO1 5FO1A 3NIDB 1KYVA 1T3ZA 2JFPA 3ZWAA 3U4CA 4MEJA 5GV7A 2DQ4A 1DC8A 3MA0A 3W1WA 3G7UA 1T91A 5JWOA 2HLDD 4RFVA 4ZK6A 4YLGA 2X15A 2XYVA 1U1GA 4DLWA 1X77A 2AOXA 1H0HA 3KZNA 3O8DA 3FD8A 1XHLA 2ZWVA 3O8LA 5LYYA 4W5TA 2QWXA 1H2AS 1XJCA 2IHBA 2P9YA 3KO8A 3MC1A 4JBGA 4MARA 2O7QA 3G13A 4PSCA 1EBFA 2CNNA 3AEYA 1NVAA 3CWQA 4TQUS 5C5DA 1FVHA 1DBRA 4Q4JA 2ZAGA 1N1DA 4WY5A 1T5IA 4ZJPA 2Z5VA 2ID8A 3DVLA 3HL4A 1T4MA 2ZREA 5M5BA 3EDYA 1A76A 1FJXA 1TAUA 1K08A 2FEMA 4UEJA 4F3NA 3E5MA 5IMBA 1GZ7A 1NUQA 1OB2A 1EUYA 1V1JA 3H9BA 3I62A 3LVRE 5SV2A 6YASA 1NRJB 4UU0A 4TRNA 1QB7A 3KAJA 3HVUA 4KDFA 3RF7A 4X62B 1ZK0A 4FFMA 4U3JB 1CNMA 1XJ5A 4X1OA 1UJMA 3D7KA 1LUAA 1RD4A 1SBTA 1UL1X 1V45E 4TXNA 3K7AB 1I7LA 4KRYA 1KVRA 2OGWA 1B6GA 1TUBB 1QAQA 4PEVA 1A69A 3OEEA 1NW9B 4JMPA 3L07A 4QUDA 5AW2A 5HQ3B 1R4NA 2EDCA 2L42A 4HAWA 1ZI8A 3HFSA 3SKXA 3BIWA 1N6RA 2GPJA 2LE0A 1I2DA 4BV2A 4MW6A 2QJRA 3C8UA 2IIQA 4ZTZB 2EQ5A 2QS9A 2A0YA 3LL7A 2VUUA 3WV4A 4YACA 1PR2A 3K16A 4V0LA 2Z6VA 5H0IA 1DEOA 1XZ8A 1LRKA 1P7PA 2I3AA 3CF4A 3HDVA 4QOHA 5KNBD 5M04A 5ILOA 1C30B 1G17A 1YIAA 1KS2A 2W90A 4QGHA 1P1JA 1MXFA 4RL4A 5C8YB 1MIHA 4HXGA 5CVEA 3DPSA 4IOMA 1T6NA 2CJPA 4BMNA 1EAMA 1AKWA 2XY4A 1RYNA 2GGSA 4LWOA 1OV6A 3OZIA 2M6RA 4M37A 5DH9A 1VIAA 1K86A 4KG7A 4F3YA 5LMCA 2W98A 4O4LF 4YYEA 1O5TA 1I30A 3OU6A 4WNCA 1KDOA 1N3BA 4JUFA 4B4KA 1E2UA 2PSJA 1NJ2A 3O1LA 2EVWX 3CNEA 5ALWA 2GSWA 3KOZA 3T9DA 2QL5A 4N0MA 4BQOA 5DKFA 5LL6P 5CR9A 2E4WA 1J1UA 1ZOOA 3IPAA 1FRQA 2V4MA 4IQ4A 4MQEB 5K51A 2Z1NA 4Q7EA 3RYCA 3TKAA 4HAZA 4RA9B 1VE1A 2EFYA 2K6GA 2QNRA 3JWEA 5H81A 3U3JA 2Z56A 4RZUA 4CG0A 1XPJA 4HQRA 4OSPA 3E23A 3FOBA 3PUVA 4CLHA 4ED9A 1CUVA 4H3HB 4KQFA 2Z8XA 3T0GA 3WFZA 3ZKWA 4D3SA 4YO7A 3DDOA 3A58B 4IDGA 2CUNA 3T1VA 1XL0A 1J2TA 2GN2A 3LX4A 1E2NA 3NGMA 4AS3A 4DLSA 5L45A 2XV1A 2R8YA 4II3A 2QW0X 3COWA 2WJVA 5A5VA 2HXYA 3NB0A 3IVRA 1Z83A 2V7GA 3F90A 3GLUA 5FPTA 4BCBA 4GX0A 5K01A 5AW7A 2DJ5A 1AHNA 1NXXA 2QROA 4XAQA 4GBED 1DAOA 1NQWA 5E4JA 4ZD6A 1T3SA 1L3IA 4MP3A 3FB1A 2ETVA 2ZI3A 3QYAA 4O4HF 2QR5A 4XWTA 3RRYA 1UP7A 2AN5A 4TM8A 1TTQB 3IEIA 1RHQA 3FHTA 3HCCA 2ONZA 3D8RA 4H7DA 3QBDA 3KDPA 1W581 1OPXA 5DP2A 2JI7A 4N54A 4EZIA 4YRAA 4HAXA 2VHQA 1XHFA 1H0KA 2P77A 4B75A 1EFKA 1G0NA 1HNZB 4EPWA 2R47A 2EYUA 3BORA 4GWGA 3FNRA 4RV9A 5C9ZA 1DUSA 3TNYA 1C30A 1H4VB 1IEWA 4LE0A 4PBTA 4M54A 4Q6BA 4RSGA 1YHYA 4E4YA 2VOJA 4B6PA 4EM6A 1SOMA 4AF7A 1RPJA 2FSGA 2VJOA 3HUEA 4JC0A 2ONCA 3CF4G 4KX5A 3USCS 1LPNA 4AG3A 1FFEA 4CF4A 4QQFA 3QGMA 4DOMA 1IVYA 2ZJ4A 3K0SA 3FOZA 3DHEA 4FGUA 4MAMA 4REQA 1XIVA 3KHTA 4GGMX 4ON9A 1U3UA 4DA9A 2EL9A 2IYRA 1FLNA 3JSAA 3QV2A 1G2OA 5U4QA 4G5QA 1RYMA 1NWCA 4IKEA 4D4IA 3AFHA 1EVZA 3WB2A 2W2NA 1R00A 2FPOA 1RQGA 5I7RA 1RAIA 1Z0UA 3Q3GE 4HPWA 4MUIA 5AI9A 5D5PA 2FR0A 2GTIA 1TDJA 4X60A 2OKCA 1C7ZA 2QM3A 4YI5A 2IA5A 1J1ZA 1OXSC 3ZKWB 3K9CA 1W36B 2FFJA 2Z9DA 4H15A 3ROZA 1X80B 4GRDA 4M8LA 2YV5A 4D74A 4ENPA 5G2OA 3NYRA 1SOAA 3URMA 3WWDA 3OPNA 2V1XA 1JHPA 1X7DA 3FW1A 2VBGA 2OAGA 2QOEA 3U3RA 3CE6A 3FGZA 3IXLA 2WV9A 1R50A 1RDFA 1QGUB 2OC9A 3SYMA 4QJBA 1NVMB 2NU9B 3X1ZA 1F2TA 1OJLA 1G7SA 2O5VA 4WNIA 4E3ZA 1BVHA 3IUQA 1CHNA 4HNSA 4E5SA 1W85A 1WCYA 2CMKA 3JYHA 3C4JA 5KOHB 5DNYB 4JKOA 2E6KA 4GBMA 5D84A 3WE7A 2XJ9A 1SBYA 3W3ZB 3WNZA 2J33A 5KHLB 3IUJA 3GLRA 3OQIA 4C4SA 1QOQB 2IEAA 3OP1A 5ICSA 1RQXA 1M66A 2MR5A 5F76A 4ETWA 5CFZA 3IV9A 1TJYA 2EEZA 1T0BA 3E5RA 3F98A 4FB4A 5LNK1 4IR7A 2XKBA 4TMYA 2IZOA 4BATA 1Q7BA 1U5AA 2F67A 2G5GX 3VPDA 2X2FA 5J2UF 3HCDA 1E6CA 5JXJA 3F5DA 2V0CA 1GXSA 5REQB 3UJ7A 3S17B 3VNQA 3C7TA 5JNSA 1S7GA 3QUCA 1X1TA 3RTEA 1ZOPA 9LDBA 1KDZA 3RIHA 5C8XA 4M9XA 2YWRA 5ALIA 1Z4JA 5IYZB 4YASA 3G5LA 4REQB 1OZGA 3AU8A 4J0KA 4P53A 4UHHA 3ZE0B 1Z38A 1WPGA 1ZK4A 1RHKA 2XNSA 4KRFA 1QH8B 4MITA 2C8LA 2XX3A 4JSRA 5COQA 3PSAA 2Z2IA 3TZKA 2ZJ8A 2OO5C 2VO1A 3A2MA 3AFNA 4O4LB 1PLLA 1I5OA 2EOAA 3X2FA 3UCEA 4OM8A 1ZA2A 4OHRA 4KIFA 4FKBA 1UDRA 3V1LA 5ERYA 3OZVA 1X7YA 4XVHA 2WBLC 3BK2A 5JD4A 1SURA 4A7PA 4M1KA 3VO8A 4LGVA 1SXJC 4S2UA 1IMJA 2HO5A 1HXHA 1X9IA 4RD4A 4MVJM 5AW5A 1NC1A 3S0JA 4C0HA 3K9QO 1WBBA 2E18A 3EMBA 4HFJA 3L7NA 4I55F 1JNYA 1Y82A 3SCZA 4OJMX 4PSVA 2PKCA 1RRKA 1X3LA 1XMQB 3MTJA 3LQ1A 3G2PA 3EA5A 1WCIB 2X86A 1F2TB 3M9LA 2H2IA 4M0UA 5IBCA 3NBMA 4NYIR 3AHGA 1EKXA 4WMLA 3N3AC 5ED4A 1W85B 3KSDO 3EGCA 1G5TA 2D2XA 3DDWA 4Q93A 3TK1A 4HUJA 3RRXA 4F1KA 2ZSHA 4I9UA 3RJZA 3U7QB 1IDN1 4CTOA 4FDTA 2Y3IA 4EX7A 4PRKA 2RCYA 1QFXA 3BFVA 2YVLA 3OQIB 3VHXA 2VJAA 1E69A 2BEVB 2F1OA 5E7IA 2O8FA 2ZLBA 3R7SA 2HWYA 2XYGA 4MZXA 4HFRA 2AQHA 2QN3A 4Y98A 3HFRA 1WQ4A 1Y4AE 1K2VN 4V38A 4LHXA 4ZI7F 4H4DA 1ZAYA 4R2LA 1SG0A 3R40A 4BLVA 3UK2A 4EUFA 4YRZA 1FK8A 1GXSB 1QZUA 3HRKA 3IBYA 3AHFA 1AG9A 3Q1LA 2AXQA 3VZCA 1LBHA 2MDTA 2RB4A 3T7RA 4LY6A 2AR9A 2O3QA 1H3FA 1O0CA 1JQAA 3CUTA 3QPCA 3C1AA 1Y3BE 2JGAA 4IDPA 1YK0A 3IIKA 3HHPA 1N7JA 1ENZA 1FVFA 4K46A 4TUYB 1YS6A 3BHJA 5DJ5A 4UREA 2QAGA 4TPKA 5LB4A 3OUZA 3QFHA 3U6KA 4X0EA 1Y5NA 2VLIA 4LDQA 4Z9YA 3L6OO 4E33A 3UUFA 1ESEA 1RQRA 1WR8A 2DFVA 1XTIA 3PITA 4M1ZA 4MOWA 1A71A 2CUKA 4JITA 5KYGA 5TQ0A 5LFAA 1JSCA 3H2BA 3ZK9A 2DU8A 3THOA 2Q07A 3L8HA 4JOSA 4A82A 1MW8X 2ZCJA 2C99A 1N2IA 2WB4A 4OLHA 4X20A 2JKYA 2P9QA 1W9MA 3EPHA 3NDIA 1GU0A 2JJMA 2IE8A 3OVMA 2BR5A 1VPLA 1BA2A 1SVNA 4Q24A 5BSFA 1AS3A 2PWPA 3G0CA 5JZOA 1U9CA 1EFUA 4BX9A 1G5HA 2C9MA 3P2OA 4FYJA 4H08A 4MWTA 4WK4B 3WTCA 1PG5A 1ZAKA 2GYYA 4JUAA 2F3RA 4ZV9A 2ZUVA 4AULA 1VLZA 1Y42X 2Q5OA 4PSDA 4BN0A 1CF9A 2EBUA 3JVUA 4JASB 4BVBA 2AXEA 1XYGA 4UZEA 5B53A 2G70A 4EJSC 5JQWA 1P18A 4HDQB 1P6UA 2OV1A 2C2GA 4GPBA 4JC8A 2H29A 3H4TA 3VX4A 4BJHB 3QTBA 4EMBA 4A16A 1MZVA 4B46A 2QAJA 1G20E 2PUDA 4MIEA 2RAVA 4IHKA 4DA8A 2RE8A 621PA 3LLMA 1KYXA 2AUTA 2YJZA 4XQGA 3RCBA 2G1PA 3H2SA 4UFNA 1PJSA 2DFKB 5CG2A 4TYYA 5LZ8A 2ZRMA 1WAMA 3QVTA 4D6YA 1VSUA 4GYKA 3BGOS 1PYOA 3EZNA 1IQUA 1II0A 1SQ6A 5ISMA 1ZGBA 4ESHA 1OFTA 1PIWA 2C07A 4INPA 5IVHA 1OYYA 2C2ZA 3G0IA 1Z25A 3IA2A 4JY7A 2Z58A 3NX4A 2UKDA 3RVKA 5C8DA 1UCFA 2ZAIA 5F52A 5ERGB 3KETA 4X85A 1EP3B 3GCGA 5JO9A 4JI5B 2IH5A 3A4NA 1V1MA 1C3XA 2IPXA 2X23A 1EJ2A 1J8QA 3LX8A 4JC5A 2EC5A 3NHWA 3VR1A 2G6TA 1H3NA 4RJ2A 4YUZA 4GI7A 3U1BA 3NM6B 2PJUA 1L5WA 1O94A 1M1NA 1QGAA 4M88A 4Y67A 5DYNA 2XMDA 2LW7A 3DHWC 4D8YA 5TQ0B 4X1YB 2PCJA 4Y0NA 2VJPA 5A02A 3GLIB 2X1MA 1RAGA 1EE2A 1D5WA 3HKCB 5TV2A 2GBIA 1AMNA 3O92A 1UBNA 2PKYX 2CMHA 2NO1A 4GPD1 4ZCPA 1QG2A 3I5YA 1RMQA 4LJKA 1TXGA 2D2EA 1Q77A 2DECA 1R5NA 4NBLA 2JI8A 4O4IB 2YC4C 4V2IA 2Q3EA 1JYSA 4QTXA 1AKYA 1P5RA 1HNNA 3W5UA 1BROA 1UMDB 2CWDA 2PH7A 3M9XA 4OYRA 2D13A 3OU2A 5AVYA 4PLVA 2NYUA 4XB1A 4N5HX 2FQWA 3A3PA 3GOHA 2QMUA 4JLVA 5KJFA 4GVXA 4Z7NB 4MR9A 4Q7MB 3SEAA 4D4MA 2VUTA 3HBLA 1E6WA 2Q5JA 1RXEA 3M5CA 1KWGA 1F06A 1L5YA 2JAPA 2IWRA 3UQYS 4NXNB 3HBNA 5EQDA 3ETDA 4C3OB 4MYUA 1NVUQ 4CIVA 4MRRA 4XYGA 4UEQA 1GL9B 1GGHA 2SBTA 4ODIA 4YRJA 3ZE7A 4DNXA 1XQYA 2H1SA 3LBHA 1YV9A 1T0IA 3TSWA 4F21A 2IEYA 1TPZA 3R4VA 3HV2A 1FQOA 3KNZA 3ZWXA 4DSAA 7GPBA 1SC9A 4I3GA 4WHMA 4BNDB 3OLQA 4KJZA 3L7YA 3EEQA 3GY0A 4RPGA 5JAQA 3VDNB 1LCIA 2ZIFA 3PXGA 1G6HA 2WMOB 4FBMA 1JFFB 4TZKA 1W0JD 1WMDA 1LLQA 4MI9A 3Q7PA 2HPAA 1V1MB 4HJXA 2HCJB 3WGIA 4RQUA 4C3VA 3RJTA 4OUKX 4KDEA 1GAJA 3RU3A 4CMHA 2YYAA 3N8NA 4D9GA 2I8AA 4WVLA 4I19A 2NUPB 2CMFA 3TOZA 4MUAA 4BXOB 3G02A 1ESDA 1N3IA 4GXQA 2WB2A 2VHCA 3BGWA 2YHUA 1TOAA 3WLSA 5J2TA 2B8EA 3EVZA 4ZVRA 2YINC 4GOMD 4X1YA 2ZI7A 1Z37A 1C5KA 1XZIA 2GSDA 3IAM6 1VPWA 4U7JA 4IH4A 3MWFA 2FZCA 1NWHA 1M67A 5CJJA 1JR2A 3IEKA 3ILSA 4KUHA 3AEKB 5B37A 3DGEC 5E9JA 5JBNA 3N07A 3L5KA 1V7PC 4RK6A 4P34A 2AVDA 2ZUBA 3H7IA 1YK1A 4N65A 1MO5A 4A26A 1N0HA 2XZTA 1L4FA 4GM4A 3AOGA 4I6EA 4PPFA 1ODFA 1OY1A 3OLVA 4F5WA 1P1BA 3QFFA 4YK7A 5AOBA 3TNLA 2IOFA 1JAHA 1FP2A 1Y6RA 3NIWA 3KCQA 3RK0A 3RVMA 3CZ9A 4Q03A 5JNVA 1Z4PX 3NYWA 2UUPA 1S9DA 5EWLA 4N39A 5JYBA 5B1IA 2Z3ZA 3CONA 1RPNA 3B60A 3G0GA 3OD5A 1Z2AA 4UDYX 2HLDA 2FWMX 4F6CA 2G7MC 4V1CB 2PXCA 2YJ6A 1JDZA 1Y7TA 3F47A 4Q3AA 4ER5A 3I45A 3RT1A 3R6GA 4QD3A 4YDQA 5HM8A 1C2YA 3A7DA 3ZR4B 1DL5A 2AHRA 4QUAA 2JA5B 4BNWA 4RWEA 1H2FA 3BE8A 3PIDA 2R92B 2VYVD 3T12A 1JIKA 1N5RA 2XIJA 1KVTA 1L4HA 1EXNA 2YASA 1PGPA 4RJKA 3G2IA 1XRNA 1ZNWA 4WVFA 2H0AA 3W2IA 2P79A 3THWA 5D3MA 2XQKA 2CD9A 4L5CA 1L4NA 1RABA 3NH6A 5EFOA 1ZCAA 4UBJA 1M2GA 1MV8A 4Z0PA 1R6UA 4AYBB 4ARZA 3LUBA 1E7MA 1JEQA 2GZMA 1GTL1 3ZHRA 4XUEA 1W35A 4J0CA 4CHGA 2JAHA 4Q3DA 4RVNA 1O77A 3R6LA 1RRFA 1T9KA 1J00A 4NE2A 5EXEA 5HKLA 3TR6A 1A4UA 1JJAA 3KV3O 1JJFA 3C6YA 5JRZA 2FJ0A 1PVOA 1S2MA 4XVRA 3ZNPA 4HS4A 3SR0A 5ABPA 2NUTB 4C5AA 4ZI5A 5TSDA 4QFBA 3ZDAA 4EY4A 3AHHA 3W5SA 2WWYA 1RM4A 4KR0A 4C30A 3KE8A 4QKQA 4JN6B 4V0RA 4A0SA 3TQCA 3VNUA 4UBKA 4KLZA 4YHHB 4O8ZA 1OV4A 2QRZA 1CUUA 3M1IA 3GW8A 3JQGA 4L5BA 4QXRA 1R66A 1VMKA 3GNLA 5L3SB 2N3ZA 3NNNA 1WDLA 3QUTA 3V2UA 5E1MA 1HDRA 1Y63A 4AZ0B 1SA0B 1TF5A 3EGXB 3M6VA 3PUIA 4P3YA 4CKWB 3TCNA 4JEHA 1MOPA 1KKUA 2V7PA 3TXYA 4KPFC 4OPMA 1Q7EA 5B58T 1C4XA 1Q1EA 3LT2A 5CYPA 2W2XA 3TINA 2DWQA 3N58A 4W5JA 1FNNA 2FSHA 3OI7A 4Y9DA 5K99A 5BY2A 5K8JB 1ZHFA 4NZMA 4L5YA 1A7AA 1OBFO 1EXWA 5LA6A 1E5XA 2G9VA 4RJLA 4YAJA 4FHZA 5BURA 5KPDA 5IJ0B 1FYFA 3IIEA 3L8GA 5B1YA 1MPTA 1C8BA 4AWXA 2ZRJA 1XNRB 4MR7B 1ZJJA 1MA3A 1NKSA 1B16A 1RBQA 5C0OE 3CNNA 4LOAA 4LZLA 1GNRA 3I6BA 5TY0A 1GZ3A 3JQ7B 3QKSB 4Y2VA 1DG9A 1BEZA 5KQGA 4HXEB 1BVRA 1ZM9A 2XVAA 3ENNA 3JYOA 5TT0A 4D3YA 1N5LA 2GX6A 1JF8A 1OE0A 2ZSEA 3E4CA 4WKNA 4RE5A 1AHHA 2J9XB 2QMOA 3MWYW 1W88B 2A30A 2HQBA 2CF5A 2YV3A 3NWEA 1BX3A 3D6UA 1KZGB 2BZSA 1SUAA 2I3DA 2O7VA 1YQ9A 3E48A 3SY8A 4AJ4A 5DW3A 2QTVA 4L4UA 3CGWA 5CURA 2WUFA 1PZEA 2YJGA 3TZCA 2I8LA 1UJCA 2V7BA 3ZOKA 3S2SA 1L8LA 3OZWA 5HRCA 1EUCB 3NOVA 1HTTA 4FGSA 3K6SB 3CO5A 1KC1A 5HDQA 1P9RA 2QUBA 3PP8A 5K0LA 2BMWA 4D57A 3OZRA 1NXWA 3ZW9A 2DUMA 1S4MA 4JLDA 4QYIA 5MFZA 3THWB 1JQLB 1WCWA 2R97A 1EK0A 2I1WA 1QIFA 3EY4A 1Q1NA 4FZJA 1YRYE 2GMWA 4JXKA 1N2EA 2N0SA 4KNVA 3CWCA 1SBQA 5CHEA 5I6DA 4XGQA 2ZUFA 3EHDA 3V1UA 3U9SA 2PGXA 2FSVA 1JQKA 1RI1A 2D06A 3I5UA 4ROTA 4JBHA 5CGQB 1JXOA 3LUCA 2IHTA 3OMWA 4ZYVA 5C3MA 5CEEA 3T7KA 4OX9Y 5EMKA 2WT4A 2ZULA 1CJSA 3QKTA 4AZ0A 2NXWA 3JRNA 2IIVA 1XZQA 2OE2A 3E8XA 3AV0B 1X7GA 4JBIA 4BBJA 3ES9A 3VOTA 4DPLA 1ZZGA 2DFPA 2IYYA 1TM3E 3N5KA 2FEXA 2O23A 2TSYB 5FTLA 3BSFA 1COWA 3EZ9A 3E53A 4JI3B 1E7SA 1KZYC 1T1RA 1DIRA 2FN8A 4QUEA 4YUAA 5FO0A 3FRHA 4H7JA 4K9DA 1Q3TA 1EGQA 1YI0A 1W49A 4EUNA 1DX4A 1J0DA 1EFLA 3GCWA 1QV7A 3OLZA 2WJZB 5BWMA 1IB6A 3D8SA 3DVAB 2RH4A 4MWEA 4NBRA 5J3JA 2NIPA 1Y8ZA 3F96A 4ZMBA 3U7HB 2HLHA 4HH0A 3M4ZA 3LQ2A 4XCQA 4YJFA 4P0QB 1YS2X 2AKYA 2P5YA 3P2MA 3QVGB 5D2CA 1ZGHA 4L4XA 4C43A 4DKXA 5GONA 4X8MA 1SC6A 4P5EA 3WJAA 1IBRA 1QYDA 3W5VA 4B3DA 4OVKA 3WWZA 4D9KA 1Z2DA 4NTZA 4RYLA 3HSKA 1BWSA 3M4NA 4AF6A 2GT1A 3CEPB 1B15A 4JU9A 3ESYA 4Y0VA 2BD0A 1S89A 2XDYA 4XD7D 1XLWA 5GWXA 1P3Y1 3PE4A 4YJKA 4RVHA 4RDCA 3Q5DA 5SYNA 4P3KA 4JT9A 3U80A 2CUZA 4DMCA 4DCUA 1NFFA 1I94B 4X1KB 3PA8A 4R31A 4QYIB 5CT4A 3NOXA 3RJMA 4AKEA 1NHWA 5IZCC 1UXKA 1HE1C 5CMLA 3IQDB 5C81A 5AOCA 4C1NA 4R1OA 4X7PA 5DVZA 3N0XA 4CM7A 1T8SA 1C4KA 1BS1A 1G2QA 1J2UA 1QGOA 3B8EA 3DOOA 2X42A 3IDQA 1C3OA 4HI0E 3S28A 3FWHA 3FYHA 3WB0A 2FZGA 3UMRA 4TT8A 3SZ3A 3RFVA 1MOSA 2H2WA 3QWHA 2IQIA 3LTNC 1OX4B 4M1WA 4F4HA 2WKWA 4JZKA 1XMOB 2YS7A 3TD2A 4V1CI 1GL3A 4OFZA 4XLTA 1QX3A 1IHYA 3DFFA 3GL9A 3BCRA 3WNDA 3H4MA 5EG5A 4MI3A 1WZEA 1QZTA 1KAMA 1TCBA 1HLDA 1V6AA 2XB8A 4Q01A 3WK4A 3CRQA 3KAKA 1U2RA 5AR1A 2QT0A 1ZBQA 2OECA 2VP4A 4JA2A 4UMEA 2DUNA 3IHTA 4YMSA 5ARCA 3UV3A 3ZCRA 2HOQA 1VI5A 2QRMA 3HR8A 4LG1A 4EB0A 4RTRA 3QFSA 5H68A 2JHAA 2WVGA 3T3OA 3OJEA 4PBRA 2JD1A 4WSOA 3SJCA 3T5AA 3SJZA 2YY7A 3V4VB 2XWSA 1V3UA 4LFCB 4URXR 1L5LA 3BMNB 3OQPA 1HM5A 5DSTA 1L7OA 1TX4B 4RU1A 4YJFB 1KRHA 1KQFA 2RG7A 4R8LA 3U4IA 3VPBA 4CVNA 5ADVA 4L22A 3GQBA 2CL5A 1B2LA 3MLAA 4HQFA 2IF0A 4UAGA 1SQFA 2AQIA 1V3TA 1BXZA 4ZYUA 1HQYE 3G2KA 4EOGA 4N7BA 1HORA 3FFWA 3QU7A 5CFPA 4L4SA 6AT1A 3A6JA 5FWYA 2FPXA 1VYUA 1DC4A 1ZSNA 3UG7A 3K0EA 1ELOA 4YRMA 4XYLA 1KE1A 3AJDA 1DUVG 3F3MA 3UFXB 4CIYA 5EI5A 1HNWB 3LIIA 1N1MA 3GLTA 3NETA 4FFOA 4JU8A 4D9JA 2UUCB 2QRPA 2YIMA 2VRNA 4B76A 1FU4A 1A5BB 4MPDA 2OAQ1 1D5CA 2UXDB 3JTEA 4Q4LA 2C4VA 2IPNA 1KAHA 1XELA 2CVHA 4N5IX 5BW8A 1L7RA 1Y1QA 2NP7A 2OHVA 3GFOA 1SZDA 2CNKA 3LE8A 5HJ2A 1SHTX 2GPNA 2IQ5A 1DWOA 3FSGA 5B2ZA 2V9PA 2FPPB 4FLEA 4BZWA 2I6UA 1AKEA 2BH2A 2HPVA 3A4VA 4FX5A 4FKMA 1L8AA 3N39C 5EQJB 3WLIA 1X6VA 2J0QA 4NCKA 1JIXA 5DSZA 5EZYB 4RANA 2IS1A 1TQ4A 1ZD2P 5BRJA 4OP2A 4RACA 1FNDA 3CVOA 3LHKA 4RQTA 3T0FA 1SOWA 3VDXA 1KWKA 1PI3A 3DAPA 4CQJA 2I55A 4FB5A 1ST3A 4US1R 5DNEA 2PUHA 5I9SA 1MA0A 4BEBA 5CFLA 3OM1A 4R9NA 4YWHA 1LWNA 1GL7A 2ERXA 4WAUA 1E5QA 1M1YA 3NDBB 3JVEA 1UWCA 2IZ6A 1SVMA 4YAFA 3I8SA 1AE1A 3I23A 2XNCA 1H6AA 3K4HA 1A50B 3AWDA 4HD8A 2D62A 3EDOA 2LR0A 2A0UA 3IO3A 1ZNYA 1MG5A 3FMPB 5DTIA 2LD4A 3AESA 4O25A 2WF9A 4L8VA 2HXGA 5F21A 2CE7A 1Y1PA 3NHSA 3QUQA 3CMMA 5A9TA 3WRYA 4JUCA 1ZL2A 4QC2A 2C4WA 3GARA 4C1BA 4XTRA 3AVPA 4D45A 5HF8A 4A8JA 4IO0A 1AY0A 4UKDA 1PQPA 1YJCA 5FFMA 1SUCA 2WNIA 3LPDA 5TRTA 3VR2A 1D2EA 3T99A 2QPLA 2YC2C 1FJGB 3CNQS 4ZWNA 2ISCA 4EYOA 3CRZA 4LXGA 4N1AA 5JS8A 1LPMA 1E1RA 1QH1A 1E0KA 1CZOA 3GMIA 1B0UA 4KX3A 2O59A 4UPDA 4JB0A 1WUYA 2JCXA 2VNAA 2C03A 1V95A 2C3OA 1K88A 4QBIA 4UUNA 1DC3A 1FP7A 3OTGA 2ZSDA 5BVGA 3PHIA 1U94A 1FDOA 4UUQA 3Q3VA 3AP1A 3V1YA 1KBQA 4RH0A 2RHDA 3E22A 3K4PA 4ML3A 4OQLA 1VM6A 1E1RD 2VS1A 2G5TA 2EKLA 3NQ41 5A2GA 1EG2A 1G8SA 3FTPA 1E77A 1W52X 3Q41A 4QRHA 5KTSA 4REOA 3WY9A 4EFMA 5K8TA 4PR0A 3TTWA 5LXTA 3C0KA 1XCMA 3K31A 3WHPA 2IX3A 3OJOA 2Y0DA 3PUXA 1Z7EA 1ITZA 1PVVA 2PANA 3DZCA 1J9EA 3RC1A 4RZSA 1RXSA 3F6RA 1NRXA 1W8DA 3AERA 1E2LA 1A8PA 3B51X 3T0IA 3AINA 1DE0A 5KYUA 4IW3B 3JQRA 2II6A 4EUKA 3OUUA 2H1HA 4XDHA 1UM8A 3P9KA 4HYTA 1GPKA 4YLEA 3EZ7A 5KI6A 3LHDA 1E2KA 1E4YA 1CQZA 1JHAA 1M5UA 1CQJB 1S1MA 2FMUA 3GT0A 3M89A 4MJ3A 4OL0A 1PUJA 2ETXA 3GUYA 2DHDA 3QHQA 4NBTA 4MGHA 5GZ3A 3VH3A 1B1AA 5LQKA 2FYTA 1NVDA 1N6IA 2NVUA 5ITZB 5JSFA 4BMSA 1RXIA 3FDJA 3JAWB 4RTNA 1D8TA 2AR0A 2BN4A 1UMCA 2JLAA 2C5AA 3OFND 1JIUA 1VHJA 1ST2A 2BCEA 3R6DA 3GB9A 2XVYA 3VTZA 2LKCA 1ZD9A 2NXCA 3U5ZB 4KHPB 5CYOA 3IUBA 4ESOA 1EFVB 4NENB 2XADA 4PE5B 4RA6A 3K9FC 1Y3IA 3PNOA 1W5BA 1YHZA 1X42A 5LQJA 4PAWA 4RKEA 5JVDA 4DDWA 2XCOA 4DCSA 4UPVA 2FRVA 3RFCA 4HG2A 4OB8A 4N0PA 1VDMA 1Y37A 1WB5A 2ZB4A 3O26A 4PYIA 2HMWA 2B21A 4TUYF 1EGAA 3CUYA 4IBOA 5CHYA 5DT9A 2V7QD 4CMKA 5CA1F 4K6FA 5I47A 2F8SA 4ZCRA 4F4CA 3BXOA 5AI0A 2OWDA 4Q18A 3ZCQA 3DDZX 1CDOA 3EF3A 4OGWA 4ETMA 1HZJA 4WBNF 2B2NA 3D64A 4IF4A 4WE3A 2R8EA 4BVHA 4OK6A 4PX3A 1T5BA 3GRVA 3IIMA 1ZMBA 1NX6A 4BNKA 3H6GA 4H1TA 4AJEA 1XA4A