2E4YA

Crystal structure of the extracellular region of the group ii metabotropic glutamate receptor complexed with 2r,4r-apdc
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
538
structure length
518
Chain Sequence
RREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAANRVNASFTWVASDGWGAQESIVKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLQNKRNHRQVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPQTTKLCDAMKILDGKKLYKEYLLKIQFTAPFNPNKGADSIVKFDTFGDGMGRYNVFNLQQTGGKYSYLKVGHWAETLSLDVDSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFTCMDCGPGQWPTADLSGCYNLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metabotropic glutamate receptor 3
publication title Structures of the extracellular regions of the group II/III metabotropic glutamate receptors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 147
structure length 518
sequence length 538
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
A PF07562 NCD3G Nine Cysteines Domain of family 3 GPCR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.30 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A; domain 2 2e4yA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4yA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2e4yA01
5TQ2B 3HEBA 4N47A 4DQDA 3SNKA 4GPAA 4GNRA 4MYRA 2PUDA 1DRKA 1CYEA 3OO1A 4IILA 3LUKA 5B3JC 4EY3A 4Z4HA 5HKOA 1LJUA 2M98A 4F8JA 3NNDA 4IMJB 1NXTA 1DC8A 5KQLA 4G0MA 1U04A 4W5TA 2Q5CA 4QYWA 3HUTA 3BRQA 1SXGA 3OQMA 1OXKB 2TMYA 3N0XA 4ZPJA 3KS9A 3M6MD 3D8UA 4F11A 4KZKA 4TLLB 2FEWB 3QLTA 3RVSA 1JYFA 2MYNA 3D02A 3Q15C 2R25B 1A2OA 1Z25A 2PKXA 4QYMA 1RZRD 3Q7TA 1LJLA 2I6FA 2LBPA 3HZHA 3KHTA 3CG4A 3RQIA 3T6KA 3O1IC 4G0QA 4WZZA 2L2QA 4JAVC 4XXHA 1U2PA 2V0NA 3EJWA 3QLUA 5JNUA 1GLGA 5JNRA 3K4HA 2DRIA 5IUNC 3BRSA 3O74A 3OLXA 1JFSA 3OLVA 4WXEA 4MQEA 3H1FA 3F73A 1E6KA 2RJOA 2FN9A 3CU5A 4YWHA 1RNLA 4Q7EA 3LUDA 4KK3A 4D74A 3H5TA 2ZWMA 4KNYA 1D1QA 3MM4A 3LMKA 1JL3A 4G97A 4O1HA 3TX6A 1A04A 1FSPA 4HNQA 5FBKA 3HS3A 4P98A 1TMYA 1DP4A 2HQRA 4MR8A 5KQMA 3MIZA 4PEVA 2NZUG 4F12A 2F8TA 2FMHA 2X7XA 4MS1B 1C0EA 2F8SA 1QNLA 1AB6A 3EDCA 3JVIA 4RS3A 4Y9TA 5CNKA 1EWVA 4ML3A 4RU1A 2JBAA 3N0WA 1F4VA 1PNTA 1JF8A 3N6VA 4Q6BA 1K68A 3QEKA 1NXOA 2FXIA 1JYEA 3QELB 2JB9A 2IYNA 4MLCA 5DKFA 2NT3A 3L6UA 4RK4A 4LE1A 1DBWA 1E6MA 4L4UA 4OG2A 4Z9AA 4N76A 2IPMA 1DC7A 4F06A 3LKVA 1T34A 2GBPA 2QR3A 4G0YA 3JS5A 1JH9A 2MSLA 3LUJA 1PEAA 4ETMA 1M2FA 5T7BA 1TVMA 3Q7RA 4RXMA 1ZESA 1BVHA 3H5OA 3NHZA 5KWSA 3LUCA 1JDNA 4Z0NA 1I3CA 2GX6A 3VNBA 5I4CA 4YP9A 4NV3A 1CEYA 5IX8A 1VLZA 3MMNA 1ISSA 1EAYA 1P8AA 1Z16A 3HO1A 4UHKA 4RK1A 4Z4GA 3RVQA 1MAVA 3DZDA 2H0AA 3C3KA 2JRLA 1D1PA 2WWVD 4XARA 1SXIA 2RGYA 3H6GA 4ZMRA 1NXSA 3BBLA 2VUIB 1PUXA 3C97A 3H75A 1U8TA 1ZH2A 2OQRA 3P9YA 4MS1A 2PL1A 2JVJA 2FQXA 1JDPA 9ABPA 1M2EA 3N75A 1LBHA 4HNSA 1Z26A 3GYBA 3DLHA 1NXPA 1C4WA 2WMYA 4KV7A 1SD5A 1QP7A 1ZH4A 2PLNA 3JPYA 2A9QA 4EVQA 5IULC 4JASB 4RXUA 5TPZA 2RJNA 1NTRA 1K66A 1YK1A 5CNMA 4JP1A 3OM1A 4RZSA 1Z18A 2NUBA 1DZ3A 3BILA 3C6QA 4RDCA 4JB2A 2J48A 1APBA 1KRXA 3RVMA 2E4UA 1JBEA 1JLKA 3E61A 5IEBA 1WETA 3F6PA 4P1ZA 4KREA 3LUHA 3T8YA 4N0QA 3O21A 3GL9A 3IP5A 1HEYA 3OM0A 3LUGA 5BRAA 2QU7A 1D2AA 1D5WA 3IP9A 5T3YA 1DRJA 3ILHA 3KTOA 4EYKA 1JX6A 5D2CA 1QQAA 2FLWA 1USGA 3HSYA 3I45A 4LX8A 4ZMSA 3HXMA 4RKRA 3HUUA 2FMKA 1YMUA 2O20A 1L5ZA 4JA2A 1B00A 1EFAA 3QELA 1PEYA 3GRCA 2FQYA 3K9CA 5TQ0B 2AYXA 2QXYA 4MPTA 1RXIA 3H5VA 4RXTA 4EGSA 1Z15A 1S8NA 4E7PA 4FB4A 5BQ3A 4OLBA 3O1HB 4G0ZA 3MQ4A 2PUEA 3ROFA 5FWYA 1ZGZA 1TLFA 1ZITA 4FE7A 3GBPA 3UUGA 3CG0A 2JK1A 3GA5A 2PMCA 3I42A 4MR7B 4XFKA 3OQNA 3GT7A 3SAJA 4B09A 4WUTA 3OMXA 7ABPA 2FN8A 3EQ2A 2NT4A 3IDOA 4NCBA 4FE4A 2JVIA 1QO0A 4MR7A 3JVDA 4OBBA 1DBQA 3H5IA 2FTKE 3RVNA 3H1GA 3SY8A 1Z17A 4KVFA 3HDGA 1W9HA 1M5UA 5EWMB 5C5CA 4IMIB 3ROTA 5TPZD 3CLKA 1RZRA 1NXVA 5TE9A 2RDMA 3EQZA 4TMYA 3CZ5A 3M9XA 1ZDMA 3NHMA 3O2QB 3EAFA 4N03A 4DADA 4F3TA 3JPWA 4MR8B 5BR1A 3FFXA 1E2BA 5JNVA 2L19A 5EWLA 5EWMA 1BA2A 3I09A 1YK0A 3IPAA 3A3KA 2YHAA 1QMPA 1ISRA 1BDIA 5JS2A 1JWLA 5TPWA 4S04A 3LOPA 3W9SA 3HM9A 2M1ZA 3N0RA 4YO7A 1VRVA 4IRXA 2WY2D 2IPLA 3RVLA 2IOYA 4JOQA 4OATA 3UK0A 4Z4EA 2MSWA 1DBPA 3SG0A 1EHCA 4UHJA 1JFVA 2MYPA 3SQNA 1YVUA 2LPMA 2PUBA 3KG2A 4RY0A 4RSMA 1DCMA 1GUDA 1USIA 4MR9B 4KK4A 5KI6A 2QV0A 3QX8A 2W42A 4TN5A 5HM6A 3B2NA 1R8JA 1Z2DA 4XAQA 5JS1A 1Y1LA 2WRZA 4EYGA 1GCAA 2QZJA 5TQJA 4Z4FA 4MRMA 3CTPA 3HV2A 1QP0A 4YGXB 2KYRA 3Q41A 4MAAA 2CWDA 2N9UA 3MYYA 3GV0A 3FGZA 2HPHA 2PAFA 4MS3B 1CHNA 1PHRA 1SRRA 4HYEA 4OTZA 3RVRA 3HJFA 4RWEA 5IUKC 8ABPA 3IPCA 3IP7A 3CHYA 4O1IA 1YMVA 1P2FA 2A9RA 2E4VA 3DBIA 3OLWA 1TJYA 4WT7A 2PUCA 1YTUA 4KPYA 3A0RB 3T95A 2CHFA 5IC5A 2GKGA 2GWRA 3TB6A 4MS3A 5JNWA 3DLBA 1DCKA 4EVRA 1ZN2A 2IPNA 3NNNA 2PE5A 5CNIA 3H6HA 4EYQA 2QVCA 3O1JC 5E3JA 4MQEB 4MS4A 2R48A 4D6XA 4YV7A 3L49A 1A0OA 4G0OA 4RV5A 1XHFA 3CZCA 4CBVA 2PJUA 4D6YA 1QQBA 1NY5A 4DN6A 5ED4A 3N8IA 1QPZA 3RVOA 2FMIA 3H5LA 2IDMA 1YIOA 4JB0A 5FBHA 3CFYA 4YCSA 5DGCA 5FWXA 1LK0A 1GUBA 1USKA 3CS3A 4ZJPA 2QVGA 4PICA 3FMVA 3F7NA 3G85A 3HDVA 4KRFA 3LTEA 1UDRA 4YR7A 1DJMA 4L85A 4NQRA 4ETNA 5HQJA 1XHEA 3N53A 3OLYA 4LDZA 2FVYA 5DLEA 4Z99A 1Z13A 4MRMB 2QSJA 1P6QA 5GOTA 4Z4CA 5JNSA 1ABFA 1URPA 3FDFA 1W25A 1KMIY 3I5AA 3MF4A 3ILYA 1MB0A 2H3HA 2NZVG 1KGSA 3EODA 1MVOA 4OLAA 4MQFA 2MYUA 3CKMA 2MSKA 4MR9A 2CD7A 4TLMB 4NICA 5KQGA 3H5WA 2E4YA 3DGFC 4W5RA 4W5NA 1D4ZA 2LIVA 1ZVVA 2JVKA 4Q6WA 3O75A 3TD9A 3OMWA 1GCGA 3LFTA 4WXMA 5F64A 2WJAA 2E4XA 3SM9A 1ZAYA 4PE5B 4N0PA 4LDAA 3IP6A 2VUHB 4YRZA 3NBMA 2QW1A 3CRNA 4QPJC 2E4WA 1SXHA 5EWJB 4N41A 1QP4A 2FEPA 5IUJC 1BDHA 5ABPA 1XWWA 6CHYA 3KCNA 1OXBB 5EWLB 3R0JA 3LKBA 4W5OA 3TO5A 3KSMA 3RVPA 3VNAA 1JFTA 1FFSA 2L17A 1FQWA 4MGEA 2R47A 4G0PA 1RXEA 4H60A 1ZGGA 3M9WA 1IIBA 1L5YA 2OENG 5CNJA 1Z2EA 3URMA 2HSGA 1E6LA 4EYOA 4ETIA 4RKQA 3H1EA 4Z4IA 2MYTA 3LUFA 2AYZA 2B4AA 4MLDA 4G0XA 4YLEA 4LE2A 1AB5A 1M5TA 1U2QA 2HQOA 3CNBA 4H3KB 4LRQA 3GBVA 3JY6A 3QEMB 1U0SY 4KQCA 2FEKA 2P9HA 1NXWA 3Q9SA 4LZLA 4MQFB 4ZYLA 4W5QA 1EWKA 4RK5A 3C3WA 5KQPA 1ZHHA 2VK2A 2FKAA 3KYIB 3OQOA 1VPWA 3RH0A 1YS6A 1DG9A 3KKEA 3S99A 4E7OA 1PNRA 3OLZA 4M88A 2A9PA 5B3JA 4RK7A 2PUFA 1NXXA 4KMRA 3KLNA 4YS6A 5DCLA 2WJWA 4QICA 1MIHA 1ABEA 2L18A 1QKKA 4EVSA 1P6UA 3E3MA 5FWXB 1QO0D 2FLKA 2LUOA 1DCFA 4LE0A 3UKJA 5TQ0A 4XLTA 4EUKA 3G1WA 5EWJA 1BAPA 2FSPA 4RY8A 2R4QA 5CHYA 2ID7A 2HQBA 2LP4Y 3KYJB 4G86A 4Z9BA 3T38A 2FQWA 2IPAB 2B1JA 4IF4A 1VKRA 5TQ2A 1MB3A 3QLVC 4IGAA 2IKSA 5KC8A 4RY9A 4RK6A 2XDYA 1YS7A 3BREA 4MS4B 3MA0A 2FW0A 4O5AA 3QK7A 3O2SB 3GWGA 4KFCA 1TM2A 2GI4A 2ID9A 3NNSA 2YHBA 2CHEA 3KLOA 2PUGA 4KQ9A 5JNTA 3QX9A 2A9OA 5GQSA 1NATA 4NCAA 4S05A 1Z12A 1BDJA 2PUAA 4H3HB 3JTEA 3HVRA 1H9CA 5C5EA 2JCGA 3C3MA 3QEMA 5DTEA 2PL9A 4PYRA 3EGCA 3O2JA 3TMYA 2E4ZA 3FFWA 3F6CA 1KRWA 2HJ9A 3FFTA 5BRJA 1LBIA 6ABPA 5IBQA 3HCWA 2BGGA 2P4UA 3HK2A 1J56A 4RK0A 1FFGA 4WWHA 1RPJA 3LUAA 3OO0A 1FFWA 3QLVA 2WB4A 3Q7SA 3DGEC 5HSGA 5IEJA 1JHZA 5KC9A 5TPWB 5PNTA 1EWTA 3A10A 3QLUC 4HNRA 5FWYB 3A0UA 2VYCA 2JBAB 4PZ0A 4XASA 3RVJA 3RVKA 3KJXA 3EULA 1ZY2A 2FMFA 1F51E 2ZAYA
chains in the Genus database with same CATH superfamily
5BSFA 4K6FA 3F90A 1TYCA 3ZCRA 3ME2R 1OI4A 1ZRHA 4C03A 5DHRA 1ZK3A 2ZRBA 4QULA 3D43A 4W7IA 3H1TA 4HAVA 4JC5A 3L2OB 1I1HA 4D0RA 3OO1A 1PQPA 5CT9A 1W19A 3EY9A 4WY2A 1CUUA 3HJUA 4I50F 1X14A 3DMNA 1ZOIA 4PC1A 4K05A 5CT6A 3UGTA 3NVAA 1LFDB 3OESA 1Z5VA 3PPWA 4GMHA 2QL9A 1IY1A 4HJRA 1UJ2A 4B2PA 1M2OB 3H7IA 3IIJA 1UBOS 1H9AA 2CF5A 2QVYX 3LQKA 4MJ3A 4OGKA 4QXOA 2OXFA 2PZMA 5HIJA 2GF9A 1ESMA 1W6RA 2R6FA 4IMPA 3C7AA 3D2CA 3H0KA 2B92A 3DVLA 3OFKA 4E1AA 2FOXA 4MPJA 3T1TA 3OURA 2E0IA 2EWWA 3OQHA 1BQ4A 4X1KB 4I1SA 1QIKA 4G3XA 1GN8A 1W96A 2ECFA 5CDFE 3QMPA 1LPBB 1KE2A 1JLHA 3Q15C 5DWQA 4QM6A 3ANLA 2NP6A 2P30A 3LFHA 3JALB 4CKBB 4RHFA 1A95A 1Z34A 3Q7TA 3IJEB 3GIDA 1WSAA 4P2GA 5CVJA 1NHWA 4RSHA 4NBKA 1MT3A 1K7SN 5CIWA 4TXHA 4LOIA 2BEVB 4NJEA 1CY1A 3AR6A 3MWEB 3C1AA 2FETA 5K1ZA 1EKXA 1XP8A 3M5CA 4G5XA 3K4HA 4HUQA 3JQ9A 3I8OA 3OLXA 1G8FA 2F59A 2HHCA 2P0EA 2WYVA 1EK2A 2ZTSA 4V3CA 4A82A 1B23P 1E2GA 2HL6A 2C31A 5GONB 1F14A 1UBTS 4UNQA 4M53A 1U3TA 3SLGA 3IURA 1RMTA 3QVXA 4IJVA 3L41A 3N7TA 1AURA 5J9FA 3SHTA 5BN5A 1CP2A 3CN9A 3BORA 1N5IA 3Q3JB 1I10A 3BIWA 4FLFA 3TF5A 5CAEA 4DPKA 3IPLA 3ZHCA 4NMMA 2X2FA 1KE1A 1M8JA 4RNCA 2X15A 1G63A 5IJ0B 4CG1A 4U8HA 2FRXA 5CNKA 3G0BA 2X5NA 1YV9A 1LFAA 2C96A 4RU1A 3F6RA 1E7WA 4KIGA 5ILGA 3SU8A 1SIWA 3Q8KA 1TA0A 4R1UA 4OHVA 1C30A 4C9BA 4ZHQF 1YB7A 5BWMA 3DJYA 3KDAA 2O7VA 1W4CA 2JHPA 3NWJA 5JYDA 1H8EA 1V8DA 2EXXA 2ZFUA 1JKFA 4YJ2B 4IDEA 3U5TA 1YASA 2OHFA 1DDGA 2BZSA 3TL3A 1QWOA 3N74A 3KSDO 3ZZ0A 4RCVA 2UZ4A 2Q5HA 5BW4A 3ZIAD 3UA4A 1C9MA 3SJAA 2VYNA 3OQPA 3U1VA 4EI8A 1DOZA 5JAUA 1IXKA 3ICPA 3P32A 2XUIA 2EQAA 3JX9A 2QEQA 1XKLA 1TOAA 1FMLA 1KO8A 2ACWA 4GSLA 3L1UA 1N25A 3I5XA 3DZBA 3H5OA 4MQLA 3L3BA 1DELA 1VGQA 3LUCA 1I3CA 3QBTA 4EG3A 2EP7A 5KQRA 3AQIA 2ZJ8A 1QGAA 3QVTA 4CKCB 3DR5A 5A4IS 3HLTA 2GN6A 3FY4A 2YHIA 1T3LA 3RBAA 4ZTBA 4IR7A 4FYIA 1W85A 4QFDA 3KZ1E 1W5EA 4HLUA 5B1YA 3AERB 3K92A 2VJKA 2JRLA 5EL0A 1FXUA 3MGAA 4YUVA 1I2ZA 2WWYA 1TEZA 1R15A 1Z68A 2J3EA 3DZJA 2YMQA 2Z5LA 3G0CA 3RGWS 5CPBA 1BXGB 2VUIB 1IXZA 1N6LA 2NO4A 1OIWA 2PL1A 1XYYA 4FVTA 4BAZA 3AIIA 1WM1A 2WVGA 1DKOA 2VNJA 1GU0A 3SYRA 1NLFA 3H9GA 1JPNA 3IBYA 2QD1A 4JENA 4RIIA 4Y98A 1ZZEA 1AKQA 2F1HA 2R3SA 3WNCA 3PFNA 5A9SA 1X3SA 4IIFA 4NBWA 1I7NA 1X39A 2DYKA 2ZT5A 1G42A 4JNKA 5C31A 1GTRA 3DLHA 1BXRA 1JU9A 2HMSA 2X42A 3LQRA 3JPYA 1IPFA 1ONBA 4M6WA 5KNBH 1N9KA 2WKWA 4KEAA 4Z6KA 1NTRA 1YK1A 5AJHA 3EGOA 4AT1A 2IJGX 2N3ZA 2PQ0A 1QLHA 3B70A 1DZ3A 4B82A 3A70A 4DYVA 4EG7A 3CEHA 1KP9A 2OBBA 3KXKA 4MUIA 3WIVA 1I1OA 3T3HA 4LHWA 1PD1A 5SYAA 5TNXA 1NVBA 1HDCA 3OQIA 3GNQA 2PFSA 3JSXA 1TF2A 2FFBA 2O2EA 3QOXA 1TVCA 5A7HA 5I4BA 1J2JA 3IEMA 1C5KA 1XXHE 2QE7A 3WKCA 1QQAA 2P9FA 1E89A 1KS9A 1MA0A 2ZKIA 3C6YA 3DBRA 4H7JA 1V9LA 1BCRB 3M6WA 3G5LA 4LX8A 4XUDA 2RK6A 3TW6A 4C7OB 1M2NA 1XMJA 2EBUA 5HW0A 4CLHA 1G1MA 4QUJA 4WLOA 4B1FA 4UULA 2RGDA 4ON9A 4MIYA 1KVQA 1LDEA 3H3JA 3D4LA 1E4YA 1E18A 3DPIA 2VG8A 4UMVA 4OLBA 3M4JA 1E20A 3L7NA 4F9EA 1TM1E 1O97C 2W6JD 5FD8A 3DVQX 2MT9A 4DJDC 4FCTA 3PQFA 1JZSA 1XQ1A 3E53A 4MX8A 5IVDA 4BCBA 4EDFA 3PEYA 2DLNA 1CIJA 1CZOA 2GRAA 4P2BA 4AF7A 1XD2B 2AOTA 4WLVA 2JGMA 1GG5A 4C2UA 1IY2A 1OASA 4XUGB 4ANFA 1JILA 3EGIA 1GTSA 3VGJA 3OQBA 4AF6A 4WUTA 2QE7D 2W22A 4NATA 2R7NA 2J3KA 1EX7A 4ND8A 4X20A 4ZRDA 4Z1MA 3VDNB 4GOXA 7ABPA 4DQ0A 1A76A 1HE2A 5EPEA 2DPLA 4EB3A 1N9GA 3K0EA 2H4WA 4MGIR 1GDHA 4QGGA 1R37A 1RHJA 2LXNA 2ZRGA 4RLHA 4Y0NA 4DPLA 2CBXA 1XMQB 4FZJA 2ANBA 3TL2A 2X9QA 4AX8A 1A5TA 3H1BA 5I8ZA 4WNCA 4JLUA 5EWMB 3AVTA 2YH2A 3MTQA 4HADA 1S3GA 4P58A 3EDYA 2ENWA 2V6IA 3L40A 3PFKA 2VJAA 5HE9A 2WIJA 4LXYA 2CY0A 1AU9A 2ZBUA 3ZY4A 2VTBB 4HQ6A 1E1CB 1AQUA 4BUCA 1QIDA 3DWFA 4PANA 5GGYA 4O33A 1AD2A 1XQ6A 2D1QA 4MVWA 3DFMA 4KMSA 4F3TA 2ORIA 5LU9A 3KZXA 3B3GA 2C20A 1M6WA 1N3LA 2EHDA 2YW2A 4DANA 5B5SA 1F20A 4GGMX 3FTNA 4NCKA 4YCCA 1E64A 2QN6A 3NHYA 2H5JA 4BAUA 3PVSA 3ONWA 1X86B 3LOPA 4MI1A 3R7LA 2W6OA 4F2HA 3CCBA 3D0KA 4PYKA 1KK1A 4XTRA 1ORDA 4H4DA 3K71B 4ZO4A 1L7NA 4X97A 4IRXA 4BATA 1M2KA 3OZVA 4Q24A 2BT4A 2HDHA 2YHIB 2CHUA 2C57A 2O0HA 2QT0A 2IXGA 4Q4DA 1J42A 2Q1XA 1R0KA 1W75A 1GP2A 2JAOA 3FLMA 1HYHA 1TCUA 4EB6A 3RHFA 3BGSA 2BMEA 3SIXA 3HY6A 1ODSA 4KFUA 2QR5A 3GH3A 1DCMA 3THMF 4KN6A 4X3PA 2W2OA 2IS4A 4N7RA 4Y2RA 1DBRA 1N6NA 5E2AA 5KI6A 4BN5A 5AKJA 4OY3A 2SICE 3P2JA 4ZARA 5AW9A 2CMGA 5TGTA 2A0WA 1NJFA 1NNUA 2E1PA 3PA8A 4R9UC 4AC9A 2FPPA 4R71A 3MLAA 1OV4A 1F2TB 4HPJB 4PLTA 5JBQA 4X63A 2VHTA 3FUWA 3OKAA 4G2TA 2IVZA 2OXEA 1J2RA 3TZLA 5CJ2A 2FKNA 5E4YA 1YJ5A 3CF4G 2WDZA 3HM2A 3Q88A 4LG1A 4I99A 1BXRB 4LJAA 2QG9A 2Z6AA 1X2EA 4LUCA 2EFHB 4LZJA 1GL7A 4WNAA 4B4DA 3FGZA 3THXB 1SRRA 1LWOA 4M89A 4MWDA 4QUEA 3R3ZA 4KGDA 2BFFA 3EGDB 2NXEA 1M33A 1HY3A 4JJIA 4TQ9A 4DQKA 4E5PA 1WWKA 3A4LA 3CN7A 3T5DA 4CM4B 3CMCO 5IMBA 4HWRA 1P18A 1JHAA 1SBCA 4L22A 4W63A 4EH1A 2GCGA 4EPRA 3WLQA 1P73A 1XQ9A 3LF1A 1BHJA 1EG7A 2X1MA 3HYSA 4IINA 4R1PA 4YJDA 4BNWA 5CEFA 5JQWA 1XLUA 2C7RA 2XB2A 5DULA 2C83A 3WLAA 1QH9A 2FJ0A 2DLDA 3PDIA 4MVJE 4NS4A 3UHJA 5J4VA 4Q4HA 1H3EA 1DJMA 3USES 4I9HA 5K0ZA 1NONA 1OV6A 3FH0A 3NM5A 4MGKR 1NFFA 1ZIXA 1CJUC 4X41A 1HE8B 4X8LA 3JASB 3RKRA 1K7EB 1P44A 2ANCA 3TJZA 4AJIA 1V3TA 4EGCB 4HLDA 2GVDC 5CCDA 1F9EA 1GT6A 3OJCA 1J0AA 1HMYA 4BMYA 2RGUA 3IE0A 1LI4A 4XFJA 2O8FA 4L6AA 1DOHA 2CDRA 4PSKA 5A7FA 1N5OX 3AB7A 4FQ7A 1MQSA 2Q5IA 4ZVOA 5JBIA 2UXDB 4ZEWA 3RS5A 5JJCA 4NECA 2B5OA 1JDVA 4OJMX 5AKLA 4B7CA 4E46A 3DTVA 3UC9A 3ZLBA 1LTHR 2R84A 4AY5A 1N2BA 5F5LA 1YB2A 3HXOA 3B1KA 5BN3B 1N77A 4GKKB 4WCFA 5GV8A 3ZLTA 1MB0A 2Z1NA 4DYDA 1PCXA 1TMOA 1H05A 1R4AA 3E1KA 4GMFA 2BMWA 2DX7A 2G7MC 4EUHA 1FNCA 1TLLA 4P0QB 3UUFA 3A4YA 5IF3A 1H4QA 4ZK6A 5E0OA 5DXAA 1NP7A 3BJEA 3VTFA 2R00A 4XYMA 1TTTA 2PS3A 4NMLA 1BMTA 4CJXA 2VHZA 2HTEA 1MB4A 2E5LB 2RKBA 1YA8A 5CCBA 1GRVA 2VXOA 2PBFA 3SMQA 3LQ4A 2JVKA 1LLCA 1U0FA 1Y1RA 3O75A 4QOGA 1B1CA 3OMWA 5HKKD 5C9ZA 3ZWYA 4CMKA 3MTJA 4P86A 4E2YA 3EW9A 2G76A 3OIUA 3LPNA 4NDNE 4NSNA 3UJ9A 3FZEA 3LPLA 3K0HA 1ZCAA 4AKSA 5JXGA 4BKUA 2FVXA 5C8XA 1A9YA 3CPJB 5DYYA 4KR9A 1G5HA 5EWLB 4DV5B 3H7AA 3HB9A 3UJAA 1Z5OA 1X7YA 4CLRB 5C80A 4QXAA 1FFSA 2QW0X 4BMSA 2R47A 3AJ9A 3JQBA 3DE2X 3OY2A 3M9WA 3R7SA 1RRKA 4TLEA 5EG5A 4CCSA 4M0LA 2ROQA 4YV1A 4GPD1 3VUEA 2O1SA 4FDVA 4BFUA 5IH7A 3AI7A 2XF2A 2HMAA 4QL3A 4X85A 3QW2A 4Y2HA 4XI9A 3WC4A 3KPWA 4K6CA 4B81A 5K8CA 1QYIA 5B57C 1JEYB 5E1OA 2UVQA 4MNTA 4L16A 4LRTB 4MLDA 4MP6A 1C80A 2OV2A 4XH9B 5FI3A 1B15A 2XMGA 3JY6A 3OHSX 2GZ1A 2FEKA 2VSYA 3QBEA 4GVPA 4E32A 2PXCA 3CM0A 3O8OA 2IZ1A 3CZ4A 3QG5A 2FKAA 3ET5A 4G09A 4X7BA 3H3FA 1IHDA 1YE3A 2ZUWA 3NW9A 3WHKA 1SCUA 2P9TA 3ISJA 3HWRA 3S99A 4OO3A 5GP1A 1QM5A 3KXPA 2IH4A 4D97A 2REQB 2PRZA 4YS6A 2CW5A 2H4FA 5CEJA 1GAEO 5FKJA 4B8ZA 3F96A 5A2GA 3PDUA 1F0KA 4TRRA 4UM9D 2A0UA 2QX4A 4ZGBA 5A3JA 1E3MA 2UZ1B 1G1AA 1O58A 1W46A 5AH0A 3O3NB 1L5KA 3FNIA 2I8LA 3MGGA 1RABA 1PKEA 1QRRA 3MAAC 1BAPA 1JG6A 5JHGB 2YZ2A 2WAOA 3BMQA 3ZPXA 3GLFA 3CVUA 2XUQA 1Z8DA 2FQWA 3CONA 4F3RA 5B2FA 2IX3A 1E9FA 1X7XB 2JIRA 5HJ2A 1IB6A 3P20A 4ZAFA 5CA1F 1JG3A 1EHYA 2AJDA 1EYZA 2IHUA 4P8RA 1SWVA 3OEED 2ZUDA 4R5MA 5I45A 4R1TA 1TM7E 2QRKA 1PHPA 1CY7A 2JGEA 1KEEB 3I9LA 4UASA 4XCVA 3K51B 4ALIA 4E5YA 3AUYA 3O2SB 2G0AA 4M1KA 2XQFA 4O2AF 5DSZA 2CVFA 3NBFA 5G1PA 5J2UA 3THWB 1OFTA 3NBYC 1IN1A 1GLVA 4RTPA 3A6HA 1Q3TA 3FCCA 3GLKA 3DDNA 3NHRA 4LV6A 4GU5A 4G56A 4UUQA 5EHGA 2PWZA 1VI2A 2B7BA 2QN9A 5AXDA 2IYYA 3RVBA 7GPBA 1N6HA 3OPYA 1SKYB 4GYYA 3U19A 4UTNA 4AJNA 3LDFA 3HACA 1M0SA 1JT9A 2JCGA 1FNDA 4IUYA 5CP8A 2EVWX 1SVWA 1NBEA 4UAUA 1VBFA 1TRKA 3MS7A 3I8XA 4BZXA 2AEFA 3N2KB 4K9RA 4JUFA 4RLFA 5EPUA 1HSZA 3IRUA 4NFLA 4Z3KA 3NWOA 3GLHE 4QLAA 1IM2A 3ZCQA 2YRWA 3CGGA 6ABPA 3HK2A 2A35A 4C0SA 1NYRA 4RK0A 5HBGA 1E5DA 2AGVA 1JHPA 1ZA3R 4LWZA 4FQ8A 1L6RA 1IPHA 1ESNA 1BSVA 1C3VA 3G0GA 3N2LA 4PG4A 1YKFA 2XPCA 4HLUC 4L27A 1DUVG 4JOSA 4GM0A 3AEKA 4LYEA 5TPWB 2ZQZA 1LPMA 3SSMA 5KYYA 5EIHA 3T7AA 4KQJA 1W88B 4IDOA 3HO6A 1RR6A 5KO2A 1RU3A 3CB2A 2EZ8A 3M33A 4RYLA 3I1FA 4N47A 4U7DA 1CUDA 2FA9A 2HWYA 4H1WA 4MYRA 2QAIA 3BJIC 2Y99A 2ZDHA 4TN1A 3VR4A 1MAUA 2ZUUA 3L77A 1W52X 1I2BA 3PFFA 2QRVB 5DHQA 3REGA 3NNDA 3FNBA 5DHUA 3WL8A 3N7UA 5FH9A 3KJGA 4YJ3F 1RZVA 1XZLA 2GJ9A 4NMWA 2YZKA 4J75A 1HORA 4BVKA 4EATA 5KJ6A 1OIXA 3BIXA 2O7SA 1KI9A 4OQYA 5BSUA 3JRWA 1PSDA 1A9XA 3GAFA 4AS2A 3DP9A 3KS9A 2HZ7A 1XRJA 5M3BA 3T5BA 1Q0SA 3ZUGA 1V11B 5FPTA 2I6QA 3TZHA 4HBZA 2CYBA 2VBCA 4QOJA 4Y3UA 4D0GA 4EOGA 3WRYC 4X62B 3PFIA 1JFRA 1U5BA 1W73A 1XQVA 2O7RA 4OA8A 2FPGA 4X00A 3T0IA 3IKLA 3TAXA 3U61B 3NC1C 3G13A 1RZRD 2BSQA 3F3KA 4ROTA 1JTFA 4JI3B 1HK7A 1POWA 1YL7A 1X13A 1KNQA 3TR5A 1YIDA 5FPPA 3DEZA 5EUCA 3IAFA 4QQKA 4OH1A 1UIMA 2F67A 1FX1A 4EHDA 4DA9A 4ZT3A 2I6GA 5E6SB 3RJ5A 4BVHA 3D7MA 2DULA 4ZK2A 2VTDA 5HBRA 2ZJ1A 4Q3LA 3DQZA 3CU5A 2O2HA 3X1XA 1MJ5A 3HJAA 1P60A 3I23A 3CLTC 4PZPA 4Y67A 2ODWA 4AKHA 1TLTA 5H83A 3IQIX 1MT0A 2E18A 2P6MA 3CX7A 4IJQA 5EKUA 4L8FA 1L5GB 1WNFA 3IEPA 5CB6A 4ZJYA 3N76A 3ZHVA 5M2QA 3GLFE 3SYLA 3BWVA 3LP5A 4K87A 2YNMA 2FWJA 1J07A 1JEAA 1S01A 3MJTA 2NZUG 4M99A 2IYTA 2WKQA 3AUUA 4OV6B 4L4RA 3TQIA 4I0WB 4AMBA 3T5TA 1NJ2A 2EW2A 4MW6A 3KOZA 2XGOA 5JPIA 2WOOA 4DLWA 1M6VB 1RYMA 1P4JA 2VZEA 2XCLA 2ZIAA 3CVXA 3B3AA 4FCCA 4L0MA 4A2WA 3ZW8A 1CJMA 4B75A 3OOEA 3HA3A 4JKIA 4KGVA 4ARCA 4EQ6B 3I4CA 2Z2XA 2F6RA 2PRJA 1AF7A 3GN1A 4OMUA 3FOAA 4V0MA 1XEWX 4B2YA 4Q1VA 4XPIA 1NXOA 4PLZA 4D45A 3FCXA 2AMYA 4ALJA 4NBUA 5HJEA 2IQ5A 2NT3A 3VV3A 2D5IA 1GGFA 4RMHA 4OJQA 5EE9A 1E6MA 1OMOA 1Q12A 2YYYA 1Z6AA 3EEIA 2IYFA 1OTYA 1SCDA 4OQPA 4OREX 1Q57A 2XNSA 4G0YA 4G4SO 1P2BA 1VLJA 1O4WA 1XG5A 2PKWA 3DNFA 4NPCA 4B7XA 1VLMA 2B0JA 3IAXA 3IJRA 2R97A 4I4CA 3DMFA 3OC6A 4GQIA 2VT3A 2PVCA 1TF5A 2C3PA 1A77A 1FSZA 4QQRA 1P4RA 1QIIA 1Y5MA 4Y2YA 4X95A 1C4OA 5K4AA 3STVA 5L4LA 4Z1OA 1JT2A 1UJ5A 4WBNF 3QIVA 3VOBA 3ZE2B 3AEXA 2IOFA 1P91A 4TS3A 4NONA 4M1WA 3OPYI 1SQ5A 2E55A 5ES4B 4IDBA 5AM5A 1C1YA 4XX0A 5IKXA 3JU3A 3HO1A 2B30A 3HZRA 4CDNA 1FFEA 1P75A 2IIPA 2C2HA 2X41A 4D9CA 4S2UA 5EKSA 5CFPA 2WWVD 2R0QC 1P5FA 2C4HA 3C48A 4MVJI 2JLVA 5K8UA 3S6JA 1PFKA 3W5UA 5EIXA 3GCGA 3N7AA 1JR2A 3PJDA 1FNSA 1ZL2A 3IB3A 2NU9B 3S2IA 2B8JA 2OQRA 4QGHA 3TW4A 3V4FA 3K9GA 4FK8A 4H7HA 1Z0FA 1E3WA 4Z86A 4JI4B 1USVA 2WM2A 1EK5A 4KQ2A 2MMGA 4CKZA 4MB6A 2XT0A 2WJIA 2OO5A 1KEZA 3PC3A 1D2CA 1FYEA 1U4NA 4DT1B 1RLIA 1T35A 5HG0A 2R87A 3MCVA 1L7AA 3CWQA 1P2TA 2RJNA 4RQUA 1K66A 3OAAD 1IATA 3KQQA 1JTVA 1KBZA 4JB2A 2NSYA 2WZDA 3M2TA 1KHTA 4UNPA 4MDHA 1S4QA 3E61A 3G0HA 4JLWA 1RHKA 4HK4A 2HH9A 3QXCA 4F1KA 4D80A 3LI2A 5BVHA 4HO1X 2AN5A 2HUPA 1P61B 3N8GA 2CXXA 4S1OA 3KTOA 1E5TA 5D2CA 3NRJA 5JSYA 1FTNA 1SVUA 4C76A 3D3WB 1EUDB 1T3TA 3I45A 5C1BA 1AMOA 4R2JA 1YHYA 1U2RA 3N3BC 5CW2A 1ZMTA 5AVKA 4ARVA 3OFJA 3MMPA 2G9UA 1XB2A 2VWHA 3D0OA 3UYKA 2JC3A 2O5VA 3FLAA 3GZ4A 3L18A 4N18A 3P0EA 5EYPA 3TW8A 1JLLB 4H7PA 5HX7A 2NU6B 1ZAKA 3LK6A 4YH1A 1VPTA 2D3TA 3UC5A 1K5HA 2VJNA 3LCVB 5BQ3A 2CEAA 2AJBA 3K8QA 3SMVA 1EBBA 3VR6A 3BERA 4OI1A 5LZ8A 3FTQA 5I7WA 3NIDB 3BX1A 4BLVA 1YR2A 1V8OA 4FE7A 2EJUA 3GBPA 4CEJB 4XQGA 4L74A 1OB5A 5L9AA 5DNYB 2VP0A 5IJAA 4F2DA 2OBMA 2G4VA 4K2AA 3RAJA 3LE8A 4DLPA 3VHRA 3TS1A 2OD9A 1TJPB 2OM2A 4G2NA 3SZLA 3DJFA 4DXAA 3PUYA 1OLSB 4GZ5A 4DVGA 1SEPA 1GSAA 2V54A 1QO0A 2XD4A 3GJQA 4DDVA 1N0WA 1EUYA 4A23A 2OHIA 1DS6A 1NIJA 1K7YA 1XL1A 2JAQA 2JJ1A 2JLSA 2SECE 2WR8A 1REQB 3ASYA 1W59A 3KL2A 5K99A 1P7CA 3RRJA 3UMGA 4QUKA 2ASEA 1MOQA 2L0XA 5TPZD 2HV9A 4BRUA 1DXQA 2EGHA 2HM7A 2C00A 3L6BA 2PA0A 1U8UA 4ZVKA 3NP9A 1Z4NA 2HV8A 1DBIA 2XKAA 3AETB 1O77A 4KFRA 3A26A 3ZHQA 4O0LA 1U3DA 4ITVA 1E2MA 4IOJA 2QZSA 3ODGA 1Y34E 4EGAA 4HVAA 3VDMA 1VJ0A 3SDSA 4YECA 5AWFC 1QR2A 3P4UA 4NDZA 2GZ2A 1J20A 2BONA 4RVOA 1S9HA 1S2OA 1N2GA 2PEZA 4DV6B 1UZMA 1GADO 3DXFA 1HR0B 2WY2D 5DCYA 1U0HC 4H2DA 2Q0SA 4MRPA 3WI7A 5REQA 3U1TA 2IHNA 4QU9A 1UBGA 2V7QA 3GGDA 3WKBA 2OGUA 4BQEA 5C7OO 3O4IA 2C2BA 4FFBB 4D4GA 4BV8A 5BSTA 2GAOA 4ARSA 2I54A 1HNWB 2ZTUA 4UDYX 4UPVA 5T57A 3L02A 4W6QA 2PX2A 2GNPA 2J8ZA 3ENQA 3G89A 3KKOA 4GZ3A 4TLDA 4Q7MB 4GPEA 5CLGA 4J1TC 1VECA 3AU9A 2Y05A 4RMIA 1JAHA 5GONA 1P7WA 1M1YB 2I66A 4G4IA 4QYSA 4JR0A 5KPJA 3H86A 4QHTA 1DO8A 1EVLA 4UCXA 5JS1A 1XFAA 1XT6A 3GFVA 2QTVB 3P2MA 2COUA 3D3JA 3M6UA 1FUEA 4J16C 3M4XA 3WDMA 2CHVA 2GRJA 3CXRA 4WOBA 5IHLA 4M8KA 1U5AA 1D2RA 2WABA 3AYXB 3E8MA 5IM5A 1ISFA 4A15A 4D41A 3VDQA 1OGIA 4AG3A 1DE0A 3D7NA 4YA6A 3T9CA 4YT2A 3ZWDA 1PG2A 2GETA 1BEEA 4F2WA 1G3IA 2O0MA 2V6GA 1ZH0A 3O6VA 3IAEA 3K15A 1I0ZA 4WT7A 5K3OA 4LTNA 4NL4H 3U0VA 2FPUA 2F1OA 5AI4A 3Q2IA 3IE2A 3VPDA 3WIUA 1BJKA 2ZT7A 1L4EA 1EXTA 1MIOB 2GKGA 5DBGA 3W8FA 3BWEA 5G41A 2AK3A 5KUTA 1HEIA 3O8CA 3I53A 3OI7A 4OK5A 5BR8B 4NBNA 3KXLA 3AKZA 5LNK6 3H6HA 2JLAA 4EYQA 3L4EA 3M82A 4XWGA 5LQJA 1GCOA 2YFKA 2QPLA 3FSEA 2OEPA 2QPOA 4TXMA 3RRXA 3UJNA 5BSWA 1LRLA 1RLOA 2FOIA 2OAEA 4JLVA 1L7QA 4F4UA 3H9QA 5ED4A 1FZQA 4XIGS 5IYZF 2HRZA 1N57A 1P0FA 1IN8A 2F1JA 2XNKA 4JZKA 4WBNB 1E9DA 1FP4A 5EP4A 5C34B 3C14C 3NAQA 1PTKA 3GARA 4MV6A 5IAEA 3GGPA 1Z0KA 1VRCA 2C94A 3ZHZA 1LPNA 4LZZA 5LWQA 2HA5A 4TYQA 1OLUA 4DCGA 1PJTA 4IIXA 4D2IA 4YXWD 2Q8QA 3A3NA 1Y4SA 2IV3A 3RNOA 1N2CE 4UFPA 1XJ5A 2FVYA 4B48A 4R83A 4B44A 2X2EA 4HQ0A 4PZLA 2V55B 4UM5A 1KVSA 4OHWA 2MTBA 1ESZA 1SHZA 1YB1A 2YINC 2R8EA 3AHFA 3BJRA 4K81B 4LVUA 3OAAA 4R8MA 1N7IA 1ORIA 1G20B 1OU0A 4QG3A 4UBOA 3K6JA 4JLKA 4DSAA 3T3IA 3EOZA 4CDMA 2I4OA 4GEKA 3HXQA 1JDZA 1H2WA 1NKVA 3R1IA 3SR3A 2FZVA 1GPLA 3H9EO 2RCYA 3LH5A 1QQ7A 3L7AA 5EIFA 4AAYA 3W1VA 3AESA 2KLBA 1SK8A 3E03A 3HKBB 3TD9A 1Y0BA 4W8GA 1UC5B 2AJTA 3N6XA 4WXMA 1YAHA 2FPKA 2V7WA 1JR3D 3CR3C 4GGOA 2VP4A 1L5VA 3WYEA 2O8EA 3MTDA 4M4PA 4XQ9A 2IEDA 4RTJA 4YHBA 5AUPB 5CPFA 3ONDA 1I6MA 5F33A 5HQ3B 1PWHA 2GYWA 4IIJB 1YJCA 1Q7RA 2Q50A 3UK1A 1AM4D 1X7XA 3UJ7A 4D4HA 1NW5A 1PD0A 3OT5A 4I8DA 2DKFA 2A5FA 2WIAA 3C3DA 3VU9B 3VYWA 2PO7A 1DXYA 4R2IA 2IK8A 4F6CA 5EQFA 1NBIA 3IBFA 3KQHA 1UQRA 3GLTA 4BP9A 3C2QA 1MW8X 3KZMA 4BZWA 2GFHA 5LMCA 1P9NA 1R5OA 4DV7B 3HY3A 2B4AA 3A1SA 1GZVA 5D7BA 1XNQB 2XUZA 3IQEA 2FW1A 1O6CA 4PIVA 1V5GA 4MDFA 3TFOA 1OTXA 1B26A 1O08A 2JAHA 2P9HA 1NXWA 4D42A 5CU7A 1AS0A 4ONEA 2CMDA 1SVMA 4KR3A 2O52A 3KKMA 3KT6A 2XGMA 2YL2A 3N07A 3R9KA 4BTVA 2JFWA 1F3OA 1RWMA 1YS6A 2C2MA 3AFNA 2VJBA 4IWNA 1O6ZA 2QPAA 3BMCA 4KE7A 1HBJA 2BDUA 4X45A 2H7YA 3SJBA 4BGVA 3A6LA 3ZR4B 3EFBA 4CMIB 1W0KA 4MA0A 4G24A 3K1ZA 1JNYA 1ML3A 3FPGA 3EVAA 2G9VA 3BG5A 1K5PA 1MAHA 2CLIB 3WMRA 4LJ4A 1BN7A 1L5HB 1V3QE 4XLTA 1WSWA 3AL2A 3AEKB 1DINA 1I3OA 5HS4A 4HEA1 1Y3AA 4ZRMA 1J9EA 1WXXA 1SM4A 1RWVA 4A0RA 5IAJA 4MKGA 3KVOA 4J6GC 2EYQA 2IKSA 1ORTA 1DIRA 2OMKA 4UE2A 4IX1A 4OPMA 1XZQA 2PS0A 5J1TB 3S44A 1M6EX 2D0OB 3A7EA 2DBQA 1GFZA 3HJHA 4FMPA 1AMUA 3SE0A 4O0MA 3TPZA 3TEMA 3S0JA 2CK3D 2QRVA 3PT5A 1C50A 3NNSA 3NORA 1JXMA 5ERGB 2X3YA 4ZV4A 1PYGA 1Z0DA 3TJMA 4MUMA 3QX9A 3PI7A 1E9RA 1LSUA 4HTFB 1EVKA 3LYAA 3SSNA 3EXIB 3VR4H 1WHTA 2DH6A 5SV2A 3TFWA 5JDIA 1ZISA 5TB5A 3TLZA 3CV3A 1Z45A 2PRIA 3SBOA 3C5HA 1ZJ6A 1MO2A 1MO4A 1VZ2A 4E5KA 2ID4A 1M0WA 1M34B 1TE2A 1W2GA 2RHCA 2PL9A 3GLGE 1DFGA 1TZ2A 1ZCFA 4ZOCA 1WOMA 1W4ZA 2WQ6A 3F6CA 4MUJA 3ZJUA 2EERA 2HJ9A 4QDKA 4ZKEA 3VPAA 3MMXA 1XMSA 1XLWA 1IM8A 1C2YA 2MHCA 1YQXA 5F2NA 2RGRA 3M6IA 1HG1A 2FZCA 1IAVA 1NBME 2WB4A 4JKOA 5K5EA 1XE3A 4ZAWA 1QF9A 4JEMA 4NYMR 1VG0B 1PWYE 1UIRA 2ZW9A 4GE0A 3V8EA 5BOSB 5BV0A 5KC9A 3RVKA 2PUHA 1VYUA 2JBAB 1WKBA 4PZ0A 5ALFA 1BMFA 2JGAA 5H9WA 3UH1A 4K9SA 1YZGA 3OOWA 2WIBA 1DFHA 4PX3A 4BEBA 1DZIA 1NAIA 1QVAA 1ZWKA 4U7JA 3RS4A 4N65A 1ZVMA 4RHTA 4DCUA 1FMJA 4OXQA 2DY1A 3EPPA 3RBVA 1U9CA 3UCFA 3L05A 1A2QA 4Q7KA 1TKAA 1KEWA 1KI3A 5IASA 1CPYA 4HQFA 2H65A 3FFBA 4IEEA 3JQGA 3CVWA 3GUHA 2PIDA 4G5RA 4NNPA 4P5DA 1HTWA 3I52A 1PVVA 3SBEA 3V80A 2VDOB 4BLRA 2XDQB 4EIWA 1TDJA 3FTPA 5E6RA 3I61A 5EQJB 3CBGA 3KE8A 1WB6A 1YBHA 2G1PA 4B3SB 4FQ5A 3PHHA 2EEPA 1BMQA 4W8OA 1WY5A 1LRKA 3AINA 2JEZA 3D7KA 2J5XA 4XGIA 1ARZA 4RPIA 4NBLA 1U81A 221PA 1LBTA 2HF7A 2RAPA 4OHCA 4PAQA 1YVPA 4PW0A 4F11A 4PRYA 3O8QB 3R5XA 2RHBA 1X19A 1DT3A 2HC9A 1A88A 2IUFA 3OOJA 2V0CA 5B4UA 4KHPB 2RCNA 3QU9A 4ZI7B 1YUNA 1KJYA 4ACBA 1EX9A 2ZVDA 3M3PA 4QYMA 2ZSUA 5JYEA 1YS2X 2ZPTX 4Q3AA 2WPDA 1Q19A 2AX3A 4XJSA 1WUYA 3G88A 3FCAA 1WG8A 3P7MA 4WKPA 1U2PA 2QTLA 4TZKA 4FEGA 1PZEA 3WO0A 2BKEA 4DARA 2WIDA 3C3BA 3R24A 3OVMA 4Y6PA 1YL6A 3TEFA 1YWGO 5CLHA 5HK9A 1RI1A 1G2OA 2WYHA 4OP1A 2UYHA 1J8DA 1ZRNA 3IVRA 3FYUA 3D1VA 4F0JA 1GAQA 4AW9A 4Q12A 5JJBA 1UKCA 4KK3A 3JZIA 1SFRA 3MM4A 1KFCB 4QAQA 2PRSA 2A78A 2C5BA 3FD8A 4HT3B 1XP5A 2NADA 4PPGA 5FBKA 3NHLA 3NVKI 5I3ZA 3PXBA 4M8IA 2OB1A 2PSDA 4MR8A 4DNXA 3KU4A 2IWHA 5CX4A 3OZ7A 1WBJB 4TQGA 2VJCA 4BBAA 5KQMA 4F71A 4BX3A 2TMKA 2V7VA 3FYSA 4F12A 3DFIA 2FSGA 3FNQA 4P3OA 4C2TA 3DNMA 2BFDB 4A6DA 4K46A 4WECA 4MW9A 3TXXA 2YDYA 4A2QA 4E4RA 3WOVA 1JP7A 4DOMA 2O50A 2HBYA 4QBTA 3OQ1A 1V7CA 2EEZA 4J3JA 3WGHA 2P7HA 3P9IA 1QHXA 5IH3A 3WWOA 1G3MA 2N75A 2P2CA 4KE8A 4QJIA 3AM3A 4NJMA 5EIOA 2FDCA 1PV2A 5I7RA 1JA0A 3PPIA 1R6AA 2BCJQ 2J6CA 5TT1A 3RYCA 4RK4A 2PV0A 1KERA 4A91A 4QFBA 1G9SA 1Q0LA 4MMYB 3ITNA 5L7TA 3B1WA 3MINA 3MWGA 5UKDA 1SOAA 3VH2A 2DUWA 2Y1XA 3OPMA 4XTCS 4YJ3A 2CFTA 4WESB 2CL0X 1RYYA 4ETMA 1OC2A 2CNWD 3LCUA 1JDBC 1W8IA 2ZI6A 4IH4A 2MR5A 1ZJ4A 1UBSB 3FWZA 4OMCA 2LDXA 5FF9A 3VKWA 3T5AA 2MOKA 4FFSA 4OUDB 1N1MA 2OYSA 3TIVA 4CM7A 3KTFA 5A6SA 2C04A 4B6OA 4MWBA 3NU1A 3STHA 4YP9A 3V46A 2BV3A 3O8OB 1U2DC 1F7UA 5H16A 3WX0A 5BUZA 4X91A 2F9FA 3UXMA 3MC1A 1CRLA 2YWFA 4D82A 3DTVB 3UXYA 2EV9A 4MPPA 5D84A 4KQWA 5CM8B 3TRHA 1QGDA 3DZDA 1DXOA 2G5CA 3MELA 4RD2A 4ARZA 5E4FA 2GN0A 1KQPA 4RJIA 4ZVUA 5EJFA 2XRFA 2NAPA 3BB3A 3EF1A 2HY7A 2G0NA 4U7GA 2AC7A 1NYQA 2JJMA 1CR6A 1FDOA 3ON5A 1FLNA 1M1NB 2AKAB 1U8TA 1ZH2A 1QFJA 1D6NA 3AKYA 2BW0A 3C8DA 3IMFA 4MS1A 1E9BA 1XA0A 1Z7BA 3DAGA 5FO1A 1RKXA 3T7RA 4YRRA 1Z5GA 2JATA 4P53A 2Q4EA 5H4HA 3BM5A 1FUYB 1Y6QA 4D99A 1ODLA 1YQEA 3TQTA 4HY3A 4XB6B 4KDRA 5BO5A 3CQ9A 1IK6A 4HZUA 4WK0B 1ZH4A 1UOOA 4DLBA 3V8BA 5AQEA 3TUZC 1P62B 2F2TA 4HLQB 1P2GA 5DGXA 2EATA 5HRAA 4RZSA 1I32A 4BQFA 4RDCA 1I2AA 2HJGA 2JF0A 4P22A 5ALTA 3VBCA 1V5IA 3D7LA 4DCNA 5M34A 1N0VC 2DLCX 1ZGHA 4N3AA 4TLBA 1UEXC 2V9ZA 4FGKA 3U09A 3RUCA 3AEQA 5HEKA 2ECKA 3VZDA 4LEIA 2UXBB 3TQFA 4REOA 2CVHA 3E81A 2I2AA 3RG2A 2I9PA 5AI9A 1GV1A 4K8RB 1PFGA 2EYUA 3WZMA 4EPYA 1OILA 2FLWA 2XMQA 3TBHA 4ALMA 1QHEA 3LY7A 3KUXA 4YPVA 2XGSA 1UP7A 4RE6A 2B9EA 1YS4A 2W0MA 4QARA 1KC3A 3ZEAA 1GR1A 3ZWKA 1IVNA 2OCDA 1OOEA 4BLPA 5CEEA 1Z0UA 3TRDA 5L6LB 1OXTA 3OLCX 2V6FA 1M8GA 2GCOA 1Y6JA 4PSDA 5CH5A 3AGPA 2UV8A 3VKFA 4G26A 1L8OA 1DL5A 1O94A 1QH8B 1YGYA 5EUMA 5KHLB 3A1NA 4BQQA 3C41J 3RYCB 5AVJA 2FGKA 3LQ1A 4DRXA 4M1TA 3C74A 3G2IA 2OV4A 2B21A 2J07A 2AL7A 3P9QA 2CXTA 5AKEA 4GX2A 5DN9A 3I42A 4MR7B 2HIAA 3GT7A 4QUBA 4UJ3A 3OQNA 1VKOA 3HO8A 3O0DA 2AZDA 4U9HS 3WGGA 1I7DA 2P6OA 3PD1A 3OTHA 3LC1O 2EG9A 1RKUA 1ECPA 5KEIA 4LIPD 3H4VA 5IXSA 1JSXA 3QUAA 2QLMA 4JITA 2KMLA 4XPZA 5KYVA 3OZCA 3G9TA 3JVVA 3ITKA 1ZOPA 4H16A 1YFZA 3PWKA 5G02A 4E4DR 1RD4A 3KJHA 3ETGA 3AGQA 4P7JA 4WJKB 1HLDA 4UNNA 4NCNA 4NG5A 3AR4A 5JXJA 5K2OA 1VQ1A 2OBYA 4J07A 1FP6A 3QJ5A 5TE9A 4F72A 4UNRA 4FMBB 5EESA 3G49A 3HDQA 2VDKB 4B84A 3COJA 3VDXA 2Q41A 3L84A 4EW6A 2YRFA 1YBFA 2C2WA 5CLQA 1XROA 4DA4A 1DX4A 4BFTA 4KQFA 4CCYA 5AD1A 3E4CA 3UPTA 4JJAA 1HDOA 1ZMRA 1PFQA 4B73A 1BA2A 1NF3A 3I09A 4G5FA 4LPSA 2H7XA 3A3KA 5EJ9A 3M34A 4F5ZA 1JWLA 5FOTA 3B48A 5IT9A 4G0NA 4WDQA 3W9SA 4YUZA 2EGGA 4P7FA 1TM5E 1NFRA 1V7QA 3OCCA 3OT4A 1Y1TA 1WX1A 5BYAA 4B5LA 2B2NA 2QIOA 4ZXPA 3OKCA 3I9NA 3DEIA 1GPBA 5HF9A 2JI9A 4EP1A 4CG3A 3F6BX 3KYDB 1CBUA 3NHJA 3UOGA 4C0WA 3RF7A 3A3OA 2AK2A 1U3VA 4X66B 2WA2A 1IXYA 3WQSB 4GOMD 1WPQA 4G5HA 4EG6A 3BD9A 3N2EA 2BSAA 5HCUA 1I5RA 3EQ8A 4INAA 3GLSA 2AHRA 1DC4A 1LS1A 3ORSA 1D03A 4F46A 3RJMA 3FZNA 3HRHA 3CISA 1WEKA 2ZPUA 1XMVA 2FSIA 4CN8A 4JGBA 2C3UA 3DE7X 3E9MA 2I0FA 2P1RA 1QKIA 1W4BA 2PQMA 2QMOA 3F46A 2OPHA 4QBIA 2GSDA 3E9CA 3DEKA 4AYWA 1I2CA 1GFIA 4TQAA 5GVSA 1SUDA 2GCPA 4OBEA 3R6TA 1J7KA 2O23A 2ZYTX 1AQLA 3H5RA 3RRZA 3MB8A 4ARUA 4Q9HA 2A92A 4K0RA 3AVQA 4JIGA 3ZY2A 1BJRE 3CH5A 3HJFA 4OTZA 3BVPA 4WN9A 3F8SA 1G0OA 2GEVA 3IP7A 4L8YA 3REQA 4RVHA 1YTUA 1T9HA 5I7UA 1NDUA 3VSDA 3UK2A 2AV6A 4UVDA 3V34A 4OIFA 3LCMA 1AO3A 1YZUA 2B37A 4YONB 2ZRIA 3JATA 5ITZA 3UWDA 3DLBA 4Q9DA 1NVVQ 1X7WA 2DGDA 2WF7A 1PZNA 4JLNA 4Z0TA 1BQ3A 1K4YA 1J9GA 1M54A 4TL8A 1NZFA 1F2UA 2GT1A 1E1MA 1J1IA 1GTMA 2W6JA 5C1IA 4CF4A 3AW9A 2ZKLA 5ALIA 2O3UA 1VIVA 1R12A 2NXJA 4U63A 1D2EA 4JI1B 4DN6A 4HN4B 1M76A 2O2ZA 4GLFA 3MILA 1PG0A 1QAMA 3CA8A 3CFYA 2RGNC 3FSRA 1VPEA 3VHXA 1U7XA 3RTGA 3VSAA 4ZQEA 5H59A 1GCUA 1L5FA 4DRXB 1H1LA 2IYSA 4NV0A 4PGHA 5A05A 4DZTA 2Z6VA 1D7AA 5KTSA 4GDFA 3W7VA 1UDRA 2AI1A 2DMRA 4WINA 1T9GR 1XRPA 3BH0A 3KAKA 3SX0A 1I1NA 3H9CA 4KPUA 1G3UA 3GJZA 3GXOA 4YEDA 1YQ9A 3WGUA 4C0HA 4Z4CA 3WR5A 5GZ1A 5SICE 1FVFA 4L15A 1JIVA 3BA6A 4L4YA 3MF4A 5COBA 4ZOBA 4AVYA 4FDLA 2J9FB 1ADYA 3MTGA 4RVUA 3V3KA 3SDBA 5CT4A 1HRDA 2RAVA 3PCRB 1E9VA 5GIPE 1KWGA 4OLAA 5BN5B 4OK6A 3A1CA 3L0PA 1YB6A 4CEHB 1AN0A 2ACEA 4N3CA 4C0QC 5AOAA 4EZEA 3RRYA 3FTCA 5JO0A 5ALNA 1W34A 3R7DA 1P39A 4OJKA 1R66A 2XUGA 3UH0A 4XVUA 1T3SA 1YE5A 3IVXA 1F8FA 4KLZA 2FZGA 1MD9A 2AN9A 1BFUA 2HF8A 1BGWA 2QQGA 3BXFA 4KH1A 4MAFA 2PXXA 3DTYA 5F64A 5BYBA 1XRSB 1U1CA 3SBDA 2ONCA 1JKJB 2PSSA 3CMMA 1JJFA 2E4WA 3T1QA 4RA6B 2YYSA 2FEPA 4CG2A 2XYGA 1V95A 2YVQA 2VDVE 2VRBA 4YRCA 1Y9ZA 3EH1A 3ZHRA 2WUDA 2BFEB 2H54A 2JCSA 3K4PA 2XOKA 5FNZA 2NTYC 4B40A 2IU4A 1AIPA 4ZCTA 5B36A 1RRPA 1QFMA 4EI9A 1M72A 4IWXA 1LEHA 1Q91A 4HH3C 3A9RA 2EJBA 3O7MA 2CV1A 2O3TA 4RFSA 5L3SB 3P97A 4M98A 2LR0A 5EXEA 5JBNA 5CNJA 2XRMA 2WTEA 5GAJA 3PFCA 2ZUBA 3FOFC 2IZOA 5FBQB 3WA7A 1JIXA 1PJ8A 1SUPA 4QBKA 1D2HA 3Q98A 5C4MA 5LZ4A 4PS1A 1H3NA 4PC3A 1H8HD 1SZCA 2BEKA 2ZRMA 3DAHA 2BMJA 2G83A 1VCIA 1Z62A 3VZBA 3IXMA 1Y5RA 5L3QB 4YBRA 1G38A 1T29A 3GROA 1RXSA 3ZWOA 3V48A 3GD7A 3IPXA 4LZLA 4MQFB 1WTAA 1TPZA 2AEEA 1YOBA 1XRNA 3C3WA 4NQZA 4RK5A 3IKJA 3S40A 1Y5NA 1HYBA 5GJBA 3QYFA 4BRWA 3QF4A 2X9GA 4LYJA 4X6YA 3CRZA 2OILA 4RYDA 1F0PA 1Z7GA 3PX3A 5IXJA 5ISMA 2AUMA 2FF7A 3DE5X 1Y1PA 3OQVA 4A1OA 2DECA 5CIRE 3C1TA 4W6ZA 1NUTA 5TMEA 1ODCA 1KQ3A 5BNFA 1KK2A 1HG0A 3TRFA 2FJUA 1G8PA 3NS7A 4KN9S 1MC4A 2IHYA 4JBWA 1GNPA 5T8KC 5TQ0A 4K6GA 1U8YA 4UOZA 2ZB4A 2FUNB 2DWPA 4CMJA 1CS0A 1V8BA 4RSUD 1IC6A 3EDRA 4XIIA 3SC2B 2HEIA 4G86A 3AY0A 4PYOA 1XEAA 2BGJA 5CVCA 4BNLA 1CW2B 1VKRA 5LL6P 1W9MA 1MB3A 2A5YB 2VP3A 4JXXA 2PD3A 4JFAA 4RY9A 3C3EA 5DO9A 1C30B 1J6UA 4J16A 4LQDA 5SZJA 4PPFA 4RF3A 4XGQA 1E1RD 2C4NA 2GRUA 2V6MA 4Y6RA 4L2IA 3OA0A 5L7YA 5AESA 3QJYA 3BWDD 3FPSA 4R0VA 1VHQA 1RQNA 4IXWA 3BK2A 4B0PA 1RLJA 4BVJA 3ALQR 3UJPA 4A92A 3TXYA 2P9EA 3MLEA 1N9ZA 1RADA 3U40A 4E2ZA 1JA9A 4OLFA 4QTTB 1H69A 3P0RA 2XYRA 4Q3KA 4H3HB 3KLPX 1EXDA 3QYAA 5C5EA 2POQX 3BIFA 3KAPA 2IDZA 4QEZA 1LH0A 2HFKA 2XR1A 3TLKA 1TVEA 4OP2A 4NZZA 5IAOA 3T7TA 3I2JA 3QLJA 4BECA 3E15A 3VRHA 1JI3A 4Q1BA 5C35A 2OCXA 1Z8HA 4FGLA 1KP3A 3UWKA 4CKCA 1DAHA 1QP8A 2HMUA 2FLVA 1UMKA 2QM7A 3A6JA 4PXYA 2OG2A 4KVGA 4ESHA 1E2PA 2GAAA 4PF1A 1B6SA 3G9XA 1G7RA 1CDOA 1FYVA 2JJ2A 3B8HA 1JJVA 2C5HA 3D2AA 3K09C 3KZOA 3O8LA 4GS5A 4OQZA 4W7HA 3V2UA 1FRNA 5FWYB 5HKOA 2NW6A 4Q19A 4XASA 5DBEX 2VHQA 4TV8A 4OBWA 3RODA 4BLSA 2G5GX 3EPLA 1NF2A 1H2RS 1S2IA 1Z07A 4TZ6A 1RYFA 1O57A 3BFXA 1KYWA 1NJ5A 1ZD4A 1KK3A 2Q7OE 4XIFA 1T26A 5F52A 2Q3FA 1E2EA 3LCJA 3CNHA 2J5BA 1JKJA 4MOWA 2IFTA 1Q7BA 2SKCA 3IA7A 2J0SA 2AMLA 5FI1B 3P9RA 3WGKA 3OZXA 4IMJB 2H59A 3IX7A 4F45A 3K6RA 4AJPA 5A5DA 1Z29A 4UW9A 2ATEA 2PGNA 1U04A 1OT3A 3NALA 2Q1SA 4LZNA 3TW0A 4FSDA 3C7DB 4ZVSA 1OVMA 3NUQA 3A1WA 1YI8A 2QN8A 2DUMA 3EVDA 4KQ1A 4O4JF 3AFMA 3UT0A 4D44A 1T9ZA 2FEXA 2ATCA 3BH7A 3F5MA 4ITRC 3STUA 1X7HA 2DPGA 2WFAA 4G1UC 4ZOAA 3U1BA 5K0CA 1TAHA 3R9XA 4BFLA 1PJAA 2EZ9A 3UAZA 4ND3A 5A04A 2Z0MA 4UVGA 2WFZA 4NZ9A 4CIVA 2NUPA 4KZKA 3EMDA 1RS0A 1GUZA 1RPNA 1G6Q1 1C3JA 2I34A 3HA2A 4LVOA 4INZA 1PR6A 1H2YA 4R84A 4BJ3A 2WWTA 5LBIA 1DVRA 1JLSA 4QYIB 3VOSA 3VPGA 3ZD9A 4P92A 5FOXA 3SNHA 4YT8A 1QMGA 1PWEA 2WMNB 2GPTA 2NGRA 3SN6A 3GDWA 2OC4A 2Y9MB 4E6PA 1VMKA 3U3OA 2P91A 2Y93A 4REQA 3PPXA 1OFGA 1Z8FA 2HNKA 4NFHA 4C3ZA 5LR6A 4NPHA 3KETA 3L0IB 4AN0A 1VC2A 1JLMA 4BE7B 5I4KA 3EAGA 1J23A 1R0WA 1VXRA 4I1PA 1COZA 1GV0A 2IKQA 4UQOA 3WLTA 2ZGVA 2E82A 2Q1WA 2WJ6A 3BRSA 3K2QA 1TK3A 1OKKA 3O74A 3MMSA 4MQEA 4W5HA 1NJSA 3UAOA 1CUZA 1UDAA 2G25A 4TWZA 4ZD6A 1RNLA 1VI6A 3BD6A 2CLLB 2ZANA 3DS8A 4IG9A 2NVUB 3VTAA 3BE6A 4D74A 5JRZA 1I6WA 3PWZA 3TLXA 2JJ8A 2C8LA 4DC9A 4OOFA 3RSCA 2UZ0A 2GAFA 4P98A 1GKIA 3CVJA 4AJHA 4V1CA 2CZQA 1ZXBA 1PJBA 4HEHA 1AO0A 2C59A 1EVQA 1O9HA 1VCNA 2IP2A 3AESB 5FWNA 1E7SA 4GD3Q 4DHEA 5IFLA 4Q3BA 1G6OA 2VHCA 1E99A 1NQOA 1H1TA 1G8HA 1KI7A 4BWYA 4AICA 2F9LA 2PN1A 3WHLA 2G6BA 1MOPA 2IHTA 3OG9A 4PZUA 2Z2ZA 4ND7A 4WOPA 4EL5A 1NI4B 1CY4A 4PZEA 1M6HA 2P4HX 5ICFA 3WP0A 3HN2A 1UF9A 4D0NA 3R7BA 1K68A 1N0HA 3GDHA 1XVAA 4N9WA 2HA7A 1NT4A 4JBXA 4UUOA 3UBMA 2G04A 5LJLA 1TIKA 1YRBA 3CLRC 4NRDA 2FPLA 2XNHA 1IQUA 4FFMA 2A1TS 3HKDB 3TKLA 3VH3A 4IVPA 1EFHA 1ZNQO 3L0CA 2PX4A 1NDQA 1E2HA 1SUBA 3LZCA 4E3WA 4MW5A 1GYPA 3N8KA 3VAAA 1T34A 4ZVQA 4TLAA 1USWA 2EQ5A 3GGCA 3QI7A 3ZXXA 2REBA 3R4CA 2DT5A 2R96A 3MRXA 1PW5A 1NVGA 3LUJA 4OJNA 2JH8A 1M2FA 4A2CA 4RXMA 2E21A 3D0QA 2XADA 3AEQB 1GSIA 2FNAA 2ZZKA 5EZ5A 2UUCB 3DFFA 3H6KA 4IQ0A 4JXJA 4KYUA 4BVFA 4UHDA 4I4IA 3VNBA 3NHAA 4NF2A 1F1BA 3KR2A 1T13A 4Q3DA 3ZTYA 1NV9A 2J45A 2QAGB 4Y9DA 4X1YA 1J8YF 2C07A 3AEYA 3WQRA 1ZQ9A 3A1EA 4N49A 3RUAA 3IJ2X 2ZR8A 3FMPB 3RRBA 2PGLA 4XUEA 3VU8A 4XARA 2IHVA 2VBFA 1QG4A 5K0LA 5EERA 1DKPA 5CD9A 3GLRA 3WWCA 4BNHA 1NVMB 2HI0A 3B89A 4NU6A 2VJPA 4H27A 4MKHA 3KPYA 5JUWA 4K28A 1U2SA 4WZBA 3ZW9A 4CIWA 1T5SA 4V38A 4C3VA 4F60A 1SXJC 2FZ5A 4FIDA 2Q45A 1YCFA 3BMNB 3SF8B 3DV0B 3ZHXA 3DZKA 4FCVA 3RV4A 2WJJA 4J4TA 1EP9A 4TVBA 3ZS8A 5E7MA 1EJ0A 2X13A 1C4WA 4M22A 4KV7A 5AM1A 1XTVA 4PGFA 4R81A 3QUSA 1PJLA 1V41E 3MBOA 4Y2PA 4ENWA 2CKMA 1D0SA 3NETA 3WK7A 1QUEA 4BRZA 4ADSG 4YV2A 1DIOB 3P52A 1WVIA 1PS0A 1S2GA 2PPLA 1B7GO 2FH5B 4PAMA 4G5SA 1Z36A 3R4VA 2G4LA 4ER3A 1TUBB 2Y1LA 3ZDFA 4DMUB 1YMQA 4RTMA 2J41A 5I9MA 4EGFA 5BRAA 2QU7A 3I34X 3NRBA 3E70C 4PHCA 3JD0A 1EE2A 3M4YA 3INGA 4GBJA 1ID8A 1YDMA 4KWTA 1EHIA 3RYIA 1A9PA 5IT5A 3RTAA 1DWUA 1FRFS 2YZGA 1SU6A 1OH7A 2CLEB 5IHXA 2LNDA 3JR3A 2FPIB 1JBKA 8LDHA 1XKTA 3W3AA 3QELA 1DC3A 1RT9A 3K94A 2WKSA 2HTFA 3GRRA 3V7WA 1FUUA 1EFVB 3GLHA 2FFAA 3JV7A 4MHSA 4RXTA 5GONF 4BNMA 2QQ5A 3JD3A 4R0NA 5JZMA 5ECGC 1A96A 2Q49A 4HAOA 5LU8A 2DHDA 1CNFA 2C03A 2M32A 1AKVA 2WFLA 3RU9A 2OXRA 2GCIA 2YWHA 3U9LA 1ZITA 4DJJA 3IPRA 1VXOA 4DLUA 3JQPA 3E22B 2Y6UA 4F93B 1QQ5A 2WWIA 3SJ7A 3UTCA 1N6OA 2EBFX 4IEIA 3A8TA 4OXNA 3SAJA 1H1DA 3IL2A 4JD5A 3O94A 4GMXA 1PYDA 3WMGA 4F7WA 2XV1A 3KB2A 2FN8A 3ZE6A 4ESEA 4H1HA 4FE4A 4TKVA 4DJAA 2I8AA 4K2HA 4OHPA 3BT7A 2IYLD 1QIHA 1ZD5A 2VLIA 4NFYA 5I5GA 4EA6A 2Z4TA 2BLLA 3IV9A 3OIDA 4OBBA 1J0DA 1ORVA 1ZL0A 4IFBA 4Z0PA 4ER6A 3RVNA 2TRSB 4P08A 3VC7A 4DDKA 1WHSB 5AIBA 3VR5D 5CX1B 2PNJA 1T1JA 1M5UA 3TTYA 4ZT2A 2QMQA 5JCPA 1H66A 1I6LA 3EISA 3HKDA 3FRJA 4BO8A 1ZA2A 4OD0A 5AMXA 5ALGA 2JHAA 3U7FB 3K5HA 1SXPA 1HEUA 4U7PB 3VVMA 3EC1A 4CMBA 3O2QB 4A8JB 4OVKA 2VDMB 4HDMA 4B4VA 3REQB 4PRLA 3PC6A 4NH0A 2O14A 5EWLA 4YUAA 2QTFA 2Q5FA 1CQWA 4Q66C 5JLAA 5IZCC 1UK9A 3LC0A 1SZDA 3SZGA 3U13A 4TM8A 3D4IA 3DCJA 4HQLA 4PLHA 4H1TA 1E0AA 2SKEA 1X7WB 5KAMA 3OT1A 3SZ3A 1BX1A 5HIKA 2Q07A 5JT1A 1QV7A 3CW8X 4KPGA 5BW5A 3TAUA 3AVWA 1U4OA 2H7VA 2G1KA 1TTHA 5K8IA 5DCUA 3EQ7A 1KR2A 5KZMB 5KU1A 2ORED 1PNQA 5DMJA 2VZLA 1RQLA 3Q5EA 2OOSA 4LMRA 3QZUA 4RY0A 2F7SA 4P4LA 4E51A 5JVDA 1TT5A 5LP6F 1GZSA 4HAUA 1USIA 4QJ3A 2JAPA 4FS8A 4AN1A 4KK4A 2FRDC 3IEXA 1QRSA 3ROGA 3ADBA 3H8JA 2QRLA 3VHLB 5ADVA 3PGKA 3AF6A 3DEAA 1G5TA 2ZVPX 1Y1LA 1FFCA 1WMDA 2D00A 2HQ1A 3A3YA 1WUIS 1YB4A 3ORYA 4I9FA 4RZ2A 5U4QA 1QPBA 1D0GR 1U6JA 1WW3A 2OZKA 2QZJA 1QGUA 3QEJA 4YDSA 5ALXA 4YMUA 1AZLA 1KJIA 2O1EA 5IVHA 2BM8A 2PXHA 3O91A 4RKEA 1SXJA 3JQQA 4Y9SA 4LNHA 5AJVB 3P9KA 2P62A 1U6IA 1V16A 3L8HA 4DW8A 1LK5A 1ADGA 2IGTA 1U3FA 3DVRX 1ODTC 1FOEB 2B3TA 2GKOA 1FXWF 5A1TA 4MVXA 2BP7A 2GGSA 3CHYA 2PT5A 3H4TA 3SDZA 3NM4A 4AG6A 2OCIA 4GM4A 2EIXA 4A4DA 1GM5A 2KLHA 5FPQA 3IIIA 4KGGC 3SXPA 1XTPA 4OMDA 1PS8A 1KBQA 2R86A 2HNAA 4KJXA 4S1WA 3ROPA 2ZQYA 3VNUA 2GWRA 2ZJZA 3WKAA 4CHTA 3AFHA 1BFKA 5ALOA 4JYPA 2CCJA 3MOIA 3A27A 4RGQA 5CMLA 3RYIB 2VK8A 2IH2A 3GAZA 4KR6A 2JGLA 3GAMA 1YA6A 1RYBA 3FDZB 3O8QA 1YI0A 2W2XA 3VKUA 1O5TA 3F4BA 3U7JA 4K1XA 5JYCA 3PX7A 1OX4B 1LI5A 1Q95A 4IDAA 5DM4A 1HRKA 1VIYA 1NY5A 2YIMA 4L9WA 3N58A 1WV0A 2WAYA 4WQMA 4EJFA 1B3RA 2C4WA 3ZN2A 2PSHA 1JR4A 4WH0A 1DSSG 1PTJA 2I3BA 4CLDA 3FNGA 5MHTA 4H1VA 2DVMA 2I2DA 3OICA 1PDWA 2WTXA 4OOEA 1RVDA 3HDVA 1RP1A 2X86A 3ZVMA 2PZBA 4URYR 2VBIA 4FFOA 3INTA 2CV0A 3RSOA 4K6OA 4FYVA 4L85A 3K70C 5EZYA 3RTCA 4ETNA 3ME4A 3NYIA 4DZRA 2PHZA 3UJHA 3PNSA 1R10A 1SBZA 2Q1YA 1WF3A 3GGJA 2OXCA 1W0JA 3OTOB 2QNBA 3FDFA 2FZKA 3LBAA 1OWMA 2AYYA 1A98A 1CG6A 1KH3A 1RWKA 2B6HA 3OCJA 2ODTX 4PFSA 1JHOA 5AXCA 3K9WA 3NIGB 3OZSA 9LDTA 1CB0A 3FGNA 3A9UA 3O1LA 4MQFA 4UBMA 2RAUA 2WMDA 3I0NA 3TE6A 2JAWA 3KYCB 2AZMA 4MR9A 5CT5A 1DCTA 2PWBA 4WTOA 4HB2A 4EG1A 5FUVA 3QHAA 4W5NA 4IUDS 1XTKA 1ZC3A 4PO3X 5DX1A 5KKCA 5CA0B 4Q6WA 1WMFA 3EMBA 4IXTA 2QMUA 2X8WA 3LT1A 4LVCA 4J7AA 3DEHA 1ECCA 4PE5B 5COAA 1QGYA 5EJ8A 4YIKA 1Z4QA 2QW1A 4RQTA 4FILA 3RVDA 2OBLA 3R6DA 2I6TA 1V39A 1ZM3A 2AN1A 3ANSA 4A10A 3K1AB 3BYZA 4WKCA 3W5SA 4DDWA 1BDHA 2C58A 2G1UA 1TQ2A 1X1BA 1XWWA 3T3GA 2BGKA 3FX2A 1VA4A 1UMDB 3QPVA 3NTOA 5FLEX 3WLHA 3WLNA 3PXAA 3KUKA 3TGPA 1DQSA 4FHZA 5AW5A 5FBLB 5IW8A 1L8XA 1NYTA 3ZGYA 4CNBA 4MW4A 3ZWPA 4B4KA 4DPMA 2GEFA 3HXPA 1LGYA 5JQGA 3SEZA 1ZU4A 5H1YA 3NOQA 1JMVA 2I87A 2IEAA 3EEBA 3ESXA 4H6XA 4CQLA 2XHEA 4PYQA 4IO0A 1JIJA 1WXDA 4E15A 3JAWB 1HQKA 1IJFA 2MYTA 3R3YA 5EJ6A 1YR8A 2XNCA 3RTEA 3FUXA 4NWIA 1NRJB 1ZHFA 5EKDA 1CXZA 3RASA 2FX2A 1FE8A 1XCBA 5E4JA 2RE8A 1UBKS 3SXJA 4BDTA 4CR6A 4TVSA 1QYRA 4EFNA 3C24A 5BV7A 1P5JA 2PIAA 3OP4A 1Z56C 4ZYLA 3D3KA 1L7MA 1ZVJA 2VSXA 4OFXA 4I1YA 3L5KA 1NC1A 2H00A 3MWEA 1Y8ZA 1ST2A 1LRJA 3ELWA 5JCJD 3K70D 3P2EA 2AFIB 1JSLA 4WZAE 1CVIA 4M88A 4Q00A 1MOZA 4GL4A 2PMEA 3EGVA 3OTQA 3HYCA 2WJWA 4LSGA 1D6JA 4UQLA 2H6EA 3W3AH 2L18A 4C6RA 3FR8A 4ZALA 5FWXB 1JTEA 2ORVA 4FSXA 3K9BA 5FB3A 4P4TA 4HDCA 3C8ZA 1D8AA 3GPDG 2OVFA 3R3XA 4G1BA 2X4IA 3RQSA 3N2ZB 2QXTA 3D8SA 5EEHA 4ZU6X 3PC2A 2ID7A 2LP4Y 2P2SA 2ISCA 1IM5A 1H8HA 4CEJA 3AILA 4J0IA 4QA9A 3ESRA 4CTKA 4KVAA 3PJRA 3DE0X 4FFDA 3AF1A 1Y98A 3O4RA 4MWZA 4EQ6A 3TRIA 1GZHB 4BHTA 3OJ0A 3OECA 4CT5A 3FYHA 1S7GA 3DLCA 4R9NA 1SOMA 3QFFA 1YCHA 4LHYA 4AI6A 1MN6A 2QRQA 3N8NA 5CA0F 3DYVA 4RO0A 4DXHA 1HT1E 2HEVR 4MW7A 3RIGA 1JAZA 1XYVA 1CJSA 3Q2OA 3WDKA 2IY8A 2D74A 2N47A 2P5TB 3UNXA 2A9OA 2QSZA 5GQSA 1QCYA 2QT9A 3DP7A 1SBYA 3VTZA 2HMTA 2OO5C 4JELA 2J08A 5AK0A 5A2QA 4F3NA 1OC4A 1Y6ZA 1O03A 2AFVA 3B6KA 4J3FA 1IYZA 4UBLA 5DRYA 4BWFB 2AMFA 3SS7X 3L7KA 2OUIA 3WGVA 1C9NA 3QEMA 1U3CA 1ZQ1A 3R7FA 2G1JA 3LZ6A 4MV9A 4B3CA 2QQFA 1Q50A 2OAQ1 3KDPA 4IV8A 4PNZA 5IBQA 4KXXA 1G18A 1C9DB 4X8HA 5MF6A 3U62A 1J56A 3FDJA 2Q8NA 3CLUC 3P4YA 4L78A 4JYAB 1E5LA 3LIPA 3K0AB 1BHSA 1L4BA 1L3IA 1T4CB 4HNVA 2C9OA 1NN5A 3KV1A 1JHZA 2Y71A 1BQEA 2IS6A 3OTGA 4P3NA 1UBCA 3KYCA 3WA6A 2NPIA 5PNTA 4HNRA 2IBTA 1OFUA 1U2GC 2WUWE 2EKLA 3ZU3A 3PQ5A 2PTHA 121PA 1H6BA 4EG4A 3E2PA 3O95A 3I2IA 1XXHB 3T9AA 4CF5A 3NBUA 4DUGA 2R7KA 1X1SA 3HJTA 5H3CA 5C37A 1T2UA 4Y1RB 4N48A 2YASA 2PZEA 5JSZB 2BBTA 4IKEA 4DQDA 3H3XA 4M0KA 3RJZA 3RUIA 3UMVA 2ZDGA 1IBCA 2XDWA 4TTRA 1M7BA 2Q2VA 1WL8A 2WJPA 1QQTA 2PK3A 2W2MA 1N8SA 2YHSA 5CAEB 1YRLA 1PGOA 1LJUA 3MRVA 2AG5A 3Q7IA 4FFNA 1K63A 1IBRA 3HPQA 4JWTA 3OU2A 5AK5A 2DF8A 4R2XA 5F35A 1QIMA 2GD2A 2DPHA 1IN4A 4K9OA 4TPKA 2I7CA 2ZJ3A 5KVSA 1ES9A 1C7ZA 4KOEC 3VVBA 4CHGA 4R1SA 4J6EA 1MLDA 1BVUA 1GKKA 1RCTE 1U0OC 3IQHX 1FDSA 1NBMA 4M9UA 1T0IA 3N0XA 4ZPJA 1BYIA 2YOHA 4OHXA 3SHFA 5DJ5A 4ZAZA 4DG5A 1TQHA 4BVEA 1CJTC 1WA5A 2WM3A 3AEUA 1B41A 2WOJA 3WGLA 5A9SB 1SXJD 3L79A 3PU6A 2FEWB 3MWDA 2XMRA 5FWAA 5JAMA 4PQYA 4CTOA 2R25B 3EFOA 3U3PA 3AFIA 3MLBA 3PCTA 4HYTA 1RHRA 3HEMA 1QIEA 3T1YB 3PNQA 1S7CA 1UM8A 1NM5C 2PLAA 2O8CA 1FDWA 3RQIA 4PCAA 2AN4A 1Z2NX 4OHFA 2H51A 1NVUQ 3FROA 1GA1A 3BQ9A 1T8PA 3FDIA 4MICA 3AF3A 4TKZA 5C3MA 1RFLA 1WDLA 4L4SA 4V39A 4LDPA 4ZT4A 1R0XA 4KR7A 2XQIA 2XA1A 13PKA 1SJ9A 1YQWA 4OQFA 3I04A 1P33A 2FN9A 2ZE6A 3PGMA 2OLJA 4J8PA 2R8ZA 4KWHA 5EXPA 1R8SA 2FW9A 1W1UA 5JWRA 3JQRA 4G25A 5CITA 1FEZA 2ZRDA 1NQVA 2BD0A 4H08A 4O08A 3KKLA 1RXVA 3K2EA 2XT6A 5ICCA 1BWQA 1N8TA 2ZPAA 4ZV9A 1SMKA 1U7PA 3GT4A 4QDTA 3V7NA 1NPTO 4LF8B 3DYBA 1X1RA 2BHSA 2HHLA 3T4PA 3ZWWA 1E2JA 2ZBFA 2RIPA 1ZSVA 3VNVA 4LECA 2NSHA 3LJKA 3LW7A 1IN7A 1XZBA 2FZLA 4GMGA 3K53A 5AI5A 3GD5A 3ZDBA 4QT4A 1FQKA 1G9TA 2H9YA 4RD4A 1FXWA 3O84A 1GILA 3DV0A 4KP7A 3GJXC 4DQLA 3SM3A 1H2EA 1E1CA 1Q16A 1Z38A 3FSGD 5AHOA 2V7UA 4H7FA 4MHOA 2W5UA 4U2FA 1P6XA 2F62A 1X8JA 4TKLA 3V4OA 1E2DA 4L9RA 3I6QA 4UAJA 3WK6A 3IP3A 4WZ6A 1E7YA 5LQKA 4RSGA 1BGXT 2MSDB 3PHIA 3SJCA 2WD7A 3QBJA 4J90A 4Q18A 1E3DA 4UQPA 1SA0B 4F5DA 1Z8NA 3WYNA 2D62A 4UE3S 3OOHA 1Q1NA 1Q15A 1MPXA 3NHZA 2FQ1A 2D5LA 1S3IA 4GXNA 4I2NA 4AO6A 2RB5A 1TPYA 2HRQA 2IBSA 5BMVA 2GBLC 4LGCA 2D1SA 2I62A 3QVWA 1CJKC 2NQ2C 3KUDA 4JBHA 1XRMA 3U3XA 3DDOA 1ISSA 1G66A 3KEMA 5EE3A 3HVKA 3BN3A 1FSSA 3AI2A 4DV4B 4RZ3A 4KW7A 5L3RA 2FPIA 4LXXA 1Q3KA 1QORA 2B20A 2PZKA 2R6R1 4RJ2A 2GD6A 2IL1A 1P7VA 3S27A 5I7EA 5EXDA 2V1XA 3KBOA 1TA4A 1K3FA 3X1KA 1T1IA 2PSFA 2KQUA 4LSZA 4F2PA 3TUJC 1LX6A 1CR0A 3H75A 1W35A 1NR5A 2HDWA 2Q5OA 2AOWA 5KNDH 4YYZA 3BPSA 2C5AA 1XJWA 4R9RA 3AQ4A 1PR9A 5DEOA 3HJBA 3ZU2A 1M2EA 1VIDA 5A62A 1TK2A 4F84A 1R8QA 3UKDA 1G0NA 5CJJA 2WC1A 4O25A 3PR2B 4TWJA 2FG5A 3IE1A 5TIIA 1QP7A 2OZEA 2GERA 3F9CA 4D3ZA 4PSAA 2VJQA 2W8ZA 4RA6A 2BKXA 1R4MB 2WSMA 1SG9A 2NUBA 2X19A 3DOIA 2SNIE 3OZUA 4P4GA 1KRXA 2XRZA 2FUEA 5LB2A 1JBEA 5A9RA 5HZHA 1MQ8B 1OLXB 1Q1EA 1H85A 2PMFA 1T5HX 5CX1A 1PGPA 1XTIA 1NMSA 3FYUC 5BSGA 5GZ3A 1CUGA 2I1WA 3HYLA 5L3SA 3H2HA 4CLEA 2ZJ4A 1O6FA 4TMVA 3DL4A 4FEAA 4YVFA 5C7IO 1VRWA 4WFKA 1V5FA 4CIYA 2CNOA 2D7DA 3L1VA 3K72B 3PUWA 2A1UA 3NMUF 3HUUA 2IYVA 3DHWC 1IXSB 3MQFA 1PZHA 4HDMB 4TRNA 2VXBA 2V7GA 1VMAA 3DFKA 4RZHA 1IUOA 1Y48E 4ZXFA 1TAGA 2ZIWB 3TZKA 3STTA 4MCAA 2BR3A 1ZI8A 1I01A 1W7AA