2D59A

Hypothetical protein from pyrococcus horikoshii ot3
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
141
structure length
141
Chain Sequence
TRPIDGLTDEDIREILTRYKKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPKYEEVLGRKCYPSVLDIPDKIEVVDLFVKPKLTMEYVEQAIKKGAKVVWFQYNTYNREASKKADEAGLIIVANRCMMREHERLLGEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PH1109
publication title Structural basis of CoA recognition by the Pyrococcus single-domain CoA-binding proteins.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 49
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2d59A00
4KDEA 3O26A 1ZVMA 4N5LA 8LDHA 2BH9A 3PQDA 3K9QO 2GSDA 4XR9A 4EITA 4Q3AA 3WWZA 1H6CA 5EJ2A 1ENPA 1Q7CA 5JY6A 5B4TA 1NQTA 1T1SA 3CZRA 4IBOA 5EQDA 1NFQA 3HE3A 3PGJA 4LK3A 5L3ZA 3CKYA 5JSFA 1LDNA 5KCZA 4XQCA 2FZEA 3TNLA 1R4NB 2P9CA 3I23A 4I9HA 4I08A 4G81A 1X7GA 4RQUA 3ULKA 1UXJA 1UJMA 4E13A 4A0SA 4WLUA 4B4UA 3BMQB 2V6GA 3ONFA 3HG7A 3KLMX 2IZZA 3JTMA 4ZQFA 1DXYA 3WYCA 1LDMA 1H9AA 3V1TC 4PG7A 2XPCA 4BNYA 1DIHA 1P31A 1YQGA 1BDMA 4PLGA 2NQ8A 1LSOA 4MP6A 3IQDB 1NQAO 5G0TA 3DOOA 4A03A 3TJRA 3CE6A 4R01A 2YUTA 3JQGB 2D0IA 3DFZA 1KOLA 4DA9A 4KUEA 4XQEA 2C7VA 4ALNA 4OOFA 4DREA 3VH4A 4F3YA 4W9NC 3AM4A 1ID1A 2Y1CA 1R12A 1PJ4A 3I5MA 4IDAA 2YFQA 3QVXA 3HSKA 4G65A 4IPTA 4D7AA 5IZCA 3IOYA 2V6MA 1ONOA 1ARZA 3FPLA 3JQAA 1Y6JA 1KETA 4CM5A 1R15A 1Y8RB 4WLOA 4YYZA 1RJWA 2HO5A 4PZEA 1LEHA 2Y05A 1DIRA 1H6BA 2EW8A 3GEMA 3ANMA 1E7QA 4NFSA 4YJGA 5A3VA 2P9GA 3QP9A 5U4QA 1YBVA 3A28A 1AXEA 4IIUA 3FWZA 1E3EA 1UP4A 2FOIA 2I5PO 3JV7A 5LC1A 1JKJA 4M54A 1M75A 3LK7A 3TL2A 4DMMA 4L76A 4R5MA 3OICA 4JGBA 1WP4A 2BI8A 2H9IA 3ZW9A 1HT0A 4HBGA 3AU9A 4FD3A 3LSYA 2WD7B 1ZFNA 5ICSA 3P7MA 3ROQA 3FI9A 4Q3BA 1HE2A 1XLTA 5H83A 1UP7A 2QYTA 1XSEA 3D1LA 3ZGYA 1QYXA 1LLCA 1R0SA 2WDZA 3KYCA 4CM9A 3M2TA 3UW3A 2HSDA 5B37A 3ZV4A 2D2IA 1ML3A 4TVOA 3WGGA 2EJVA 1PJ3A 3N74A 1ZMOA 1Z7BA 4J4BA 4L9RA 4CUZA 2GYYA 1KC1A 3VOSA 1JAXA 3PYMA 5IDYA 4I1IA 3V1UA 4J3FA 2ZYDA 4OHUA 2G17A 2W2KB 1Z7EA 1NVTA 2O48X 4I9NA 1Z6ZA 5DP1A 1V35A 3LLVA 2YYYA 2V7PA 2FY8A 2YDYA 3D3WB 3F3SA 3TPCA 2DPGA 2GCGA 4NQZA 1WNTA 2H5LA 4M89A 2BKAA 4FQ8A 1RM3A 4ALJA 4RF3A 3AY7A 2QRKA 1E1MA 1CDOA 4KOAA 4WEQA 4CMBA 4EW6A 3H65A 4D0RA 4L4XA 4AJHA 4DTIA 2W90A 3WQRA 3QRWA 1H2HA 2I76A 4QECA 1EBFA 3PRJA 1RM0A 4CM8A 4DIOA 3OQ6A 1VL8A 1ZSNA 4F6LA 4HP8A 2AG8A 5DBFA 3AW9A 3RFXA 1LI4A 3FF4A 4E5KA 1BDBA 4MVJF 2QIOA 4XCVA 1DO8A 3UHAA 1ZK0A 3F9IA 3IAHA 3ONDA 3B1JA 4HKTA 2J5RA 2DUWA 3VKVA 3JSAA 3PVZA 4FFPA 3BMCB 3Q2KA 2NTJA 3U49A 4CLRA 1PWXA 1PJLA 3FHLA 5IAAA 4Y67A 4K9DA 3W6ZA 1BGVA 2GN6A 1T2AA 4R68A 1QYCA 1DC4A 2DC1A 4S3MA 3RJ9A 2NU7A 3NRCA 2H6EA 3PXXA 3G17A 3BYZA 1Q0LA 3EHEA 3AUTA 3ICPA 3KB6A 1L1FA 1PZEA 2A9FA 3HADA 2DLDA 2F1KA 2ZCUA 3OEWA 6ADHA 1O0SA 1ZIDA 1ZXBA 3GVXA 4HADA 2AQHA 1C0KA 5KOIA 1C0IA 2RAFA 2O3RA 3IUPA 5L4LA 3BTOA 2DTXA 3BMQA 4YJGB 3WGYA 1YGYA 1Y8QA 2P91A 4JJGA 4J6FA 1N9GB 4CJXA 4IUYA 5HBRA 5B12A 1LX6A 5JE8A 4AJ1A 1HSOA 1YL5A 3W4KA 1WMBA 4J7XA 4YQYA 1VKOA 4N54A 1GQYA 2FPGA 4UULA 2IE0A 3AJRA 1A71A 3FNHA 4LGVA 4TKLA 1U3VA 1KEPA 2D4AA 2D5AA 3SJ7A 1V0JA 2BFAA 1LRJA 5FFFA 4GSLA 1UDBA 1U28A 2EGGA 2I65A 5G4LA 2VCYA 3RUCA 1Q1NA 3BMOB 3N58A 4EZBA 1LLUA 5AVOA 3S55A 1Y7TA 4PRLA 3IP3A 1CQJA 1LLQA 2DBVO 3AU8A 4YR9A 4CQMA 1X1TA 1Z74A 2Q1TA 1SB8A 4H15A 5DP2A 3K2EA 5JCXA 5KIAA 3N7UA 1JKIA 5HM8A 2B4RO 4CR8A 2W8ZA 1MC4A 5KVVA 4AJOA 4J0EA 3SC6A 5L45A 3ZWWA 3ZV3A 4YAKA 4R1TA 4R5HA 3HDHA 3WGIA 2VYND 3TSCA 4AJIA 1V8BA 4NBRA 5AQ1A 1MXHA 2ZB7A 3NGXA 1ZO8A 3MWDB 1RKXA 3LT0A 2VHZA 4E6PA 2LDXA 5TJ9A 1LUAA 2QW8A 3H9GA 4O59O 5BNIA 4RVFA 5C7LO 1Y81A 1KVSA 3OETA 4FS3A 3D64A 3U5TA 1DHTA 2YV2A 2ZTMA 1XG5A 1KY4A 1MG0A 2AE1A 2JJYA 3KSZO 4U5QA 3A9WA 5JXWA 4FC7A 4HV4A 1DC3A 5KVSA 2WJPA 3CINA 1E3IA 1CRWG 1IZ9A 3TZCA 1EUDA 4BNFA 4QXMA 3GFGA 4NFHA 3F46A 3W8EA 4K6FA 4OMUA 3OIGA 4C7JA 4JP2A 1QRRA 1YQDA 3CXRA 2ZYAA 5JO9A 3GLQA 4JCOA 1T2DA 3GEDA 4EEZA 3WSVA 3VPHA 4DC1A 1B8VA 2D59A 4D43A 3DXFA 3ZHYA 2PD3A 4KQXA 1Y8QB 4XQ9A 2SCUA 3IMFA 4PVDA 3ADOA 5I9NA 1EFLA 3TL3A 2WE8A 1V3TA 4E2ZA 3R6DA 4JQCA 1P1FA 4KUGA 4E2WA 3QY9A 4E3ZA 1VRWA 3OJFA 2NQTA 4XYMA 2ZTVA 3HHPA 3JQAD 1A9YA 3RUEA 4FFRA 4WASA 2X8LA 1KVRA 2A4KA 1JWAB 4YBZA 1M76A 1R66A 1C0PA 1O89A 2GLXA 1D3AA 1TEHA 5CDSA 5KVQA 1A5ZA 2FRDA 3FNGA 1UDAA 4JX8A 3HQ4O 4XYBA 5A9SA 4WNCA 4GAEA 2P5YA 2E82A 3LF1A 3DC2A 5CEJA 4CLRB 1DIGA 1PU2A 3AUAA 2C2XA 3ZZNA 2JFHA 2VYVA 3K92A 3INTA 1XELA 3ANLA 2DBRA 3F1LA 3PWZA 3AOGA 1GTMA 3DDNA 1N7HA 4N18A 4BQPA 2R2GA 4RZIA 5JAQA 1PGJA 3DB2A 1HZJA 5L40A 1TB4A 3KEQA 2J5QA 4CM9D 4WKGA 3EC7A 3PHHA 4W9NA 1N92A 8ADHA 4D0SA 3ZNNA 4TWRA 1ZEMA 1PTJA 2EGHA 3GMDA 4BNLA 1WPQA 4UUOA 4BMNA 1Z45A 2GR9A 3S2GA 4ZN6A 1SO8A 1SOVA 1WWKA 5IDQA 2HRZA 2VHXA 3KYBA 1B3BA 4MKRA 1FMCA 3M6IA 4J1TA 3GDGA 5F5NA 2V6FA 1Q0HA 1E1LA 5U1PA 5EMHA 5CG1A 5G0UA 3L9WA 1B16A 3DL2A 1GPJA 1I2BA 2W98A 4I5GA 1V9LA 2JCXA 1C3VA 4CLEA 2Y1DA 4ROSA 3PYXA 2O3JA 4GX5A 1MB4A 1E1NA 3D0OA 5EINA 1EQ2A 3WGTA 1P0CA 4DL9A 5JLAA 3D5QA 4G2NA 2WEKA 1P44A 3R3SA 2CDBA 3FBGA 1BXGB 4BO4A 4FDAA 5JFOA 3B1KA 3DQPA 4RGBA 1HL3A 4K28A 3GN1A 2VHVA 4PN3A 5TRTA 4CR7A 4ZU3A 4OQZA 5EERA 2YDXA 1ZJYA 2VT2A 4BO3A 4Y98A 3LLSA 3DR3A 1L7EA 4L4RA 1LC0A 5DOVA 2VWGA 4CMHA 3VPFA 3OF2A 4UREA 1YL7A 4Y9DA 3DBRB 1ISGA 3H6KA 4GKBA 4IDCA 4YWJA 3ASVA 4AJEA 4BNZA 3G79A 3SX2A 3WMWA 3R3JA 5EL0A 4NH4A 4IJWA 1WZEA 5COQA 4DBZA 4FJ2A 4BNIA 4EDFA 5I7SA 2YHIB 5KJFA 4MO2A 3WR5A 3C3XA 3VDQA 3WYBA 3ZN2A 3GOHA 3JQFA 4LMRA 4XRRA 4EI2A 1EDZA 4XYEA 1HDCA 4GGPA 1P0FA 1W4ZA 1BW9B 1BG6A 4YACA 1GQ2A 1YOVB 4K6CA 3Q9NA 1F17A 3NV9A 4BKPA 3COSA 3UFXA 4RV9A 4EUEA 4ALIA 4ZQHA 3Q3CA 4HX5A 5JC8A 4W6ZA 5JYEA 1P1JA 3MZ0A 1AN9A 3RC7A 3VPXA 4UEJA 1ADBA 1PZGA 3PYLA 2XAAA 3ZWMA 5KKAA 2JCVA 2DM6A 3QVTA 4P38A 4JJIA 4IMPA 4ZVVA 3UVEA 3O9ZA 4PLFA 3OA0A 4MVJI 3DAFA 3PDUA 2CVZA 2AQIA 3NUGA 2PTGA 2OZPA 4AJNA 2YY7A 1RM4A 5TT1A 4FJ0A 3GZNB 3L6DA 4B8ZA 3WFIA 5KVCA 3JYLA 2NTVA 3A06A 5JMPA 3TZHA 4E21A 4E33A 3UGKA 4B8WA 3RBVA 3DBHB 3ROKA 5C7IO 2HMSA 1NASA 1OC2A 1E77A 5JNLA 3R1IA 1IPFA 4IIVA 5IZCC 2BELA 1ZSYA 4DLBA 2EV9A 4XZ3A 3ZWXA 1E5LA 4DQUA 1LQUA 5A06A 3GNTA 4FGWA 3I6IA 4M1QA 1CEQA 2VZ9A 2Z1MA 1DDOA 2DKNA 4PCVA 1PSDA 3ICCA 2BFMA 3CIFA 1LSSA 4Z0PA 4AFNA 3I9OA 2C20A 4FFOA 2LDBA 4J90A 5TT0A 4WJZA 4NBWA 2EP7A 1DJNA 1GUFA 1JWBB 4YAGA 4QFDA 1NVMB 1Y8RA 1ULSA 3AY3A 1NWCA 2I3GA 1BRMA 1J49A 1EVZA 2ET6A 2PGJA 3H4VA 4HFMA 3ZU2A 3KXDA 5K9ZA 4CL3A 1HEUA 3L07A 3OJOA 3QWHA 4B3IA 5KJ6A 2PA3A 1NPTO 2VZ0A 4CMAA 4BO9A 3PP8A 2GN4A 4CR6A 4INAA 2A92A 4BO0A 3I4FA 4XRGA 2E6UX 1HKUA 1BVUA 3QV1A 4JBIA 4RQTA 1QKIA 2ZYGA 1B8PA 4MIOA 1X1EA 1GL3A 3EK2A 3EVTA 4B4VA 5I7FA 1MXFA 1HYEA 1SPXA 4RLHA 2W2LA 5TX7A 5L4NA 1I32A 4UUPA 1PJSA 1YL6A 2DTEA 5L95A 4BMVA 2G0TA 3GRKA 1LSJA 3FR7A 2CD9A 3BHMA 3BMNA 1XWFA 3JQFC 3JD4A 5A9RA 5DBIA 1F8GA 1FDTA 3ZHXA 5IN4A 4GI2A 1C0LA 3JQ7B 4CLOB 2I3AA 4A2CA 4OAQA 1NHWA 2B4QA 3V1YA 1ISMA 2VYVD 1T2EA 3H9QA 2YV1A 2GZ2A 4JROA 5G2OA 4WECA 5HA5A 4J7CA 3ABIA 2PH5A 1IULA 2ZTLA 4JXKA 4P22A 4BB5A 2O50A 3L6OO 1SMKA 4EBFA 5CDTA 1NX6A 3DHYA 1VJ1A 4M86A 4EYEA 1UXGA 1IHYA 2CDCA 1IYZA 1GY8A 1U9JA 2CVQA 2OO5A 2HK7A 3ETDA 3KVOA 1FDWA 1U8FO 2W2LD 4A26A 2I9PA 3JYOA 4GVLA 2P5UA 4HXYA 4PGFA 4F6CA 2BI7A 1KS9A 4B79A 4BNMA 3U4CA 5JDCA 4LCEA 4IY1A 1HDYA 4FIZA 2JD1A 3PLRA 1WVGA 2RCYA 1IE3A 2WYWA 2Q50A 5CEFA 3P2YA 4R4JA 4NNJA 3ROPA 3G1UA 2ILTA 4IJKA 4E5NA 4RPJA 4UEKA 3B70A 2GNAA 2RIRA 1HWYA 1ULUA 4KDFA 2DU8A 4IQ8A 5JAZA 3TQHA 4NIMA 4BGVA 5GZ1A 1B26A 1BMDA 2ZB8A 3IUSA 4HFRA 2HJSA 4NI5A 1U8XX 2C0CA 3VVCA 4HNGA 2X7HA 3O8QB 4B3JA 1Y1PA 2EKPA 2IEBA 2WYUA 5IG2A 1E6WA 4UVDA 3T7EA 3NT5A 1OMOA 5A02A 3V8BA 3WNVA 4ZICA 1B2LA 3BXXA 3RUIA 3G1TA 4OXKA 3X2FA 2HK8A 3FTPA 4TZKA 5KWEA 5L7TA 4QX6A 2VHWA 4PG8A 5TQVA 3U3XA 3HUDA 5BQFA 2O23A 4I5FA 2VN8A 3DBVO 3PFWO 1KBZA 2C5EA 1LDEA 4DIBA 1AXGA 2V65A 4GMGA 2HKIA 5L9AA 3ETEA 1NP3A 1LDYA 4EGFA 1GAEO 4J4HA 4ALLA 4RVUA 3TDKA 3RJ5A 4J7UA 2JD2A 3I9KA 4E4YA 2NWQA 3K5PA 3IJRA 3WGZA 1JN0A 1SBYA 4H7PA 2P9EA 1HYHA 3LF2A 2DT5A 1F12A 3HFGA 4IMRA 3ZDFA 4XYLA 1PS8A 1R6DA 4TZTA 1YXMA 2PH3A 4A27A 4MPDA 1HDGO 1G6KA 1HE4A 1E7RA 2VUSA 2QRLA 4IM7A 1IHXA 4IDGA 1I5RA 4KMSA 1A7AA 4TRNA 1U3WA 3DONA 4TVBA 5JAMA 3K31A 2PFGA 4FOSA 3DAPA 3JQ9C 4I5DA 2DPHA 3AFNA 2B83A 3D3WA 4QO8A 3L0DA 2X9NA 5L7WA 4XX0A 1GADO 5JCJA 1P3DA 4J1QA 1QORA 2Y0CA 1H94A 3LZ6A 2FN7A 4KUHA 4QEDA 2NACA 1TVEA 3GRPA 1I2ZA 4Q39A 4YPOA 5KKCA 2D5CA 3ITKA 3PEFA 4ESOA 3V2HA 2X0IA 1ONNA 1F14A 2ZTUA 2QQ5A 4GKVA 4OXYA 4MIEA 3JYQA 1T4DA 4FN4A 5KNLA 4J9UE 1NPYA 2HRBA 4YAJA 2O2SA 5HRUA 1X14A 4C7KA 1QMGA 4PRKA 3H5AA 3U4HA 3K2BA 3ZWYA 4BHTA 4BNGA 3D7LA 2Z5LA 5DULA 2C2YA 3KYCB 2NLOA 3QA9A 4XR4A 4J2HA 5JDCC 4G5HA 2HUNA 3BMOA 5TNXA 4RPHA 1NBOA 2UDPA 4ND5A 3GHYA 1XIVA 4LSMA 1DRWA 2Y0EA 3KTDA 1ZMTA 3I3OA 4BO2A 3KETA 2GZ3A 5F5LA 5T64A 1XU9A 2XF8A 2X58A 2JKVA 1EUCA 5BSGA 1U2GA 4R41A 4IGFA 2PLAA 3GA0A 1RYDA 3D4NA 4KTTE 4Q3NA 1ZK3A 5JO0A 3KV3O 3OIDA 4DLAA 2FSVA 1FXSA 4LCJA 4CM1A 3K30A 4UVHA 4KWHA 1H0KA 1SZJG 5T6BA 1PL8A 1A4IA 1UP6A 3FR8A 1BHSA 1KEVA 4E2YA 4DQVA 2OP0A 3CPSA 5ADHA 1Q2XA 1DSSG 2BD0A 3NKLA 3VDRA 4AJLA 4S1VA 5HS6A 4WCFB 4P4LA 3C1TA 1PQPA 5IXSA 3H9UA 4CV1A 2H1SA 4BKOA 2NSDA 1PJBA 2GO1A 4J4TA 4OXNA 5BNFA 1M67A 4HY3A 2IZ0A 3WIDA 1O94A 4GX1A 4U0KA 4W99A 4MVJH 2C54A 3ZWVA 1MX3A 3RVDA 3WG9A 1LU9A 1LTHR 3BMCA 2FR8A 4J2OA 3GUYA 4Z9FA 1QP8A 3FTNA 2G76A 3UCEA 3KSUA 1CYDA 3WBBA 1GFSA 3O4RA 1UZNA 1YKFA 4MP8A 1R0LA 1C1XB 2OBNA 2ZIZA 3RIHA 4C4OA 2O3TA 2X22A 1I30A 4WCDA 3JQEA 2VRCA 1PR9A 2YHIA 1GCUA 1XYGA 1DRVA 1W0CA 3U62A 3MJSA 3RCBA 1GV1A 4Q3EA 3I1JA 1XU7A 2UUPA 4DVJA 4XKJA 2PKQP 1K0UA 4BVAA 5CDYA 3VZQA 3ADPA 2WYVA 5C3MA 1SC6A 4JNKA 4P4GA 4RJTA 3LC1O 3DOCA 4GBJA 2QG4A 3F47A 3CMMA 4TRJA 3PIIA 1PR3A 5DZSA 4CMIA 1LRKA 2A35A 1W73A 4J1NA 4ZA2A 5JS6A 4IDFA 2UYYA 1N8KA 3ZU4A 1IY8A 1PEDA 3HWRA 4L75A 1KVQA 3M1LA 4IDDA 2TMGA 4WLFA 2GERA 2PR2A 3RU7A 3E9MA 1M6WA 4D41A 5A9SB 1UXHA 1TXGA 2GPTA 1RPNA 3RC9A 5ILGA 1X7DA 3Q1LA 3GG2A 3ORFA 3JQDA 1BXKA 1BVRA 1ZUD1 3P19A 1UUFA 3T7CA 3VC7A 3DWFA 4YCAA 5MDHA 1MFZA 3F4BA 4UUNA 5JBIA 5JAIA 1LLDA 1O5IA 3C7CB 3JD2A 5GMOA 5CAEA 2F00A 4B7CA 1IUKA 1U4SA 4HFJA 4IJUA 4YRAA 1J4AA 1JKFA 4TKMA 5HTOA 4D44A 5TC4A 1V6AA 3GY0A 4CMKA 3DHEA 1NNUA 1LNQA 2BF7A 3OIFA 5ER6A 4NFYA 5JYDA 4XB1A 2HU2A 4EJ6A 5F1KA 1JA9A 1KIFA 4OIMA 4K1LA 2AEMA 5DCWA 5CEEA 3VH2A 1U7HA 4GVXA 4BO1A 2PY6A 3EY4A 1L7DA 4XGNA 4Z0HO 5A04A 1H6DA 1ZNQO 4NJMB 4DPKA 4E32A 1E6EA 4ZQGA 1PJQA 2AEJA 5AXCA 1UZLA 4DC0A 1F06A 4PG5A 5C37A 5G0WA 1P33A 3DAGA 4R3WA 3BHJA 2YQ4A 3G3EA 1GZ6A 4CLXA 4BQRA 4UUMA 2Y0DA 2YHUA 3PZBA 2FR0A 2J3KA 4CLOA 2PZMA 3C7DB 3DTYA 2NVUA 3WIEA 4ZRMA 1IOLA 4PIVA 3G49A 1I36A 3DZKA 3UN1A 3X2EA 1DLIA 5TGDA 3TOXA 2NADA 5F3RA 4OM8A 1A72A 1EVYA 3EZLA 1PGPA 3QWIA 4GX0A 4GQAA 1Y9AA 5H82A 4Q3CA 1NVGA 3JQ6A 3F1KA 1ZK1A 2EXXA 1C1DB 2GN8A 2EW2A 3D4PA 4LMPA 3TZ6A 4CMEA 2Z95A 4I8XA 5I9LA 2CF6A 4XDZA 2QRJA 1PGQA 4L4SA 4DYDA 1N5DA 1X7HA 1YONA 3DBRA 1UDCA 1PL6A 2GD1O 1NHGA 1ZEJA 1OOEA 4BNUA 2QZ9A 4BS9A 3GFBA 3I52A 2BFPA 4MKZA 1M66A 2EIHA 2QYSA 4L8VA 5T8KC 5TS3A 4AL4A 4R1NA 4HWKA 3DBLB 1Z75A 4E5PA 2AEFA 4DWVA 2D1YA 3DOJA 3O38A 1GV0A 3H2SA 5B1YA 1DFIA 3O03A 4OSPA 4R9RA 3DZIA 4RVSA 5F21A 3VH3A 3CH6A 4O1MA 3VHRA 2Q99A 2OGUA 2DUUA 3D5TA 2DFVA 3U9LA 4YJFB 2CFCA 5JDIA 1SB9A 2PGDA 1QXSA 3GF4A 3OECA 3OMLA 2FWMX 1YWGO 1A27A 4PLVA 1F8FA 1HXHA 4L0QA 1MC5A 4OJNA 3VKUA 3KRTA 3L6EA 1Y5RA 4KP7A 3A1NA 4Q3DA 3WJAA 4RF4A 4MJLA 1LDBA 4W7HA 4BNKA 1KY5A 3C85A 1X0VA 3GT0A 9LDBA 5FYDA 4IINA 4LSWA 3F6YA 1NXQA 1OAAA 4FFMA 1C1DA 3W8FA 1VC2A 3RFTA 3QJ5A 1NAHA 3UH1A 5EIOA 5FWNA 3DZJA 5F1PA 5AYVA 6LDHA 4ITUA 1P1RA 7MDHA 2VZ8A 2ZQZA 3PK0A 4CQMB 5ILOA 5CDGA 3VZSA 3P2OA 5IN5A 1XGKA 2EKQA 4CM6A 1HZZA 1E3WA 4RPKA 3I83A 2O2YA 1P1IA 4PLZA 2EEZA 3TRIA 3L4BA 2FZWA 3NJ8A 1GCOA 3MJ4A 3PWSA 4U7WA 1JQBA 2HLPA 3NT4A 4PZCA 1E1KA 4IXTA 3WDSA 4YAIA 2OORA 4KWIA 4Q9NA 4Z3DA 3IKTA 4WLVA 4XD2A 3LT4A 1IPEA 1G1AA 3GH3A 1K2WA 1S6YA 3TFOA 1ZZEA 4LN1A 4BGIA 3M2PA 2G1UA 4BNNA 4E2XA 4OYRA 1VE9A 3IDSA 1DIAA 1S7CA 1W8DA 1C1XA 3GAFA 2VUTA 3PQEA 1K5HA 3Q11A 3FNFA 2O4UX 1PGNA 5C5IA 1HETA 2FHSA 3K8ZA 3SLKA 4AJPA 2G5CA 2NV6A 4D3DA 3IP1A 4O5OA 3ZWNA 1DAPA 3OHSX 4W4TA 5KJ1A 2O3UA 1EK5A 1KVTA 1PGOA 1JVSA 4BNHA 1FK8A 1FF9A 2X9GA 4NK4A 5ENVA 3JQAB 5FF9A 3TZQA 3HB4X 1JVBA 2GUGA 3I9JA 3W4JA 4IS2A 4BOYA 1E3JA 5TSDA 3JD3A 3QWAA 4EUHA 3L4SO 2CDAA 5ES3A 1TA4A 4M8SA 1HLDA 1YJ8A 1NQ5A 3W6UA 3RI3A 4NG5A 1GPDG 2DAPA 4YTEA 2EKLA 3LT1A 4DMLA 3GN2A 1K6XA 1Y9EA 3FD8A 5JPIA 4WLEA 3ZH2A 1AHHA 2Q2WA 2IDZA 3ZV5A 4RO0A 2OMEA 1PQWA 3NX4A 3VPGA 3GVIA 1C14A 3WICA 1DEHA 4L74A 1PJ2A 1KERA 2HDHA 1XCBA 2Q2QA 1D4FA 1HE3A 4MVJD 3WWYA 4IGEA 3KOUA 1I10A 5JDIC 2VOJA 3OP4A 1I33A 2HMWA 3QSGA 1Y5MA 1YBAA 2G82A 1YJQA 2B0JA 2YW9A 2Y68A 3VTFA 5DNAA 1DC5A 2VTEA 4FBGA 3W8DA 4ND1A 5L4SA 5IDWA 5L53A 5BSFA 1JTVA 5ENDA 1MGOA 1QV6A 4DYVA 4MVJG 4GLLA 1H5QA 4R3NA 3DHNA 1WW8A 4WLNA 5G0VA 1ISIA 4MKXA 5DT9A 5BNTA 2YJZA 3ZWBA 4YJDA 1EVJA 5ITVA 3I4CA 3RQSA 2Q4BA 1DB3A 4KTVE 3JQ9A 2WE7A 1MLDA 4ZJUA 1P77A 3EDMA 2BGMA 2HMTA 4IDBA 2Z1NA 4AJ2A 1HSZA 1JW9B 4BMSA 1R0KA 3QIVA 2FSSA 3HB5X 5CPBA 3WTBA 3E5RA 1RYEA 3LU1A 2E37A 3ZI0A 4OOEA 4CLHA 4MP3A 4NPCA 3L4BC 3M1AA 4CUJA 2PV7A 1HDRA 4R9SA 3VZPA 3EYWA 4B4OA 4XB2A 1YOVA 1GU7A 2ZQYA 2JFFA 4MOWA 4ND3A 4NBVA 4RPLA 4UEOA 1VM6A 1CIVA 2GASA 1I0ZA 1GEEA 1R4MB 2EG9A 1GR0A 3I9LA 4A10A 4IS3A 4M87A 1HLPA 5CP8A 3U09A 1XEAA 3C7AA 1YDWA 2TMDA 1E3LA 5BSHA 1B8UA 1O6ZA 2GGSA 2DBQA 2VQ3A 3EUWA 4PLCA 1BTOA 4LVUA 4D45A 3NGLA 3BAZA 3ZW8A 3GHHA 1HF3A 4WOKA 1WAMA 4H16A 1D7OA 4IZHA 2PWZA 1R4NA 5KJEA 1BXZA 3BTVA 3FN4A 3MCVA 1TT5B 3VZRA 1DIBA 2RH8A 4NBUA 4WGGA 5CPFA 3NEPX 3DTTA 2C7GA 4U6QA 1PL7A 2HMUA 2VYNA 1U7TA 3ASUA 4QQRA 4BL5A 1QLHA 1XQ6A 4WEOA 5LDHA 1FDVA 1JLLA 1LBEA 3AOEA 3KM0A 3UF0A 2DFDA 4M49A 2BGLA 5KJCA 2PKQO 2VRBA 3OA2A 1FJHA 1AHIA 3JD0A 5THKA 3GR6A 1GD1O 1P9LA 3OBBA 1GYQA 3WGOA 3B20A 3RBXA 4DRYA 1FDUA 3DBLA 4FW8A 1E5QA 3GDFA 1OFGA 3PGXA 3MWEB 3PHJA 2I6TA 3GAZA 3S2EA 1NQOA 3AWDA 3B6ZA 3BZUA 4CM8B 2Y99A 3F4LA 1E7SA 3QVWA 4IXWA 1EDOA 4LRSB 5TJHA 1LRLA 2E48A 1HDZA 5JY1A 3TWOA 2NU6A 3QLJA 3FWNA 4PG6A 4IQGA 1ZH8A 1Z73A 3ZNPA 3GVCA 3BHIA 4EJMA 4B3HA 3JYPA 1ONPA 4BUCA 4CM7A 5JW6A 4OO3A 1E3SA 3QWBA 2P2SA 2OHXA 3F5QA 3RUFA 1K89A 1H9BA 3FRJA 3KSDO 3W4IA 2JHFA 2E4AA 1SEVA 4RPGA 3GEGA 4RF5A 4R51A 4AVYA 2VRCD 1WMAA 3ENNA 4OGWA 3GDOA 1VL6A 4FSHA 1YB5A 1VI2A 3WFJA 3Q9UA 4XQGA 4AG3A 3WX0A 5CHEA 5COAA 1ZK2A 9LDTA 3DZGA 1DHRA 2EHDA 1WZIA 4PZDA 5G4KA 3HDJA 4XYGA 4XGIA 5ER9A 1E0DA 3H2ZA 1XDWA 1M2WA 1YE3A 4NU5A 4N5NA 4WCFA 4AJ4A 4YAEA 1DAOA 3UOGA 3WLEA 2CVOA 1CWUA 3MJVA 4ID9A 4NJMA 1QYVA 3INGA 4TSKA 4Z6KA 2NTNA 1U5CA 5K6AC 4AICA 3JD1A 3RUDA 3ROMA 3EW7A 4J9VA 3AM3A 1T24A 1I2CA 3GQVA 2C5AA 3R0IA 5BSEA 2HK9A 2CSUA 4II2A 3K73O 1DFGA 2NVBA 1T4BA 4A7PA 3AY6A 5L7YA 3GPIA 1E7YA 1NAIA 4RORA 3QQPA 4XDYA 1RWBA 1EZ4A 1H2BA 2DVMA 1AGNA 3GVHA 3GNSA 1DPGA 1TT7A 1QSGA 4ZQEA 5I8WA 3C1OA 4RZHA 1D8AA 3S1LA 1NR1A 2Q45A 2DTDA 1WLYA 1F0YA 4MVJA 3QHAA 3RBZA 3ZWAA 5C7OO 4DPMA 4E30A 4R54A 1LDGA 2ZJ1A 2EWMA 4GL4A 1HDXA 4DBVO 2JD0A 1X13A 1I3MA 2EJWA 4L73A 4RCVA 1GYRA 3UAGA 4U0JA 5B4VA 1ORRA 2J3HA 3ZWCA 1NYTA 5A5FA 1BSVA 5A3JA 3ZCXA 5CFZA 4DQXA 3TOZA 2VHYA 1SCUA 1K6JA 2BHLA 3MTGA 1JDJA 1DLJA 4YVFA 2O3QA 3PFFA 5IJZA 1Q0QA 3TZKA 2WD7A 4QFCA 3GVPA 4CQLA 2HAEA 1ADCA 1OC4A 3L9XA 1VSVA 2B35A 3NT2A 4YJFA 4GWGA 5F1OA 3U4DA 3E8XA 4HUJA 4PVCA 1VL0A 3PHGA 2DQ4A 2JHGA 4CMEC 5FI5A 1O8CA 3WYEA 1YO6A 3OH8A 3KHUA 3HN7A 3SLGA 2AMFA 3IIEA 3HFSA 2ZB4A 2ZJ0A 3CSDA 1SNYA 1VSUA 1N7GA 3E5MA 3E6AA 4RVDA 3FPCA 3E48A 4A73A 2VNSA 2YV3A 4W82A 1ADGA 2RH4A 3LDHA 4PLYA 2X86A 2VNAA 4CM4B 4O63O 4BNTA 3WGHA 3RWBA 2B4TO 4J1SA 1GUYA 4JJFA 4MINA 2D8AA 3KZVA 4JLWA 3V2GA 4GH5A 4NZ9A 3RC1A 4ZRNA 5LDGA 1YQXA 4QO7A 5AXAA 5DBGA 3WJ7A 4U8GA 1EK6A 1J0XO 4FPXA 1LSUA 2Q46A 3I9MA 2O3SA 3SBOA 1BXGA 3PZRA 1ZSVA 2X4GA 3DO5A 5A9TA 4DPLA 3AFMA 3EGOA 2WMDA 1HTBA 2CNBA 2IRWA 5IFLA 2AG5A 4N7RA 5DOZA 1XR3A 3UCXA 3GGPA 3OJ0A 1YB1A 2H63A 1QR6A 1ENYA 1R4MA 2ZK7A 1H93A 1I01A 5I7VA 1OI7A 3CTMA 3HZZA 4IQ0A 3WBFA 4BNWA 4CPDA 2CUKA 5J23A 2BGKA 2WSBA 3U4IA 2OBYA 4RVGA 4OKIA 3Q2IA 3E18A 3WQSB 4CQLB 4J16A 1Z82A 2B69A 2AQKA 2JCYA 3WXBA 1X0XA 3ZNOA 1I3NA 4BGUA 3EAGA 3LVFO 5G0SA 2OUIA 3S8MA 4EJ0A 5BT9A 3HN2A 1ZBQA 3RAJA 2B5WA 1QYWA 2E49A 2B37A 3ON5A 1ENZA 4F45A 1QYDA 2EP5A 4D3SA 4EUFA 3DMTC 3E03A 3Q0EA 2J8ZA 4BO7A 4D46A 3DZFA 5TIIA 3RC2A 2JFGA 3ZHBA 5JMWA 3E9QA 1ISJA 3C8MA 2JAHA 2NUAA 3H5NA 4RL6A 3T4EA 4FJ1A 3STHA 1MV8A 5IDXA 1QV7A 3T4XA 1UZMA 3GMSA 4FOOA 4BV9A 4HNHA 4FB5A 1PS0A 2X5KO 3LC7O 4YJHB 2BLLA 5I7EA 3RROA 1UR5A 2P4HX 1SOWA 3NYWA 1UXKA 3KYDB 4TMFA 4YT2A 5A03A 2J6IA 2Q3EA 3INRA 3F5SA 1A7KA 1J5PA 4JN6B 2VOEA 2Y67A 4RF2A 2P68A 3NAQA 1HE5A 3UICA 2XXBA 2X9VA 3CUKA 3FCOA 3GC6A 3PHLA 3C24A 1GQQA 3ZV6A 1T26A 3A4VA 3KBOA 1R16A 2IYPA 4CV2A 4URFA 3RUHA 1AE1A 5TLSA 3OM9A 4J0FA 4UAGA 4BKRA 1DRUA 4NMHA 5G4KB 3E1KA 4ZGWA 1A9ZA 3BIOA 4CM4A 4KZPA 1V3VA 1XHLA 2QHXA 4CMIB 1ZJZA 4EEXA 4N5MA 5AXBA 2C82A 1LXCA 4Y6SA 3BMNB 5AXDA 4PG4A 3W1VA 1VKNA 3GNQA 1AUPA 4PLWA 1GDHA 3V2UA 4R1SA 3IJPA 3WTCA 4MVJP 3U0BA 1MUUA 1DJQA 1BW9A 1P74A 1UH5A 4WUVA 4ND4A 3ZWPA 4BB6A 5CDUA 4OH1A 3MJEA 1SEPA 3CEAA 1YVEI 2AW5A 2IXAA 3KYDA 4QT0A 3WMXA 4IJVA 4TRMA 4CMCA 4BKUA 4DXHA 2RHCA 4NU6A 1E7WA 1U4OA 1LJ8A 4QTZA 5KTKA 2PKRA 1T2FA 1GUZA 4FFLA 2A94A 2QX7A 2VUUA 3HDYA 1YBMA 2X6TA 4H3VA 5IZ4A 2X1HA 1ZKMA 2V6BA 1CJCA 1VJ0A 3JQ8A 4YT4A 4BO6A 1HRDA 1WDKA 5GY7A 4QUKA 2VWQA 3DMYA 4UVEA 1GZ3A 3NJ4A 4OQYA 3RU9A 1NR7A 1D1TA 1T2CA 5IF3A 4Z0TA 3FBTA 3GUCA 2PNFA 1U5AA 3GZ4A 4WPGA 4UVIA 3QWFA 1U3TA 4ONEA 3LYLA 2Y66A 4DIFA 1B7GO 2EERA 3O8QA 4JBGA 3HJAA 2C07A 1QG6A 2GN9A 4YA6A 2WM3A 5A5EA 4NK5A 4AJJA 4XJSA 4ZHSA 2Q4EA 3RD5A 4OKNA 1IB6A 5EN4A 3H3FA 4LW8A 3BTUA 4I5EA 1WXDA 4WCFC 5HS4A 1U1IA 2IYOA 4YJHA 2I99A 4YRBA 1W6UA 3NDJA 3IC5A 3IL2A 2VWPA 5T5QA 4OSOA 4UVGA 3UUWA 5H81A 4IDEA 1KYQA 5COBA 5A4DA 1TLTA 3TFQA 3BTSA 4J91A 2FR1A 3AM5A 2GZ1A 2PZKA 5A05A 1N1GA 4NJOA 4DLLA 4BIIA 2Y93A 3D3EA 1B14A 1IL0A 2NM0A 2UV8A 1VLLA 2AHRA 2EF1A 2UUOA 2WD8A 3VH1A 3AI1A 1FDSA 1YB4A 4J43A 2X0NA 1NTOA 3H5RA 4WNIA 4XA8A 2BFOA 2HQ1A 1T25A 1CETA 1Q7BA 2Q49A 1MFPA 3H9EO 5LCXA 1PWZA 1UXIA 5BR7A 1EBUA 1K6IA 1V3UA 3RKUA 4E31A 3E9NA 2JAPA 2FPPA 3RKRA 4NR0A 2WTBA 1I3LA 4I9UA 3AOEC 3L77A 5JCJD 2BRUA 1ZK4A 1YRLA 1BWSA 4BNXA 1K3TA 1TI7A 2Y1FA 3NDRA 3OQ1A 2CZCA 3BA1A 3GGGA 1TT5A 3CMCO 4E12A 2UAGA 4BNVA 4ZQBA 3PJFA 5HWSA 4CMJA 4Z3KA 3SXPA 2GF2A 4WK6A 3LQFA 1N9GA 2OOSA 5DDIP 1GZ4A 3OEYA 3IS3A 2X0JA 3AI3A 1KC3A 2IODA 1NPDA 4AJKA 3E82A 4CUKA 1H6AA 3RSHA 4MDHA 2NVUB 4CL8A 4GMFA 1P45A 1DC6A 1MA0A 3NTOA 4RLSA 3WNQA 3DBHA 4K26A 4YB8A 4CLDA 4IZIA 4TRRA 2OFPA 1PJTA 3JQGA 4R16A 1KEUA 1NFRA 1UAGA 1ISHA 3RASA 5JC1A 2W2KA 4DGSA 3PPIA 3C1AA 3ZU3A 3FNEA 1ISFA 3DFUA 3AUUA 2NVWA 3PHIA 4XIYA 2RBEA 2Q1UA 2J3IA 3MOIA 4MVJE 3AI2A 4Z9XA 5I8ZA 3K6JA 1I3KA 4Y8VA 3FSRA 1PZHA 3B1FA 3UXYA 4FCCA 3OFSA 3JQCA 4NDNE 4NHEA 2NU8A 1U3UA 4GGOA 1E92A 3ETGA 5L51A 1CERA 2W4QA 2IXBA 3UCFA 1N2SA 2BMAA 3LT2A 1IZ0A 4XJTA 3SC4A 1EUZA 3AK4A 3HNPA 4P4NA 5K6AA 1B0AA 2X5OA 3EVNA 4J49A 3H9JA 4PLHA 2WWRA 2HCTA 1UAYA 3NTQA 2ZB3A 1N1EA 5DCYA 1B15A 4Y6PA 5T67A 3SVTA 1GEGA 2GDZA 2O4CA 4PFJA 4B7UA 3VPSA 1NM5A 1P1KA 4E5MA 3WSWA 3WOHA 1Q7GA 3GK3A 4RDIA 4GSKA 1ADFA 3ZNQA 1JU9A 4D3FA 5A1TA 4Z9YA 3GGOA 4GLOA 1X15A 4CQMD 3LC2O 3AUSA 1ZCJA 3RFVA 4GWKA 2YZ7A 3DEYX 1WDMA 1PS9A 3MEQA 4ZD6A 1PQUA 4CMGA 2PD6A 2Y1OA 1R37A 5EPOA 5GZ3A 4U6SA 4LISA 2CMDA 2AE2A 1PJCA 2ZCVA 4JK3A 4WE3A 3H8VA 3JQ8B 2Y1GA 3A14A 4MVJM 1ZXLA 2NNLD 4Y6RA 3OQBA 2B36A 2CF5A 3PLNA 4YQZA 4CODB 3DMTA 1G0NA 5EESA 1GYPA 1XKQA 1E7MA 1NWHA 2R00A 2GRAA 5AOVA 1EVIA 2RHRA 3S2IA 4GX2A 3JQ7A 4BNJA 4P8RA 2NU9A 2FP4A 2X5JO 1I24A 4JP3A 4R1UA 4CV0A 3IKVA 1PZFA 4YT5A 4YT8A 2B5VA 5THQA 3ZWOA 3S2FA 5CG2A 4BO5A 1QLJA 1HDOA 4TQGA 3WLFA 4DUPA 4YRDA 4ALKA 2FMUA 4D42A 3PTZA 4ALMA 2OXIA 4FR5A 4NBTA 2QZZA 4RVHA 2OP1A 4GPD1 3GZNA 1YS4A 1M6HA 3PI7A 1VPDA 4BO8A 3MJTA 1ENOA 4R69A 3DZBA 4WOJA 3EZYA 4RDHA 3TF5A 4F46A 3K96A 7ADHA 1XA0A 3JQBC 4JBHA 3I9NA 4M55A 1ZW1A 3JYNA 1EFKA 3GG9A 4BGEA 1LA2A 3QVOA 2R6JA 1DOHA 2Y1EA 2HMVA 2J3JA 3HDQA 1MG5A 5ICMA 1E3WB 1A4UA 1CF2O 3QW2A 3V5NA 4E0BA 2VTDA 4ILKA 4YEDA 3MOGA 3PJEA 1E6UA 3UKOA 3ZHZA 2HJRA 4B7XA 5FEUA 5T8KA 5ITWA 2VWHA 5DN9A 4YXFA 3EMKA 4E5YA 2PD4A 4B4WA 1MP0A 2DBZA 3WS7A 3QVSA 4D79A 1CQIA 3PJGA 4FGSA 1I8TA 4XGKA 1P1HA 2ZATA 4HFNA 3CZMA 2FPIA 5K0ZA 5IXYA 4KQWA 2PGLA 3PIDA 2YQ5A 4PLTA 4LVCA 2CY0A 5T57A 1HYGA 2AA3A 1DFHA 3ANNA 4BV8A 4X54A 2D3TA 1PX0A 3PJDA 4MIYA 3DZHA 3PQFA 5I9MA 1XQ1A 5GZ6A 2JL1A 2O7QA 3D4OA 1EQUA 3JCZA 4PLPA 4II3A 4O0LA 1KEWA 2X23A 2Q1SA 3H3JA 4FFNA 1T1RA 1LQTA 3VAZA 1OBFO 3G0OA 1PIWA 3WB9A 3VTZA 4CV3A 2POQX 4XWYA 1WDLA 4O6VA 1NFFA 1EE9A 3QE3A 4QSMA 5B4UA 2Q2VA 1O95A 1EMDA 2OL4A 1J6UA 3KLPX 4LRTB 5DCUA 3SEFA 3NTRA 3KEOA 3SJUA 3KUXA 1O9BA 2J5KA 2PZLA 2X0RA 5TF4A 3OSUA 3PDJA 1U2DA 2I67A 3VVBA 2O7SA 1LC3A 1EEHA 3ONEA 2R00C 4FC6A 2AQ8A 3NDIA 3MTJA 3TN7A 1B3RA 2PK3A 3GPDG 3RUAA 3ZU5A 4JIGA 4YDRA 1D1SA 3H7AA 1JAYA 1DBVO 2YFHA 3I6QA 5U9CA 3MJCA 1G0OA 1KVUA 1SAYA 3WGQA 2C59A 2XOXA 3WQQA 3PWKA 5DF1A 3ITDA 4XIJA 4XEHA 2ZKLA 3OJLA 2Q1WA 4BKQA 2C29D 2IEDA 1EE2A 1YDEA 4ND2A 3KO8A 1YH3A 3ST7A 2I66A 4W7IA 4OL9A 1VJTA 3OJEA 2AXQA 4TROA 3ENKA 3P5SA 4A5OA 5MGBA 2UVDA 3JQBA 2IZ1A 2P4QA 3Q6IA 1RM5A 5FI3A 2PZJA 2VT3A 2XXJA 4CM3A 5EQFA 1OZAA
chains in the Genus database with same CATH superfamily
1XDZA 1G291 2XLBA 3OQIB 5BVHB 1SZPA 1E5TA 4N5LA 4DB4A 4KQEA 1DQRA 1VHQA 3ZVRA 2NSYA 1YI8A 4XR9A 2OYCA 3U3RA 4EITA 3CG4A 4DXDA 4ZYTA 2P6RA 2LRHA 4Q5IA 2ICAA 2I78A 3L1HA 1ETUA 5LA6B 2V5UA 3HE3A 2FEKA 4L72A 5DN6A 4C5AA 3CKYA 1XROA 1XRLA 3AUYA 1I3CA 5TV2A 1EFAA 2FZEA 2P8JA 1BH2A 2XB8A 4C0KA 1V5FA 4EI7A 1ESNA 2P9CA 4IG4A 3ZBPA 1GPMA 3HABA 4I9HA 3C15C 3FHJA 3HRKA 4M2LA 4NU8X 4RQUA 5EJAA 1XJQA 1KO4A 1N3BA 2OHJA 1UXJA 1UJMA 3AIKA 2Z2JA 1VJGA 4N82A 4BLSA 3MQ4A 3H5VA 3NM4A 2WV9A 3UFXB 4G0XA 3HG7A 1WZCA 1RWMA 1T9GR 2IZZA 2J9FB 3KLMX 4HXFB 4L07A 4LJAA 1WSBA 4JDPA 5AW5A 2QI9F 3B6JA 3FRHA 2A58A 3WYCA 2DY0A 5LVAA 5JOQA 2HV9A 4ZU1X 1H9AA 3V1TC 4L9AA 2IY7A 4HSGA 5AM4A 5GAJA 2IDMA 1K97A 4GQIA 1DIHA 5HKKD 4NZZA 4YRZA 1BDMA 1M10A 3PX2A 1X2EA 4Q19A 4LRWA 1VSBA 3JASA 1D07A 2C8VA 1V5EA 2UUAB 2I91A 1L2TA 3TTUA 3UWMA 3IQDB 3KOOA 5IEJA 1RPJA 4O1HA 3AR3A 5H5JA 1ODCA 2C4VA 3HYSA 3NRJA 3BK1A 2YUTA 4TQUS 1CS0A 3PKZA 5C35A 3VPAA 2FVYA 5IBPA 5AVXA 3DF9A 1EUYA 4XQEA 4QEZA 4ALNA 2AN1A 2Y1KA 2HC9A 2R6AA 3N1UA 3CHYA 3ZHSA 3JWJA 1XZNA 3CH4B 3R0QA 4FU0A 1JAZA 2ST1A 4ZVLA 1YDHA 1RTTA 1QHHA 4JB2A 2C8KA 3HSKA 4Y2UA 1G8MA 1JG2A 3D0QA 4CT4B 1ONOA 2CHEA 5JWHA 1ARZA 3JWPA 4DBLE 1F20A 2XOKD 2C5LA 1Y6JA 3JQAA 5FIUA 2PVCA 4CM5A 4QU8A 1J2YA 4ABTA 1N8NA 1EHIA 2PXAA 3G9TA 1SKBA 1VL5A 2ZIEA 2FP4B 3M6WA 3TPFA 1RJWA 3DGFC 4PZEA 5K45A 3KUDA 1DIRA 1H6BA 4YJGA 1HY3A 3BWXA 4OHFA 2X41A 3OOWA 3E5NA 2ORIA 5U4QA 5B2ZA 2A57A 3TEJA 4OK6A 1AXEA 2P30A 3HPRA 3FWZA 4NNOA 4WIAA 3ZHUA 1UP4A 2FOIA 3I53A 1MAHA 1SCNE 1JKJA 4M54A 5LC1A 1GCGA 3ZK7A 3FLBA 3RTGA 3BE4A 3OICA 4KRGA 1ELOA 1Q12A 3O8BA 1AKMA 1QNFA 1TW2A 1Y4AE 2QYHA 3JWEA 3AHEA 3ZW9A 1HT0A 4NHOA 3WV4A 4JLNA 1E8NA 1JXAA 1JEEA 4QUGA 4EPVA 3FI9A 2I6XA 4Q3BA 1E1YA 3QTTA 4JBYA 1XLTA 2P90A 2V7BA 4H6PA 4S24A 4GM1A 5D6NA 1OYVA 1UP7A 4C7VA 4G4SP 3MLAA 5DRTA 2PJZA 1UMKA 4G0NA 1F6WA 1SD5A 5BV0A 4C2UA 4OQMA 3Q3IA 3HCBA 1JHOA 1RKQA 2WDZA 4CM9A 4BWFB 2FWAA 1Q16A 1GTZA 2D2IA 3WGGA 4JL8A 4JR0A 3O95A 5JCZA 1VKJA 2ISSD 1GL7A 1VE6A 4KQIA 3T1VA 2H2IA 3GLGE 3K9WA 1K08A 4GWLA 4TKVA 3Q5EA 2XMQA 3EXAA 5IMBA 3VOSA 5IDYA 5DRYA 4I1IA 3V1NA 1VRCA 1ZGGA 3C4JA 3KQSA 4I6EA 4J3FA 2H5EA 4UXIA 5HX7A 3ILXA 4F72A 2GTPA 2GZRA 1NVTA 5EYPA 4CTKA 2O48X 4I9NA 1TM1E 2YYYA 1KZ6A 2VDQB 2FY8A 3R5FA 5EIHA 5HK9A 5B3KA 2GCGA 3WYDA 1IUPA 4ZT6A 4PSDA 4M89A 3GLHA 1BGWA 1I4LD 1ZGAA 2R7MA 2PTHA 1PQYA 3LC0A 3TD6A 1RM3A 3KL2A 2I80A 1SG6A 2WU8A 2C1EA 1T8YA 1S7GA 1OREA 1XZGA 3KZOA 5H02A 3SYNA 4WEQA 3ISJA 4TM8A 1RI4A 4X6LA 2PR7A 5T3UA 3SBDA 4AJHA 4D0RA 1G21B 3UPTA 3WQRA 3P1JA 1ZN2A 2HM7A 3PDIB 1RQLA 4OHKA 4G4IA 1Z3IX 2HYIC 1EBFA 3D6FA 3B7GA 4JBWA 2C5BA 5IYZF 1S3FA 2O06A 1O95D 2EKDA 3KLBA 2HIGA 4ATNA 2AG8A 4F6LA 5LPNA 5DBFA 2WPNA 1ZL0A 2IU0A 3FPKA 4F1JA 4DANA 1A96A 1BDBA 5FR1A 4XCVA 3OI7A 1DO8A 5SY9A 4PYMA 5JAHA 2R5WA 3ONDA 5LP6A 5CLIA 4TXHA 3WYAA 1TECE 4MICA 3GZJA 1N4AA 4CLRA 2BEWA 2GK7A 3NHMA 4PS0A 5IAAA 4K9DA 5AW0A 3B1ZA 4Q3KA 1NBAA 4TWZA 4EW1A 1YT5A 2YXPX 1FRQA 2I1WA 2H65A 1DWUA 3ASYA 2N9UA 2V55B 1TF2A 3RJ9A 4PPGA 2BAGA 2H6EA 4YK7A 3ICPA 1T2NA 2QUKA 3BYZA 3GBSA 4V38A 1L1FA 4DV2B 1N6IA 1PZEA 4WZZA 4ZO9A 1TIKA 1C7JA 4YUZA 4W5OA 1XFAA 1EA5A 3HADA 3QENA 4X95A 2QTRA 2GXUA 3GVXA 1OLUB 2DFLA 3BCUA 1F0NA 4HADA 1NJ1A 3PNBA 1L9KA 4B45A 1R5NA 4FQ5A 1ZA1A 4H6XA 1SPBS 3COPA 5HF6A 4YJGB 5HIIA 2P91A 3MFYA 2GETA 1G59A 5BWOA 4KN5A 3T06B 2K6GA 1LX6A 2Z4TA 3MAAC 3RTCA 2WU0A 2XMRA 4XVHA 4P32A 5DX8A 2PUCA 3A31A 2G3YA 5CGZA 4N54A 5IYZA 2IUSA 5CIYA 2BGJA 1A71A 1NVFA 1HG0A 1ZQ9A 2P79A 1U04A 1Q0ZA 3EXEB 3F6SA 4LGVA 2I2WA 1M7HA 3JAKA 4KPUA 4KWEA 1L7NA 3E7WA 1L5NA 4JX9A 3SJ7A 5IFKA 1SOMA 2UUCB 3DVSX 5BR1A 1EXWA 4DUYB 1XMOB 2GRUA 1UDBA 1U28A 2I65A 4EZBA 4PQGA 5DHAA 5BW5A 3N58A 2P7HA 5AVOA 5HFJA 1Y7TA 3RYHB 1XRSB 2RGNA 1CQJA 4BDSA 5BN5A 2REBA 3NC4A 5KQGA 1FUKA 1LLQA 2YJ4A 3AU8A 4RUKA 4Y2PA 2VHEA 4LQDA 4QULA 1NMZA 1NT4A 1AMOA 1NI5A 1L0BA 4RKEA 3AF6A 1UPUA 1Z74A 1ZI6A 1N0HA 1WDTA 2Q1TA 1SB8A 1T13A 2L82A 3IT1A 4OUDB 3K0SA 2CEAA 5DP2A 5K4HA 2IXFA 4LJ7A 3CLTC 1ZJ5A 3VX3A 1T5BA 1QPGA 3KVRA 2B4RO 3W6OA 4QOSA 1P0MA 5KVVA 2A0XA 3ZWWA 1R18A 3ZV3A 2MYNA 3VNQA 1UPAA 2RAPA 3EXIA 1ZHOA 2J33A 3B53X 3WK8A 3EVCA 2H1CA 4D5EA 1XDUA 3KOYA 4C0BA 2VYND 3VKFA 2V6JA 1HK7A 5AQ1A 5LMNB 1JV2B 4TUYB 3WV5A 1D09A 3HNRA 5EP4A 1ZPDA 1VKRA 3I32A 5IKPA 1NVVR 1RYZA 1LUAA 2LDXA 3KPJA 4ZFNA 2W6ID 2ORYA 2QW8A 4FINA 3H9GA 4JI7B 1Y81A 5B7QA 4FS3A 3SEAA 1CF9A 3ECSA 2V7GA 4MEBA 1NNLA 2CWWA 9ATCA 3BDAA 3MGKA 3FRIA 3GAMA 2P75A 2J3DA 4NS4A 2LBPA 2XX3A 3ZV4A 1GGFA 1FU8A 3R9XA 5AJYA 4GE3A 4WKCA 2P3LA 2W6PA 4J8PA 2IYYA 3ZH9B 1N4DA 5KVSA 4LXXA 2WJPA 3R5KA 1M2EA 4XIGS 1GA1A 5CDHA 1IZ9A 3RVBA 1EGMB 4RAQA 3D6NB 1EUDA 4DLKA 2G77B 4QXMA 3PEVA 4PSCA 1DRJA 1RVV1 5ITZB 1LJLA 1Y3CE 2V96A 3W8EA 3CLSD 4K6FA 5AUOB 1VE3A 5E6RA 1A2KC 1L3BA 2WC1A 3HACA 4G24A 4Q21A 4ZMBA 1VB3A 3CXRA 2IITA 3ICVA 4CZ2A 4E1BA 1YR1A 4UU1A 2ZYAA 3GLQA 1WW3A 1T2DA 2BF4A 5TEWA 4RIEA 4BP9A 4EF4A 2D59A 4PRZA 1JPVA 1PR6A 3ZHYA 2FW1A 4XQ9A 1Y8QB 2GN1A 5CT9A 3IMFA 1QHIA 3GWZA 1UKAA 2FSVC 3ADOA 2AIRA 5IARA 1TCCA 1G5TA 3LY8A 4LHYA 4M1WA 2WE8A 3O8OB 1V4NA 3TL3A 5F3WB 2NUBA 5EJ6A 2IL1A 3COZA 4E2WA 5C32A 3QY9A 2ZYWX 1NY5A 3OJFA 1NLYA 1N6NA 1ZP6A 4LC0A 5K1ZA 4O02B 3LD9A 2B8NA 1UBMS 1DG9A 4F1KA 3UJHA 3HI4A 4FFRA 5F73A 4KMMA 1YRQA 2FK7A 5I7RA 3ZVMA 1C1YA 1E8DA 1KVRA 3E23A 2PSFA 1CRLA 1NULA 1R66A 1YZVA 4K3VA 4RYLA 4YBZA 4Z51A 3P52A 4Q9LA 1TEHA 3MELA 2HT1A 1OF1A 2K87A 4KX3A 2ZIFA 3QX7A 4D4HA 1JZQA 4FLMA 1TQ6A 2FRDA 4LS3A 2QP4A 4CW7A 1SCUB 2X42A 1Y7IA 1VSTA 1U0JA 3W5BA 5IP5A 3H4MA 1WPXA 3DC2A 3HBAA 1ZOPA 3PR1A 4FVTA 5B1HA 4HUTA 3RSZA 1DIGA 4TSRA 1PU2A 3BWYA 5KAPA 2FK8A 5K5EA 1PYGA 4OP2A 2P9FA 2JFHA 2YUIA 2VYVA 3H86A 4BVLA 2FSGA 1SBNE 4UMVA 3A36A 4OK5A 4YMIA 1XL1A 4WK4B 1RJFA 3CNNA 3M4ZA 3VR2D 4ZYLA 2NZYA 1SN7A 2CLLB 1YD7A 3DB2A 4OGFA 1XPUA 3PXBA 3KEQA 4BYMA 1EM8B 3PHHA 1ADYA 4WXYB 2OXRA 2Q4DA 4KR0A 4FR0A 3ZOZA 2EGHA 3GMDA 1L6IA 2JLYA 3HYLA 1SOVA 4L22A 4OU4A 1J9ZA 4HDNA 4C04A 2VHXA 1Z29A 2Z2IA 4S04A 1B3BA 1KJWA 2WPDD 1X77A 1DQPA 5A0VA 1LBIA 3QXXA 3HJCA 2SCUB 3U56A 5U1PA 3W5DA 5EMHA 5EXDA 3E35A 5CG1A 4KNYA 4E5SA 1B16A 4TL8A 2ZRBA 4FGJA 1FP6A 1V9LA 2XCLA 2M6LA 1RWOA 3E9ZA 4MGZR 1FSZA 1T0IA 5KYTA 3PYXA 4AQ7A 2WRZA 4GX5A 3U44B 3AR6A 3LO5A 1EQ2A 2A0WA 1P0CA 2IW3A 2VSOA 2VHCA 3PXCX 4DL9A 1RQ2A 2CDRA 3IX7A 3SN6A 4D4LA 1AZLA 3EISA 1Z06A 1UJNA 1ZAKA 3SU8A 1S2IA 4Y2XA 5G02A 3SEQA 2H1HA 2X6RA 3RG2A 5I47A 2IK8A 3KQWA 3MPUA 3F0TA 1PKXA 3TBHA 4Q34A 2R9VA 5BWBA 5K8TA 1HYQA 3BSSA 3CLUD 4ZYZA 2J0QA 1FXUA 3QUAA 4X84A 5DHPA 2PSJA 4RY0A 3VA7A 3USCS 4DDWA 5T41A 2P0EA 6REQA 4MR7A 1H66A 3D6JA 4PPYA 5H3CA 5A3SA 3DR3A 3A6EA 3F97A 1U9CA 4BFCA 1B2RA 4DIDA 4JLPA 2I6FA 4L4RA 4L2IA 4DUGD 3P45A 4U2CA 2BFBA 3G2QA 3VPFA 4CMHA 2DF8A 4GKBA 3H6KA 4HZIA 4X63A 4YWJA 1IDN1 5JD3A 3RLIA 1OZFA 2GD6A 4G5RA 3NW9A 2GKSA 4HOYA 4NYMR 4EZEA 3KJXA 2FPUA 1CUFA 4WFIA 1P1CA 1WZEA 3LRXA 3MS4A 4RLQA 4WXHA 3VR6A 4BNIA 2YHIB 5KJFA 3A25A 3FPSA 4AC9A 1OH7A 1WV0A 3WYBA 1NVBA 3LCRA 4ZZIA 3O2SB 1EJBA 2DJIA 1EDZA 1KU0A 3CN9A 4LMRA 3UFBA 4DMGA 1KDOA 1BC5A 1P0FA 4OJKA 1W4ZA 1BW9B 3THXB 4AQDA 1BG6A 2JLCA 4BV2A 1V4BA 3OLZA 3WO1A 3DKIA 4MH0R 2PX3A 3A9RA 4QXOA 4RV9A 3NHLA 5G40A 4FEGA 1THMA 5FDFA 1VXRA 1YB7A 2GA8A 5AJWA 2OCDA 1OUMA 3QVKA 4F93B 4MARA 2X8AA 3NHKA 5JYEA 2ZVPX 1NJSA 1BMQA 3LA6A 3RC7A 2QMHA 3VPXA 4EVRA 4KQ9A 3HBFA 1R7RA 4WT7A 4RXMA 4D6PA 4EJ2A 4HF7A 1TQ8A 1DNPA 2AEEA 3MRTA 1PZGA 3PYLA 2PZBA 2XAAA 1X80B 4LBWA 8AT1A 3PXAA 3FKQA 2HTEA 1ZUIA 3WIBA 2JCVA 2V4ZA 1MT0A 4ZVVA 3HGTA 3QFFA 3PFNA 3HU5A 3L0BA 2AI2A 3OA0A 4RZ3A 3AEQB 4WZAE 3T7DA 3ZDYB 1KBQA 4GZLA 4RKRA 4F2GA 2CVZA 1ZVKA 2PTGA 4HDKA 4QYWA 1Z0DA 1SKQA 3TCXB 1O1YA 1P9WA 1Q1QA 3CISA 5HMLA 4YAUA 3WFIA 3JYLA 1KAHA 1ZS9A 3FIUA 5JMPA 3TZHA 4B8WA 2XUZA 1XKLA 3RV3A 1W2HA 1XTRA 1XTVA 5ADWA 2OBBA 4JA0A 3R1IA 4RVNA 5L3QA 4RL4A 2KLBA 3UHOA 5EKSA 2HWWA 3IEMA 4HEA6 2PFKA 2C4UA 1Z2PX 4Z2YA 2B8EA 3CRQA 4P4UA 3HL0A 3OIYA 1E2IA 4OHOA 2EZ8A 1E5LA 2Z57A 4ZIRA 5I7AA 3U16A 1SM4A 3GUZA 3GNTA 4FGWA 4Q01A 4FNMA 2QMQA 4JQZA 5JD6A 1TCUA 3R6GA 1DDOA 5FWYA 4UUBA 1DXHA 3TQSA 2EARA 1QZUA 2PWAA 5DM4A 3E81A 3IPAA 5C53B 2IYVA 3L0OA 4AFNA 4FFOA 4JLAA 4MS4B 5HIMA 3AKCA 4O2BB 4D0GA 4G84A 3R8XA 4EM6A 1G3IA 1Y8RA 1ULSA 2ZBUA 1PFYA 2RJNA 4HGQA 2AT1A 1LBTA 3E5HA 3QPUA 4V3CA 4ACAA 1VJ5A 2HT6A 5JUWA 2IHNA 3CCFA 3H4VA 5J5VA 5I4KA 3KQKA 2BWJA 4RWEA 1XLUA 4CL3A 5EIAA 3QWHA 4B3IA 2PA3A 3LYHA 1U28C 4J3JA 5LZ4A 4DV0B 2FZ5A 4BFLA 1YJAA 2RARA 3IERA 3PP8A 3IHLA 3M1IA 2Q3FA 4HYEA 3U3JA 3ZD9A 4Z49A 3T1YB 1H0SA 3W2GA 5B58C 5EP1A 2PH7A 1F38A 3SF8B 1NBIA 3R8CA 4JYPA 2BSAA 1GZHB 1ZMXA 2JAQA 2XUDA 3WKBA 1KRXA 1T10A 4W63A 2XSZD 4JBIA 1V8OA 2H5JA 4JLSA 1QKIA 1V9CA 2Q6KA 4J3NA 1Z4MA 1GL3A 1XHFA 3EK2A 5EHXA 2FE1A 1T4CA 1GN9A 2XMZA 4RLHA 3A1FA 5L4NA 4F56A 1CZNA 3RVQA 5H9WA 2IGBA 4HC4A 5L95A 3RNLA 1N1DA 2DTEA 3K15A 4BMVA 1IBSA 1WCYA 3BHMA 3DEHA 4JJKA 4EVQA 2R6ZA 2FZVA 3ZHXA 1UDXA 4MPTA 4GI2A 4TUYA 3DBOB 2NGRA 4M4SA 4UZEA 4ZOAA 2Q7XA 1P6QA 1SFRA 4UTPA 3N2EA 1QAQA 2B4QA 3BJRA 4PNHA 1T2EA 3LP6A 1OB5A 4PO9A 2H0QA 1Y89A 4ISCA 2IVFA 2LCIA 1CHNA 1SUPA 2VBIA 5G2OA 5A6SA 3RT1A 4LY6A 4JXKA 3B1WA 1CLEA 4HN2A 3ZIAD 1SBHA 2VC2B 1XTBA 4MRMB 4P22A 2PRIA 3L6OO 4HDMB 4EBFA 3KIPA 2O8EA 1AKRA 4ZDIA 3WLNA 3RBAA 3DHYA 2FKAA 1A5BB 1OGJA 4W5TA 1IHYA 1U9JA 4O3FA 4X64B 2PM8A 4QELA 1O6FA 1U8FO 2BEVA 3L1VA 1P4AA 3K2IA 2P11A 3JYOA 3RJTA 3SFZA 1MIOB 2FPLA 1N2ZA 2P78A 1R5BA 1KH1A 1D2CA 1NSFA 4HEJA 3O5AA 4OPMA 3T6KA 4LCEA 3T5MA 4IY1A 3IQIX 3KXPA 4RS3A 2JPDA 2O14A 4G8JA 4Z8XA 1MPXA 1BCRB 3PCXA 2NZ2A 2ZJBA 1QH1B 1O6CA 1RCFA 3GLUA 4NNJA 4F4FA 2N1MA 2EC5A 2ILTA 4CTMA 2AJTA 2CNNA 2O54A 2LZ0A 2JRLA 4RHYA 4NDAA 4BE7B 4UAJA 4RTNA 4KDFA 2WVGA 4EG7A 2PIDA 4RM3A 2H0AA 2DU8A 3CVOA 4IQ8A 1YVUA 4IH4A 5FOXA 4X1YA 1B26A 4AF6A 1XQ9A 2C88A 5E4FA 4NI5A 3MWGA 1U8XX 2VJMA 1PDVA 4I99A 1WTAA 1U8TA 3VVCA 2BJHA 3O8QB 4XQ0A 2NXWA 4PSUA 4G9EA 3OX1A 5JPDA 1Y1PA 5IG2A 4P33A 3TLZA 1OYWA 3UANA 2P8SA 3H5TA 5JG7A 3DOFA 2CFRA 2MSWA 2X2PA 2O2DA 3D7MA 4ZICA 2QM0A 2YJNA 3L5KA 4LUCA 3RDPA 1U80A 2FF7A 4OXKA 2EJUA 2C9ZA 3FTPA 4K87A 5BURA 1KY2A 5KWEA 2VHWA 4PG8A 1EFRA 3GLTA 4UJ5A 5HTKA 2A6PA 4PQEA 2O23A 5AKZA 3UUEA 1UBCA 1H1LB 1XAGA 5JVDB 5C1IA 2KE5A 3HYTA 3OM8A 4PXSA 2FRDC 5E8JA 2IUYA 4PQFA 2O2IA 3JZFA 2DQZA 1EXNA 3GFVA 4RPIA 2OAP1 5E9WA 2OR3A 3FNRA 4J4HA 4TSFA 3RVOA 3SEZA 1I6LA 1U2QA 2WJVA 3RJ5A 4J7UA 3I9KA 4YXWD 5ES4B 3VHXA 2LW7A 1OV4A 1FNDA 2WSMA 1NA5A 1RYYA 1T2VA 3MN1A 4XYLA 4Q4CA 1N5KA 1KZHA 4J0JA 2V4MA 3WYNA 5LJLA 2FQXA 2PH3A 1CR2A 3TBKA 1GSHA 4TMVA 1Z35A 3P9YA 1O97D 1V8DA 2JAOA 1HDGO 3CE9A 1HE4A 1NU6A 1AVTA 2VUSA 3FOWA 2JJ2D 3AF4A 3GO4A 1IHXA 3CT4A 3HHEA 3KJGA 4HAZA 4JUAA 5LIPA 1Y1KE 3LI2A 3PGLA 4NAHA 4TRNA 2WHXA 3QU4A 3K31A 4TVBA 1Y3HA 4FOSA 5KYXA 1BS1A 2H7YA 2V74B 1WUIS 4K1XA 5ERXA 2EFCB 1ICEA 1RE0A 1HZZC 1JIQA 3CF2A 1EFVA 2B83A 4FZ3A 2DSTA 3I4LA 3ZJVA 3IESA 1BWPA 1YS1X 2A84A 3HU1A 4IHKA 4GXQA 1CUGA 1XVIA 1Z6GA 3VNRA 4C3UA 3S68A 1QORA 5DSXA 3OIWA 5KNBH 2NO4A 1IJKA 1V6CA 2FN7A 2IBTA 4QEDA 1D4ZA 1VIMA 5HKLA 2QTHA 1J33A 3GRPA 3KKZA 5KKCA 4DZZA 1C41A 2D5CA 2OORC 4JH0A 3F90A 2FW6A 3PEFA 3ER9A 2X0IA 3NPMA 1ONNA 4LKOA 2ZTUA 2WSSA 1S8NA 3CR7A 2XZOA 1T4DA 4FN4A 1QZ3A 4IZ6A 3JARA 4KBFA 3AVWA 4YAJA 3R9XB 4WJKB 2FVXA 4Q1CA 5IU6A 3LUAA 5HRUA 4PRKA 3H5AA 3P2EA 4V0MA 4JXZA 1E8MA 1KXZA 3VOBA 3BEDA 3D9QX 3ABQB 1HYBA 1NMYA 2Z5LA 5WRFA 2C58A 3D2BA 1GJRA 4G5HA 3KSAC 2WJWA 1L9XA 2UDPA 3EGCA 3IA2A 4BASA 4C3OB 4UDNA 3KTDA 1UBEA 1ZMTA 1JHAA 4FNOA 4FHGA 4BO2A 3BS4A 2DXIA 1NV9A 2W6JD 4D56A 2IH5A 5T64A 3Q7IA 4FB4A 3LPLA 5IHXA 5BSGA 5FTJA 4R41A 4IOMA 5AK5A 4KTTE 5H16A 3DMRA 3OIDA 4JB3A 4KNVA 4Z5XA 1WX1A 2DHCA 2BHNA 3AEKB 1XCPA 4NDZA 5KQPA 2OOKA 2XMDA 3MCZA 3K30A 4R84A 3S3TA 3ZQUA 5A7HA 4KWHA 4BMPB 1ZH6A 3PU6A 5T6BA 4FONA 4L57A 1PL8A 1M1YE 1SIBE 2DULA 2I6UA 1UP6A 4I14A 4BRWA 5A3RA 1BHSA 1KEVA 5TGTA 4E2YA 2OP0A 1DX6A 1Y6GA 2G6TA 5CVTA 1T36A 2IPAB 4TTAA 1DSSG 1Q1ZA 3OE4A 4NCNA 3V8MA 2F64A 3VDRA 2JKZA 1V16B 1CUJA 4QGAA 5HS6A 5A6SB 3SYTA 3KKMA 3UB4A 1Z0SA 4P4LA 3JZDA 2RKWA 1PQPA 5FAXA 3KD3A 2BDEA 2CLEB 3GOQA 3I12A 4CV1A 4BKOA 5CXUA 2JBWA 1BH6A 4NL4H 5FBQB 1YI1A 4ED9A 1V6SA 4HN4B 2WP0A 4C0WA 4J0DA 3UJPA 1C30A 3M6VA 1FP4B 4PGGA 4AF7A 2EBHX 2ONYA 1MX3A 2G08A 1QHXA 3WG9A 1QE5A 3UMMA 4I1PA 2A1UA 1KPHA 4WRRA 4EAQA 1KQPA 3KUCA 4Q9AA 4BFWA 4J2OA 1LI7A 4ZDWA 3A9UA 2AUMA 3AUXA 4OJQA 3UCEA 1QC5B 4O4LF 5J3JA 5CT8A 5IVDA 1PEKE 1OH8A 3GMIA 1AD2A 3F6PA 3QKIA 1BQEA 4LQ4A 2CNDA 4CKYA 1NG9A 5TVGA 1E69A 4P08A 3KFLA 4TLAA 3KJIA 1DRVA 2VNJA 4QDXA 4Z7JA 3NVDA 1RFLA 3LUCA 4NE9A 1IRIA 4Q37A 4Q3EA 4F1WA 3L0ZA 4RY8A 5JSZB 4IW3B 4XKJA 4DT1A 3RAEC 2XUAA 1O96B 2QJWA 4BVAA 5K3FA 1K5DA 2AFIE 2LR0A 3ADPA 4QLAA 3V8NA 3HB9A 4GIBA 3VZQA 4P4GA 3K5HA 1QS0B 5BPHA 5K6RA 3DOCA 1TTQB 2QG4A 1WKBA 1W5AA 1PR3A 5HMMA 4Z4HA 1DE0A 3FZEA 121PA 4RNDB 1A77A 1CUXA 1H4SA 1R27A 2GBFA 4HGYA 1N5OX 3NXSA 2WT8A 4WD3A 3JS5A 4JT4A 1PEDA 3HWRA 2IYSA 3A1VA 4TOIA 5IVIA 2IUEA 4YHHB 1QIIA 1JFSA 1BYIA 2TMGA 4HEQA 3ZKAA 1ZVQA 3K72B 5REQA 3E9MA 1ECLA 5C4GB 1OLOA 1XJ0A 1TXGA 3FZYA 3Q1LA 1DPFA 1E63A 4MQEB 2CWDA 5JT1A 1YQUA 1KK2A 4FW9A 4ZVQA 3BE6A 1NJ2A 4RMNA 4GQBA 3OKCA 3IQZA 3RVMA 4ZODA 3L6RA 3WIUA 3MTEA 4V0RA 4IIEA 3EOBI 4P3PA 3VC7A 5MDHA 3RTAA 5TPWB 2ZXEA 1TW3A 4KLAA 1M5TA 1XQYA 2BKXA 2XAUA 4KYTA 4B35A 4CIDA 3JD2A 3RNOA 4RC9A 2VNKA 3BXFA 3VKGA 4OLHA 4DQKA 2GCNA 1A5SB 3CRRA 3S2ZA 5HTOA 5LM3A 4QUDA 1I7DA 1ZVVA 3R6WA 3DHEA 2YN0A 4NFYA 1B6RA 1EP1B 1L1EA 2E2WA 3R09A 2YASA 4PQYA 2IHKA 2FJPA 1QK4A 5J43A 5F1KA 3CNEA 2BTOA 3ET4A 1JA9A 3EVGA 2UYQA 2PKCA 1KIFA 1UJ2A 2GVNA 3PDWA 4K1LA 5EYPB 3SQOA 5BQ5A 2X4IA 5HE8A 2YMPA 4ARVA 5CEEA 3VH2A 2VI5A 2W11A 1ZN9A 4XGNA 2HSJA 5A04A 2HBYA 4PANA 4GDFA 1FQOA 1H6DA 2P3QA 1AUXA 1TDJA 4NJMB 4PX3A 4RA6B 3I42A 1J25A 2W5UA 1JEYB 2AEJA 3G5TA 2NUPA 2BHRA 2QVBA 5AXCA 4DA6A 4DC0A 5C37A 3TVTA 1O2DA 4R3WA 4FX2A 2DYKA 3BHJA 2BYTA 3CH5A 1K7YA 2Y0DA 5C8DA 2Q9CA 2IYAA 2YHUA 4WXMA 4HJRA 2LXNA 5M7EA 4CLOA 1IXRC 5TMBA 4N5IX 1CXZA 2JB9A 5JQGB 3O1LA 4TLBA 4YREA 1IN8A 2XKBA 4ZRMA 2CJXA 1Z0ZA 3SIXA 4MB2A 1E64A 2NADA 2XMSA 2GCOA 4OM8A 2WYOA 4LZWA 3T5GA 4EGSA 2FFAA 1A72A 4NCXA 1EGHA 2ZFUA 1A8SA 5CM8B 3NM5A 4GX0A 4R9UC 3GW8A 3P8ZA 4C08A 5E9AA 1CUVA 1O08A 1QK3A 2V3WA 2MSEB 4F4DA 2EQBA 3WZLA 2OFXA 4HH3C 2WAXA 3LY5A 3TZ6A 4CMEA 4EG5A 5EHZA 1I9CA 1CRZA 2DR0A 5KSPA 1MW9X 3RIXA 3COJA 3JRNA 1QIMA 3HDVA 5IJXA 4XDZA 3V8VA 3LBHA 1F3LA 1MDFA 3QEMA 1PGQA 2LNDA 1MB0A 1R74A 1X7HA 5EZYB 4LF4B 4JKYA 1UDCA 4QTYA 1PL6A 4UPEA 1OOEA 5ICCA 4NYJQ 4GDMA 2QG9A 3HEAA 4MEAA 5EP2A 2BFPA 1XMVA 1OGIA 4MKZA 3I8XA 3NG1A 2QYSA 5TS3A 4AL4A 4R1NA 4V02A 4HWKA 4R1PA 1VCHA 4R1MA 5CVDA 1NKVA 1Z75A 3EZGA 1BVHA 3OWOA 3O38A 3DOJA 5IBCA 4X1KB 3MMZA 2O1SA 1DFIA 2QTBA 3O03A 1TIBA 4OSPA 4D3XA 1GGKA 3DL0A 1JQ3A 4GEGA 2C9MA 1DOZA 3NP9A 4WN9B 1NXSA 3LECA 1IVYA 4LX0A 3L8CA 3HJRA 2J9XB 3L0YA 3T9AA 3VHRA 4QU9A 2G88A 2OGUA 4M36A 4P3YA 3DLAA 2G9VA 3DCYA 4KK3A 3SQDA 4ZOBA 3U9LA 4MLDA 4YJFB 3SZMA 3VQTA 1SB9A 5IJ0B 1ZM9A 2O0HA 3RIYA 2FWMX 2PU7A 3PXGA 2CGEA 1ZJ4A 2JEOA 3QF4B 4L0QA 1MC5A 4P0QB 4OJNA 1KEKA 5GOTA 1Y5RA 3FTCA 1B6GA 4Q3DA 3WJAA 1MX1A 1ZRSA 4RF4A 5BSRA 2WA1A 1NUQA 3KKQA 1GXSA 1LDBA 4OB6A 4W7HA 1W8IA 2R7NA 1ZVJA 2O8BB 3CJTA 2QZSA 1C8VB 1ZOOA 4IINA 4LSWA 5G3YA 1OAAA 3DO8A 1IZ7A 4H7JA 1OSNA 3FYTA 3UH1A 2C3OA 2IVZA 3K20A 7MDHA 3IP5A 2ZQZA 5JH7A 2IPNA 3PK0A 1Q74A 4BWYA 3HBLA 1ZM4A 5CDGA 3P2OA 1P9NA 1TIPA 2KHZA 5IN5A 1XGKA 1WW2A 2FFRA 2QT9A 4H7EA 3ZXUB 4FYKA 1HZZA 1AGRA 1E3WA 3M8KA 3THWA 2O2YA 1SVMA 2ZYTX 3EVFA 4ZVKA 3OHMA 4EH1A 4V0SA 4ASUD 4G4GA 4OTZA 2V7QD 1M8KA 3Q0IA 1UBSB 1JRLA 1I1OA 5EHNA 1DC8A 3L4BA 3NJ8A 3T4PA 3LX4A 4IOLA 3EE6A 5DNCA 3DAHA 421PA 4CU5A 5KMGB 3F6RA 1JHXA 1TCVA 1Z33A 1E1KA 2QR3A 4ZP1A 2R6GA 2D54A 2OORA 4OA5A 4MRAA 3TW0A 3WDSA 4ARSA 4GI7A 3IKTA 2YJGA 4TZ6A 1ZXXA 4KXNA 1G1AA 2HXSA 4DA0A 1DI0A 1Z8NA 3JQPA 3SIPA 2H11A 1ZH0A 4DCCA 2WG2A 1RBZA 4CFZA 3FFXA 3B48A 2RONA 3M2PA 1J2TA 2G1UA 3A58B 4OYRA 2VIIA 3HEBA 3HXLA 1ZRNA 3FUWA 4UFPA 3IDSA 5LFAA 1DIAA 3EBPA 2CYCA 1C1XA 1KSFX 2VUTA 1KGSA 5J2TA 4FTWA 2WDPA 3FNFA 1A2QA 2A5FA 3HY3A 2MINA 2JLVA 1HETA 2NOAA 2FHSA 1G98A 2IHVA 2CNWD 3KUKA 4AMBA 3IDZA 2PMFA 2QMYA 4LDRA 2WUVA 3OHSX 3NPAA 3UA3A 1BX1A 2O3UA 4AG5A 4AYXA 1SCBA 4ZCMA 1JVSA 4N0PA 4OGGA 1FK8A 3RAFC 4FHEA 3UJ9A 4EI9A 3JQAB 4K9PA 3RFCA 2B61A 3TMKA 3PXEA 1JEJA 4IS2A 4BOYA 4C3VA 4DILA 2AR0A 3JD3A 2BM0A 1HRKA 5DYIA 1XTKA 2CDAA 4KLZA 3U37A 4HB4A 3VYRB 2RBGA 3HR7A 1P4RA 3LHSA 3QF7A 3T7AA 5LDDC 1T8PA 2O9JA 3SDSA 3KV1A 2DAPA 5K0TA 2WABA 4DMLA 5BVGA 4QXQA 5KTMA 1K6XA 1BEZA 2B30A 4ZT7A 3EXHA 2R6FA 1GDDA 2PLWA 2IDZA 1TRHA 4RO0A 3LQKA 2OMEA 2Q6TA 3KZXA 3RRNA 3NX4A 3BWMA 3GVIA 4N7JA 1QF7A 4DGQA 1Z34A 1QDEA 2VF2A 4L74A 1IG3A 4XM0A 3NEAA 1PJ2A 2QAGA 4I3HA 4DJAA 5FA8A 4KAJA 3SGLA 4F3TA 1KYTA 1UOOA 1GLVA 1S0UA 2VK1A 1I10A 1CY6A 3OP4A 1GXSB 2R47A 1O0BA 4JI5B 4D9BA 4PHFA 2G1PA 1YBAA 4DLZA 4O4IA 5C8YF 2AR7A 2Y68A 1HR0B 1DAEA 1DC5A 1ZWKA 1FX0B 4LZAA 3PUYA 2K4MA 5ETJA 3VZCA 621PA 4LG1A 5IDWA 1UMBB 2HY7A 4U9IS 1JHYA 5JECA 2R62A 3NI2A 4QD3A 5ELMA 3P0RA 4D0NA 3PNOA 5ENDA 4EK9A 1QV6A 2VHUA 1IQPA 5FNVB 3L7NA 4KXYA 5HVNA 4HVLA 4MWZA 3DHNA 4WLNA 5G0VA 4EFMA 5CA1F 1XRRA 1N3IA 1Z25A 2YS7A 3D54D 3NASA 4YLGA 5BNTA 1ULAA 4ZK2A 1U90A 1JJVA 1O58A 2KS6A 3RQSA 4EYQA 4KTVE 1OJ7A 3JQ9A 3NANA 4I19A 1T4CB 3A2MA 4KFCA 3NORA 3VX4A 2XDYA 1Z6XA 2V6IA 3C4VA 5GPBA 1SH7A 2E9SA 3FDFA 4OQ4A 1SU4A 4IJQA 2WFAA 4JVSB 4BMSA 1R0KA 5CPBA 3WTBA 1DKMA 1ORWA 2V7UA 3KHTA 1R9MA 3WNCA 3GX1A 1NI4A 1BGXT 4NPCA 1CUZA 1JMKC 2HA5A 2ZSDA 4MRMA 3VZPA 4I7EA 4D8UA 1D9XA 3L79A 1E6KA 5AKYA 4AMGA 2WZBA 4XB2A 2GEBA 1YOVA 5P21A 4AF8A 1GU7A 5LQSA 2JFFA 1P6UA 4C06A 5ISMA 3EBLA 3CONA 3L04A 2XCIA 5E6SB 1RRGA 3AO0B 3UEOA 4A6PA 2NVOA 1I4OA 5DLYA 1C3XA 3GJ4A 1GEEA 4FZ5A 1OXSC 1R4MB 3OOYA 3I9LA 2FWRA 5FL7D 4DSNA 4M87A 3WQBA 5HZKA 1E9CA 1RLMA 1LPOA 4G8DA 3O2QB 2EFDB 2JK1A 2QTVB 3M3HA 3H17A 3QVMA 3I64A 1C4WA 4CRWB 4UHEA 4J76A 2DBQA 2VQ3A 3NHPA 2D62A 3LIIA 3ZW7A 3DOUA 5EKDA 4ZEMA 4GO1A 5DIFA 5AHWA 4BLWA 3WRVA 1JG7A 1X8LA 5K2MA 3WB0A 1X9IA 1OIXA 2B82A 4MI3A 4QGFA 1NRIA 1YQWA 1D7OA 2VQDA 2NN3C 1ZD2P 3SXJA 5GIOE 3ZDFA 4LE1A 5KJEA 4CF6A 3BTVA 4G8CA 4ZIRB 5IJWA 1TT5B 1FU4A 3TECE 1B0PA 4LTDA 5BRAA 2JLAA 3VR6D 3HYNA 3DTTA 1LW7A 2OAEA 5IPFA 2ZLBA 1PN3A 1NN3A 4C6TA 5B3LA 3GBPA 2X8WA 2BGNA 3VISA 5LDHA 4IF4A 1MKYA 4H0NA 1JLLA 1LBEA 3KM0A 3STVA 3UF0A 4ZI7A 1C8KA 2BDUA 2DFDA 1QO7A 3QG1A 2O1XA 2QN9A 4MPJA 2QK4A 4HT3B 4PAMA 2JLXA 1AS0A 3EA5A 3PXUA 1GT91 1AHIA 1M2HA 2P7IA 2TSYB 2OAQ1 4NZNA 4S1WA 3M34A 3RBXA 1AX9A 5C1PA 3ID6C 4G9GA 4FW8A 3L7OA 1EP9A 3AEKA 4U02A 3LBNA 4URZR 3PHJA 4QYMA 3T95A 3KKOA 3RVNA 2I6TA 2I2CA 2X0KA 2VJOA 1JMVA 2IOHA 3GAZA 3GRUA 3HYCA 1TUEA 3M49A 1WSWA 1XA3A 4KKVA 2ORED 2RKBA 1EDOA 2B8JA 3QUTA 4LRSB 3TQIA 3PF8A 2FQ1A 4G86A 3LW8A 1RI2A 5JY1A 4LMBA 1LCIA 2BP7B 3QLJA 4RTMA 3AILA 3R5SA 4H3SA 2O2GA 2WAOA 4RGQA 2HQBA 1QRUA 5C1BA 1ZH8A 1PI3A 2PPLA 1U98A 2QYOA 3NAGA 2R8YA 2LIPA 4PY2A 2CCGA 4RTQA 1K86A 2F3UA 2VPIA 1YMUA 1RPAA 4CM7A 1OX5A 3ZDBA 5HCIA 2OHXA 4P98A 3F5QA 2QVGA 1JX6A 1K89A 3LCUA 3KSDO 1MIHA 2FEWB 4FDMA 3W4IA 2A88A 3I0NA 2E4AA 4A0QA 1H3NA 2BJVA 3ZE0B 3R4CA 4IWYA 4F5ZA 1IK4A 5IAGA 1E6CA 1KQ3A 2O8VA 1L7RA 4R51A 1WMAA 4W1QA 4CT0A 3AR7A 1C81A 1UBRS 5FPPA 2OWD