2EFCB

Ara7-gdp/atvps9a
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
165
structure length
165
Chain Sequence
SINAKLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLLDARKVTAEDAQTYAQENGLFFMETSAKTATNVKEIFYEIARRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 51
structure length 165
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2efcB00
1MABA 3GD7A 3OEED 3AF3A 3TSOA 4B43A 1KMHB 2QRNA 1W5TA 1I4LD 3FFBA 4IFBA 5AK0A 1XTQA 5KSYA 3QY0A 1ZBDA 4YXWD 2QT1A 4RFSA 3TMKA 4WVFA 5BN3A 3NC0C 4G5GA 1OXSC 2MSDB 3KUCA 3QNUA 1ZM4A 3X1YA 2RGBA 1IXSB 3GEEA 2QMUA 4RZXA 3IIJA 1P9WA 1Q0UA 3AGPA 1R6BX 5L3QA 4FI3C 3PJRA 1KDRA 5LB4A 1IY0A 2GNOA 4FCVA 3QXSA 5JCZA 1AKEA 1LFDB 4TSFD 4CVNA 2F9LA 2ZSAA 2ZI4A 3B6EA 3MFYA 1DEKA 4IKEA 2O5VA 5TXGA 4QJ3A 5KDDA 4MGIR 2ZYVX 4TLAA 1GL6A 4PAOA 1XDBA 1VCNA 1NY5A 2N1BA 5IK2D 1OLOA 1XRJA 5L3QB 4B6EA 1GILA 4FIDA 2OSBA 5GJVC 4B74A 2VHTA 5FOVA 1FW6A 1VMAA 1TADA 1KGDA 4NYMR 1G8HA 1G6HA 3CF0A 1ZU4A 2DPXA 2K5UA 1P4SA 3DZDA 5BQ5A 4E07A 2GAOA 1ZC4A 4PZYA 1GG2A 5EUQB 4KYIB 1RIFA 1GKYA 5C4MA 2PT7A 4A0FA 2C2HA 1C1YA 2BBTA 5TVKA 2AWOA 5JSZB 3E5HA 1P7CA 3U7GA 3GLHE 5BN5A 2AHOA 4C0HA 5J5CA 1YR8A 1TUEA 5EXPA 1O3YA 3BRWD 1W0JA 3DEFA 2V8OA 5JHHB 1XEWY 4JYBA 1CS4C 4DCNA 2H8KA 2EFDB 3KFXA 4DLVA 4EPYA 3LLUA 4JJZA 4ACAA 5JJIA 4TMVA 3VFDA 1G3UA 2CLSA 2ZRBA 1M7GA 2F55A 4PC3A 3KKOA 3K0AA 4Q48A 2GAAA 3GMTA 4R7ZA 2CLCX 2EVWX 2GK6A 3QBTA 5DYIA 2UVQA 1CJMA 2QGZA 2JATA 2GBLC 4I81A 2YWHA 1M8PA 5KSPA 3O8BA 4W5JA 4YLGA 4W7SA 4N0EA 3CPJB 3UKDA 3ZH9B 4BFVA 3WHKA 3BE4A 4Q7JB 1RRPA 2GDJA 3K0AB 1N6IA 1E2EA 2PEYA 2OCPA 2J1LA 4OHXA 2DBYA 4H1UA 4LHVA 4N1AA 5JMTA 2O8CA 2QTFA 4WAUA 2HJGA 2FA9A 2CCKA 4MYTA 5G3YA 3ND9A 5HCNA 4Q1FA 1R8QA 1KDPA 2GILA 1KK2A 2DB3A 1LTQA 1LB1B 4RZ2A 1CLUA 1XZQA 1UPTA 4BEJA 1Z6GA 3LWNA 4I1OA 2GCNA 2I4IA 5DLQC 4B3BA 5FFMA 1RFLA 2WJYA 1ZIOA 3ASYA 4TYPA 3SQXA 4WIAA 4JL5A 4Q01A 1ZNXA 1QHIA 4XWKA 3UK6A 2B92A 4N0DA 1E99A 3W5JA 1DAFA 3RRYA 3W8RA 4KAXA 4ABYA 4EAQA 1KI4A 4R2IA 4U7DA 1YRAA 5FTJA 3KB2A 3DDCA 1US8B 3JZAA 1EESA 1CJTC 2VBCA 1Z6XA 2Z5FA 4FMCF 2FFHA 2ZTSA 1JQLB 1MT0A 4W5HA 5HKKD 4PSAA 1KKLA 4C7OB 4C9BA 1JR3D 4M9XA 3X1WA 1MO6A 2EWWA 1GRRA 1KI9A 3IIKA 3U3KA 3CO5A 4RFSB 1R0XA 5KSZA 5CITA 4W5WA 5KTYA 2NTYC 2GCOB 5A4JA 5CK4A 3K70C 2H16A 2WSSA 4IOMA 2QE7A 2ZETA 5KDOA 2FV8A 4FWIB 3I8SA 4A8JC 4BFUA 2ZI7A 5JFGA 3SJBA 3QKSB 4WZBE 2FPMA 3AVWA 5GVRA 5BW8A 1YR6A 2EFEB 3WYFA 1LS6A 821PA 2J7PA 2DFLA 5CB8A 5LB2A 2IYYA 4D80A 4IXNA 1PZNA 2KE5A 1TPZA 2AFHE 4GFDA 2FEMA 3K1JA 4QGGA 5FOUA 1FOEB 4QG7A 3TR5A 2RGNA 4JSTA 3HWSA 3TQCA 3CNOA 3GJ0A 5FH9A 5FPYA 5BYJA 1ESNA 4X8MA 2PMDA 3QI2A 3TW4A 4DCSA 2QT0A 2BDTA 5JCPA 3NBYC 4TLBA 1XMSA 3U3OA 2X19A 3DL0A 3AVUA 1OH5A 3LBIA 4TN1A 3MMPA 2DHRA 2ZJ2A 2YYZA 5FTNA 3PVSA 4EFMA 2PL3A 2FDCA 3DKVA 5LPNA 1BIFA 3EPHA 5SZIA 3WP1B 2G83A 1OKKD 3AH8A 1O87A 1KOFA 1ZD8A 2IXEA 1E1RA 5DIFA 2V7QA 1BH2A 2ZR0A 4QL3A 5B57C 1HQCA 2PJZA 4BLPA 3MJRA 1NMXA 1Z6YA 2JJ2D 4M1MA 1IAQA 4ZPXA 4MYCA 4OI4A 3T15A 2BEJA 4A92A 3B2EA 4CT5A 1YZKA 1SVIA 4PHGA 2ZS7A 3NDPA 4GMDA 3CPHA 3I92A 1KO5A 2WKQA 3GLHA 4QJ5A 4XTCS 1OF1A 1A4RA 3KKMA 3VKGA 4HZUB 3KQHA 1NN1A 4KBGA 1YJ5A 1R7RA 4PC2A 4URUR 1W0KD 2FFQA 3FYHA 4AKGA 4M1KA 4TL8A 3W3AA 5IDVA 1SKQA 3GJ5A 2QM7A 1KO7A 3EWSA 3AGQA 4C30A 3W6PA 4RZ3A 1E94E 1ZD9A 1HY3A 3W5IA 5GJBA 2VP9A 3U7EB 3A36A 2BIFA 1NIPA 1XWIA 2GEUA 4RKEA 1E2DA 1YZLA 4M9ZA 1L8QA 1ZINA 4GL2A 1XCPA 3KQUA 2HYIC 3F5FA 3BORA 3RYTC 1FQJA 2WMOB 3U3JA 4KXFB 3O47A 3IPYA 2HEIA 3FMIA 4GMXA 4LYJA 2R6AA 1Z47A 1XP8A 1ZD1A 2O8FB 2QPOA 4YONB 2J45A 1GKUB 2XITA 3Q5EA 2W00A 4V02A 2C99A 1BOFA 2VP0A 1ZM7A 1M7BA 3H1TA 3KZ1E 4ILEA 1M74A 2PBRA 4DSTA 2HT1A 1S4QA 3HU2A 1EFHA 1KY2A 2OFWA 1S9DA 2VP5A 1EG7A 2VHUA 1Z07A 3K0FB 4FW9A 5G41A 2O52A 2Q3HA 1OXUA 2GKSA 4B47A 3IEVA 2CMKA 3TBKA 4B2LA 2ZE6A 3C15C 1U8YA 2CLDX 4DLTA 5SZJA 4U00A 4YMUA 3TSZA 3SI7A 2VL7A 2WBLC 1EGAA 3QKRA 2IYLD 3UWKA 4JBYA 2A5JA 3MLEA 2IXGA 4HI0E 3NIBA 4HAZA 4JKYA 5H1YA 4OQNA 2JJ1A 4BFSA 1JNYA 4HAUA 4LJ5A 1UKZA 2Q21A 5TDHA 5UKDA 3KUDA 2H57A 1IOZA 1QVRA 4LV8B 2XNSA 2D7CA 3A58B 3P27A 1DAIA 3LD9A 4OK3A 5AUOB 1HQYE 1QHXA 2GCOA 4NYJQ 3KQNA 1JI0A 1E9AA 4A0HA 1IN5A 3FKSA 3KXLA 2W6ID 3VTKA 1Q1EA 3NWJA 1KDTA 2VO1A 4NBSA 2YINC 1HURA 2YVUA 3LXXA 1X8KA 1PLLA 4TZ0A 3VR5A 1NJGA 1YZGA 1A5TA 4GI7A 4JIMA 1XPOA 4DB4A 2ZAOA 2FGKA 1YKSA 5E7IA 1KSHA 4L16A 2D3WA 1P2VA 1YZTA 3OZXA 4JL6A 4KSBA 1RKBA 3HP1A 1II0A 1XEXB 2JCSA 3DPUA 4D25A 1Z0FA 3OIUA 5KHOC 1V43A 3G0HA 3RHFA 4QFMA 4A82A 2FOLA 4DLZA 4QBIA 1NVUQ 2ZVPX 1OT3A 4MKGA 4LOAA 3C4JA 2VPPA 4DSNA 4V0ME 4TLCA 2ZE5A 2GVZC 4KFUA 1DO2A 3MRSA 1W2HA 2FN4A 4D0NA 1IY1A 5EE1A 3ZZTA 2B8TA 1NVXQ 1EX7A 3KTAB 4NCJA 2WWHA 4AG5A 2J59A 3I62A 2MMGA 5FBQB 1L7VC 1N0WA 3D8BA 1GRQA 4IOLA 5FPSA 5J4VA 1G5PA 4C2TA 3UXMA 3AP3A 1Q57A 5CDFE 4HLDA 2HXSA 1JB1A 3HU1A 3GLFB 2RH5A 4NPHA 3AKYA 1W36D 3B9PA 2G1KA 2ZRDA 4A9AA 4LBWA 3K09A 2J9RA 5SZKB 4RVCA 1T0HB 4TT3A 2HUPA 3LXRA 3NTUA 4TMZA 4M1OA 1F2TA 3VR6A 1R10A 3MCAA 4EPRA 3FTQA 1CIPA 3M0EA 4PFSA 5CM8B 2VA8A 4MH0R 1TEVA 1VG1A 4XVUA 2F6RA 2XGJA 3EAQA 4MRNA 2WICA 2CBZA 1CJUC 3LBNA 2V1UA 2W58A 4D4JA 1ZJ6A 1E2JA 1TMKA 5G53C 1QHSA 2A5YB 2CE2X 2QP3A 3CRQA 1X8JA 3HR8A 4M22A 4QHYA 4D81A 5FTLA 3MSXA 4ZDIA 3X2SA 3RVBA 3EZ6A 1FP7A 2GZAA 4E09A 1JXMA 2IT1A 2Z83A 4HDCA 3U44A 3QEJA 3W6NA 2FZLA 2JDIA 3U7HB 2J0VA 2Q3MA 4ZKEA 2WWIA 1DARA 5HKKA 1F2UB 3QVUA 4HSEA 3H4MA 2C9OA 3PFIA 4EPTA 2ZS8A 3GLGE 4ZDKA 1P2SA 1ZUHA 3CF6R 3SE0A 2GRJA 3FDIA 1UBEA 2BBOA 1XXHE 3KL4A 4P33A 1DPFA 4K81B 1YZNA 1Z6TA 2VSXA 2FZ4A 2AXPA 2ZR7A 1ZUIA 5AWFC 3AV0B 5EXTA 4KO8A 2CK3D 2VSFA 4DWJA 2ZIAA 2IYZA 2H18A 4UXHA 3SR0A 3B60A 2FSFA 5C18A 2IW3A 1LY1A 2WSSD 1P75A 3F0TA 1XD8A 1XB2A 4CRWB 4HAWA 4ON9A 4EQ6B 1ANKA 1M34E 5IRCD 1GAJA 4QM6A 1MH1A 5FOXA 2WWFA 1CR0A 4H9GA 3ZGXA 1U0JA 4DIEA 1N5JA 3IBYA 2KWIA 3ZVMA 1W7AA 4XJXA 1XTKA 2DWPA 3NG1A 2P2LA 2ODWA 1U9IC 3SEAA 1TQ2A 3KKPA 5B58C 1Y3AA 3CRMA 1IY2A 3ECCA 3IUYA 4V03A 3AVXA 3IQXA 2CEAA 1F5NA 4LGMA 4I1VA 2D2FA 3N2IA 4S2EA 2C78A 4BWYA 2QGNA 5FUYA 3MJHA 3AVPA 5B2ZA 1Q1BA 4IDHA 2CDNA 3B1YA 2WJVA 4PSKA 4Q7LA 4A2WA 4FMCB 3IQWA 5F9HA 2I1VB 3SYKA 3A37A 3LA6A 1JBKA 2EFGA 3TR0A 4Z1MA 1NVVQ 4UJ3A 3U6BA 2ERYA 1LNZA 1CU1A 1KNQA 2GESA 2IWRA 3VKWA 1G291 3OE7D 3HYRA 1OV4A 1HT1E 3GFTA 1Q22A 1SXJA 1VCIA 3GJ6A 2HF9A 4GP7A 3SDZA 1QG4A 2ZJ5A 1UKEA 4RKFA 2BMJA 1T5LA 1BO6A 2RGXA 4PC1A 3N70A 5F2EA 5FL3A 1U90A 4ACBA 4A0GA 1NG9A 4EPVA 3B85A 4JS0A 4G5QA 2A9KA 3NBXX 4OKSA 1E9SA 2B7BA 2X1VA 2AD1A 1RRGA 8OHMA 4L9SA 3NH6A 1N3BA 1W49A 2CVHA 3N2EA 4DUGD 5KUTA 4UNPA 1G3IA 3TAUA 3ND8A 4YXWA 3D6TB 4HLCA 1J70A 1WE2A 3CUEF 4Q21A 1VHTA 2A5FA 2R8RA 3I73A 3GLIB 3DOEA 4NHOA 3SYLA 1UAAA 1D8TA 1N6NA 1XX6A 4JBWA 1YE8A 1Z0IA 3CX6A 3L0SA 3OIYA 2ZUBA 2WWXA 3ZQ6A 4DT1A 2EYUA 4PZLA 2P3SA 5M04A 3UMRA 5C2JB 1DAHA 5TV2A 3NDBB 4PZZA 5EE9A 3A6PC 1NN3A 2DYKA 2ZEJA 1OHHA 3B78A 2QTHA 4BFXA 4LZZA 1S8FA 1KJYA 4DC9A 2OV2A 3T61A 1P2UA 4DJTA 3CBQA 4V0KA 1EFCA 1YRBA 4DRZA 1NKSA 4BPBA 2FEOA 3R20A 1P72A 1XXHA 3R7WA 4LYFA 1S2MA 2VQSA 4CF7A 4BGDA 3N5CA 1OIXA 2DR3A 1HV8A 3MAAC 1P6XA 4HEJA 3ZLJA 1K8RA 5FTKA 2ZJBA 1OFUX 5GJCA 3CH5A 5JLJA 2RMKA 4TLEA 2J5XA 1E96A 3EZ2A 1WP9A 2AR7A 1NBMD 3QENA 2L0XA 4LC0A 3ZVLA 1W4AA 2NO1A 2DWOA 5FBRB 1JJ7A 4LJYA 3EC2A 3AKDA 1A7JA 2IK8A 2WVJA 1AZSC 2WM9B 2WV9A 2ZROA 4Q4HB 3TNFA 4C0KA 1AS0A 4Y0VA 3TVTA 3PUVA 4KFTA 3CX8A 4M1WA 4EPXA 5TY0A 2W2TA 3K53A 1N6HA 5CLQA 3SNHA 1E9DA 5GVSA 1WF3A 3O8DA 1BYIA 5C1BA 2ZJYA 4LUCA 1SKYB 1P62B 3T12A 2P5SA 2P6UA 2Q9BA 4PQYA 1XBTA 2WZQA 1EFUA 2WMNB 3KJIA 4AK9A 2YC4C 2ZQ5A 3FHOA 3GLHB 3NBZC 1PLKA 4FMDF 4OYHA 5HTKA 2RB4A 3GFOA 5ANRB 3DO6A 3QXCA 4S35A 1TF7A 3GQBA 1EWRA 2J0UA 3THOA 2VP2A 1M7HA 2BVNA 5AUPB 5FUWA 2XZPA 4M1SA 3GLGB 2J46A 4PO1A 4P4SB 2F9MA 1KKMA 4YDHB 3ZS8A 4FD2A 4W9MC 1N2CE 1MO5A 3VHLB 2V4ZA 3AP2A 1E79A 3FVQA 2QM8A 2V7QD 2W2VA 1FFHA 4LJ7A 3X1DA 2PLFA 4LBVA 1JR3A 2JLZA 2OCAA 4P31A 4Q7MB 4BRWA 3Q72A 3NXSA 3W90A 3WHLA 1HE8B 4ZIRA 1FQKA 1AN0A 2A30A 2YWFA 4AKIA 3BH6A 4OQLA 3C7KA 3EZ9A 2HXYA 1Q21A 3RS7A 4B35A 4NYIQ 1EFRD 1TNDA 2QE7D 3QXHA 1IN4A 1VKJA 1N6OA 1SGWA 4Z8YA 3EPLA 3FE2A 4WA7A 1NVVR 1SVSA 2ZE7A 4R2HA 4Q47A 1NG1A 1YVDA 2ZJAA 2OO7A 1E9RA 5JEEA 3OIVA 3OIWA 3EZFA 2ERXA 4NONA 4MUBA 4AYTA 1DADA 1OXVA 4P0TA 2JJ8A 3EIEA 4RCYA 1R0ZA 3QIAA 4PANA 4YMSA 1II8B 3EIHA 4TMXA 1XEFA 2WJGA 4DLXA 1YZQA 1Z6AA 2ZI6A 3WRXC 5BWMA 1OIWA 1U2RA 5CB6A 1F60A 4U5XA 2BCJQ 1QHNA 2QAGB 4K46A 5BYKA 3HR7A 3TJZA 1WA5A 2CL0X 1KMQA 4AKEA 4Q03A 2C5LA 4DXAA 2XXAB 1TAGA 2IL1A 5CYOA 5AJWA 2REBA 4LJ8A 4OI2A 5A5GA 2GETA 4JLNA 3ZVRA 2KJQA 3M4YA 2PZEA 1D9XA 2EYQA 4XVQA 4CZ2A 4JVSB 2OT3B 1NLZA 3EW9A 1UBGA 2OXRA 2WJJA 4MYUA 4WOPA 4X8OA 1JPNA 3B9QA 3K9HA 3TH5A 3TRFA 2FE4A 3B1ZA 4GP6A 4EFNA 1KI7A 5G40A 3WBKA 2ECKA 3RRMA 1GRNA 1GWNA 2J7KA 3GLIE 5K8IA 3TK1A 4PPGA 3SN6A 2ODEA 5KNCA 4LCBA 1SZPA 4C3ZA 3GPLA 2BKUA 1EXMA 3NH9A 1VG8A 3AP1A 4KJZA 5E7JA 1TUIA 5FL7A 2N42A 1E2KA 3L0IB 2GVDC 1JXOA 1KY3A 3OEHA 4KODA 2VH5R 1KI1A 4QBFA 4FCWA 1SVMA 4IVQA 1EFRA 3U61B 4XSHA 1BS1A 1RRFA 1E2FA 1QHYA 3D7MA 5JBQA 2JLWA 1NP6A 3IHWA 5FBVB 3QE0A 4WBSA 2GXUA 2V6IA 1GITA 3ZD6A 3RS5A 3THWB 3K09C 1G41A 1E0JA 1J99A 1ELOA 3SFVA 3EXAA 5HZHA 3TE6A 3TIFA 1T8UA 4RSGA 5JECA 1KTVA 3BS4A 2OG2A 3U2QA 1U0HC 3VNVA 2F1HA 1D2EA 1XMVA 4HAYA 3HYTA 5EE5B 2D7DA 5CIWA 4DLWA 4US2R 2YWGA 3GLFA 4DBLC 5JJKA 4CT4B 3OFNA 5CM9C 1Z2AA 2ATVA 2J3EA 3QKTA 4DDUA 3U7FB 2ZSEA 2QA5A 4LI0A 3T34A 4M9QA 4O0MA 5FI0B 3PEVA 1H65A 2VIIA 3B1WA 1QVAA 1CR4A 2QMEA 2Z0MA 4D0GA 4G5OA 3SJAA 2GBLA 5DYGA 1E9EA 1T0JB 3W8NA 1UBCA 4MGYR 2DWQA 3Q7PA 5H68A 2YC2C 4JVNA 3CF2A 4PQRA 3LX5A 4OQXA 3ICEA 4D0LB 2UKDA 3F3YA 1AM4D 2FG5A 1WQ1R 4GZLA 4D82A 2ZRIA 3RSOA 4NU0A 1CKEA 4XTRA 4Z54A 4Q00A 4ZO4A 2XTNA 1KYIA 3AVVA 1OKKA 2GF9A 2WPDD 2CNWA 3P4YA 4HB3A 2PX3A 1BMFA 2D2EA 5CLLA 4E22A 2JLQA 2LKDA 5H70A 5E7MA 2YKGA 3IILA 1VHLA 3DZ8A 4EFLA 2VHJA 4JLPA 1Z29A 3KKQA 3QF7A 4TL6A 1CJKC 3L0PA 5EJEA 4JJKA 2VHQA 1G4AE 221PA 2YWEA 2QBYB 2XEXA 1ETUA 4ASUD 4LJAA 1GSIA 4KVAA 4BECA 3AUYA 3WXMA 2ATXA 4OL0A 2QSYA 2IF0A 4V0LA 1J7KA 3W3ZB 1E2IA 4GZMA 4XD7A 3WNBA 2AFIE 3PIRA 2O0KA 2QTVB 1MOZA 2CXXA 2NPFA 2XJ4A 4HUTA 5LD2C 1DAMA 1S1MA 1Y63A 4GOJA 2JA1A 4TTRA 4UJ5A 2QQEA 4UKDA 4JMPA 1E1QD 4G01B 4GBMA 1NY6A 1KSGA 1DO0A 5CJPA 2C98A 4B44A 3THYB 2QAGA 3CLVA 4OHYA 4PPNA 1G21E 3W34A 3UPUA 1VIAA 4Q9HA 3A4NA 1SXJD 2QPAA 4PPQA 1E0KA 2XJ9A 4KSCA 5EP1A 4AWXA 3UATA 1ZAKA 2ZANA 4OJKA 1SVOA 2IUSA 5EP4A 4LV6A 1IJFA 2P6RA 3CPEA 3K0EA 4LX0A 3Q85A 1CJVC 1FP6A 1FPMA 2IHYA 4NDZA 1E2MA 4LY6A 1W36B 1RVDA 1OFHA 2QUZA 1W4RA 2ZPTX 2ZR9A 1KI8A 4LYAA 4Q9JA 3Q9LA 4A2PA 2O8DA 4TQUS 3EG5A 121PA 2ODBA 4FMBB 4CEHA 3PV0A 1RRCA 2PZFA 3V4RA 1AS2A 2G77B 5FPHA 5GJWC 4URYR 1H8HA 3QJYA 1SXJB 1P9RA 1T5IA 4RD4A 4PHFA 1Z8FA 4POAA 4P32A 1NRJB 2O0JA 2OBMA 1OSNA 4A6PA 1NN5A 5DHFA 2RCNA 4PSVA 3REFA 5JWOA 1ZNZA 1IQPA 2XOKD 2ZVQX 2VRWA 1CP2A 2ZRMA 1MO3A 2R65A 3ZS9A 5JZVA 4QGFA 2CHGA 1FTSA 1N0UA 4AURA 1Z2CA 4C0AC 4ZCIA 1D2NA 3K9LA 2QMHA 2MSCB 1AIPA 2YZ2A 1UKVY 4Q1BA 2WOOA 1N6LA 1NL3A 1DG3A 2CL6X 2HLDA 3S1AA 1JR3E 4O3MA 2O8EA 3PENA 1XMIA 1NLFA 3A1WA 5D3MA 1GFIA 3QG5A 1NJFA 2ZYWX 3T5DA 1VYTA 2PCJA 4ZCLA 2CJWA 1U99A 3DM5A 2IWHA 2CHVA 1HEIA 1D6JA 1QHGA 2F1JA 3FOZA 4TZ6A 1E9BA 1AQYA 2C8VA 3I61A 3TLXA 1F48A 1G8YA 1VPLA 4DLUA 4DSUA 2OAP1 4Z51A 1IM2A 1D9ZA 2IYXA 2R9VA 4QXAA 1XPUA 4A8JB 1D2MA 2ZUDA 2V6JA 3AF2A 2NQ2C 1E79D 1XTIA 5FPTA 1T3SA 2A5DA 4MYHA 1SQ5A 1N6KA 5HZKA 3THWA 3DKPA 4BLTA 2AKYA 2YHSA 4LWZA 4R98A 1TX4B 4JVLA 4F93B 1GZSA 1NSTA 1TQ6A 3CNLA 1W46A 2IC5A 2XAUA 3JVVA 2D62A 4CEIA 2IYWA 2EFHB 4JLMA 1DG1G 3BERA 1DAGA 1ZCBA 5EE0A 4HDOB 2KSQA 2GXQA 2A78A 3E70C 1ZYUA 2BWJA 2F7SA 4HDQB 4HUQA 4QNMA 4OI1A 3SU8A 3PXGA 4F4CA 4PAQA 4YMTA 4LSGA 2GEVA 3NEJA 5KSOA 3MUFA 3T5GA 2QAGC 1XPRA 1RZ3A 1S1CA 3R8FA 5EE3A 1N25A 4MRSA 2ZUCA 2ZE8A 5L3SA 1COWD 4DLSA 1KK0A 3QSYA 3FFAA 4YC7A 4IEIA 1U8AA 2I3BA 3H84A 1KJWA 2AKAB 2HLDD 1KI6A 4L4UA 1SXJC 2IUTA 2KI5A 4DCVA 2F3TA 1JQJC 3F8TA 5BXQC 3PR1A 4Q1DA 5JSZA 4TSFA 2ONKA 5HCIA 4HLUA 3WRYC 3WY9A 4KLZA 3B13B 5IF9A 3VAAA 4B3XA 5FR2A 2YOHA 4FWTA 1XD9A 4DEYA 2EW1A 2ORVA 3PUYA 2XB4A 1K6MA 3BB3A 2HJVA 2HYDA 4RD3A 3C5HA 4TQ9A 4M8NE 3EPKA 3CH4B 5EZ6B 3K8YA 3NKVA 4C0SA 2RGEA 2RKOA 2KBFA 2VTKA 4DLRA 1R5OA 3QG1A 2QEQA 1T9HA 4LC1A 4NCNA 1AKYA 1SHKA 1XD2A 4LV5B 4AYXA 4EJSC 1G17A 2BJWA 5AJVB 2ZJOA 2ZRLA 4NYIR 4KCGA 4IVRA 4LYHA 4EJSA 3ICQB 3DHWC 3OAAD 2ORWA 5TARA 1Z5ZA 2YV5A 4B2PA 2PJRA 3VR1A 4H1VA 3DMNA 4AC9A 1IN6A 2ZSDA 4ZIRB 5E95A 1XMJA 4CIDA 4A1FA 3GJ4A 1E4VA 2P6NA 1VCMA 2ONJA 5JRZA 2X77A 1B23P 5LDDC 1N5KA 3MWKA 1WCV1 1AQUA 2JJ1D 1J90A 3A4MA 4M4SA 2FU5C 3FMOB 3RC3A 2OHFA 5JS7A 2BM1A 5KYKA 4Q19A 3DM9B 4F38A 1Z0JA 1XEWX 1UEIA 4NMMA 2XNDA 2WWGA 4BLSA 3ZD7A 3BH0A 1R2QA 2N46A 4TMTA 4ZI3A 1KAOA 3KKNA 2PX0A 3I3SR 3NBFA 3KQKA 5B30A 1ZU5A 4JBXA 3BJIC 1J8MF 2X2EA 4TTPA 3CZPA 1E1QA 1K5GA 3HDTA 5EP2A 3L2OB 2IF2A 2RHDA 1KK1A 5DE3A 1IONA 2ZS9A 4AG6A 1T8TA 1CBUA 4CEHB 2O8EB 3TQFA 4M21A 2OZEA 4TMWA 5ELXA 2ASEA 3VX4A 2W0MA 1T91A 5K8UA 2WWYA 4U02A 3AKCA 4IDNA 1AGPA 2QP4A 3PG5A 4BZPA 3RRNA 1G18A 2HCJB 4TLDA 2O8BB 4WXRA 3KJGA 4A6XA 1C9KA 3LQQA 5FI1B 5HR5A 4A4DA 1JPJA 2R62A 1XZPA 2RGGA 3OAAA 2G9NA 3AEZA 5DI3A 4TTQA 3OEHD 1TU3A 1L4YA 4NCIA 2O8BA 5KOYA 1UKYA 1Z06A 3S1AB 2UZ3A 3IO5A 1Z3IX 2YJTD 2VLIA 3EPJA 1GIAA 1C4OA 1BKDR 4PHHA 1FMLA 2C95A 2R2AA 2JLSA 3AB3A 4IRUB 5D3MB 3R9WA 3UIEA 3I5XA 2QRZA 4WXPA 4FN5A 4URVR 2C77A 1OB5A 1G3RA 4RD6A 4B32A 1RJ9A 4P4UA 2IS2A 4QC2A 3ZYCA 3RWOA 1SKYE 2I1QA 2EFCB 2R6DA 1OYYA 3NC1C 3AKEA 4MKIA 3GP8A 2CK3A 1LVGA 1G7TA 1YZUA 2WJIA 4DEXA 2ZREA 5KPDA 4ASUA 2ANCA 1RE0A 2W83A 1EWQA 2PH1A 4BEBA 1L4UA 2OBLA 3MWLA 3LBHA 1G7SA 1RPZA 5KO2A 3PUZA 4PO9A 3AM1A 2G88A 1CR1A 3RS4A 4MGKR 4TL9A 4O2RA 3RSLA 4F4IA 2PMKA 4UXJA 3P1JA 1BMFD 1CTQA 5HE8A 4HB2A 3CWQA 3RANA 4FMDB 2QY9A 1RC8A 3BB1A 3ZZ0A 2QROA 4LHWA 2GJ8A 4MKFA 4EDHA 3SQWA 1HUQA 4HLQB 1RW4A 3CKLA 1Z28A 1Z0KA 1XCGB 1U8ZA 3IO3A 4ZDJA 1VYUA 1DOAA 3FHCB 1P5ZB 2F43A 1LW7A 4PO8A 1KI3A 2RGCA 1E2PA 2REXB 2D4HA 4ZKDA 4CDGA 5J4YA 1G8PA 4GOXA 1XJQA 4IDQA 1IJEA 3BAFA 1UEJA 3ADDA 1GL7A 3EZ7A 5L3SB 1ZIPA 4HAXA 2XSZA 5FUXA 1NMZA 4M1TA 4OBEA 4XD7D 2HT6A 3GJ7A 2C04A 3LW8A 4FCTA 3ZJYA 3ADBA 2A3RA 4DDWA 5HPYB 4ZV4A 1G6OA 3BXZA 4ESVA 1KNXA 4B3CA 5F98A 1F2TB 5C4GB 3O8CA 4OQFA 2XSZD 2XB2A 1Q3HA 4E03A 3DMDA 3LQRA 421PA 1KK3A 5L3VA 3K9GA 2ZI5A 4ZCMA 4OI0A 2FX3A 5DHAA 1FX0A 3GEHA 3U4QB 3TAHA 2BM0A 5FOTA 4Y0AA 4A15A 2NG1A 2F1IA 5DN6A 3H2YA 1V5WA 5IK2A 2IHBA 3RDPA 1II9A 1XJCA 1DAEA 1WDTA 2JEOA 3K0CA 4KV9A 1MO4A 2OM2A 2CCGA 3ZVNA 3MWJA 4BFYA 4CYMA 4L15A 1GKIA 3AVOA 3QPUA 4HZUA 1TU4A 1ZM9A 2AXNA 5LBIA 4ZI2A 1SVLA 4LBZA 5FTMA 2DFKB 4LJ9A 3K70D 4MQBA 2MSEB 2H92A 3K0FA 3SS8A 1N5LA 4JVMA 4IVPA 4AYWA 1E4YA 4Q9LA 1CULC 2A7QA 2C96A 4KFRA 3WMFA 1G8FA 3BH7A 1KSJA 1QZXA 4IHQA 1KO1A 2ZI9A 4C4PA 1QRAA 1UBFA 3TW8B 4OK6A 2BMFA 2WIBA 2WKPA 3SOPA 1U94A 4RD1A 4GPTA 1CR2A 2ZU6A 4HAVA 2D74A 1TF2A 3I8XA 4OHVA 1RYFA 3MD0A 1SHZA 1X8LA 3RS3A 1GP2A 5DISB 4CEJB 6Q21A 5H8WA 1XTJA 2IYUA 5IHPA 2FSGA 1HH4A 3NHAA 2CHQA 4PAMA 2AX4A 3KDSE 4D4KA 4Q1AA 1GVNB 3B5JA 4RJLA 3NVAA 4F92B 3CX7A 2ZRFA 4BRUA 1MRSA 4BLRA 2IYTA 4Q1EA 3PITA 3MGCA 4US1R 4CEJA 5JJLA 4JYCA 4LDJA 2HCBA 4IOKA 4DDVA 1WMSA 4L5BA 5JI2E 3VR2A 2QU8A 4LHXA 1SVWA 4DCUA 1G20E 1AZTA 3I72A 5DN6D 3QBVA 3G82C 4R71A 4TYNA 2ZRGA 3CWZA 2V3CC 3C14C 1VYVA 2WOJA 4US0R 5EXSA 2B6HA 2FWRA 1AA9A 2GTPA 1TL7C 2IYVA 2G6BA 2Q9CA 3QKSA 2NO9A 3CM0A 2J41A 3A1VA 5AUNB 4OQMA 3GFPA 2AK2A 2WIAA 2CJWB 4LRWA 2QZ4A 3HJNA 4QOSA 4P3YA 4ESHA 4HATA 3C16C 4IOJA 3A8TA 3THXA 5DSZA 4IEEA 1VG0B 3HPQA 2VF7A 3SJZA 1X6VA 4JZKA 2BCGY 1T3HA 3RWMB 5FR1A 2JLYA 2ZRNA 2IBMA 2P65A 2OESA 2GK7A 1Q20A 2UZIR 3EIQA 3KTAA 3L8ZA 3VU9B 3ETLA 2NZJA 4C0JA 1R8SA 4BUJA 2ZU0C 2HF8A 4MRRA 1ZM2A 4YDSA 1DTSA 1UADA 3BOSA 1NSFA 1PLJA 1ONBA 4KHZA 2AD5A 2QAJA 3BC1A 4XVRA 2QP9X 3ONWA 1KHTA 1OXXK 2CNWD 2H1LA 4G1UC 4CEIB 1Q12A 2ZRAA 2H7VA 4CW7A 2WSMA 3RRZA 5JRJA 4JLOA 4XIGS 4Q4LA 2WAYA 3GLIA 2V55B 1TTTA 1HYQA 3QVVA 5J4KA 4MRPA 4JLVA 4UXIA 3QXJA 4TYYA 1G16A 3OHMA 2IXFA 3VR4A 5EQTA 2PT5A 1NMYA 2H5EA 2OXCA 3B8HA 4I99A 5A0FA 3OF5A 3T1TA 3V9PA 5F9FA 2PZGA 2PCLA 2QMOA 1MR3F 3CZQA 4URWR 5CK5A 3JZMA 5FOWA 3B1XA 1OE0A 2YOFA 1PUJA 3IBGA 1J8YF 3VMFA 1E9FA 2XTZA 2B8WA 2GCPA 2R6CA 4E5UA 2IA5A 4B3DA 4ERNA 3O8RA 5FUVA 1KI6B 1OXTA 3GJ8A 2F43B 1ZW6A 3VNUA 1LF5A 4KI0A 1JEEA 2QORA 1F6BA 2D06A 2IS4A 3Q5DA 2FSHA 3X1ZA 4Q4AA 1YR9A 4B3FX 1E0AA 3T1VA 1GDDA 1PJRA 1S0UA 4B6FA 4HB4A 3R9XA 2VSOA 1OHHD 1E2GA 1YR7A 5FBWB 1R5BA 2J0UB 4Q4HA 2G0TA 4EIWA 1I4TD 3LRPA 2FPKA 5AJZA 4P4SA 1NIJA 2ZXUA 1G5TA 1G8GA 1QDEA 1U81A 1NNEA 1AS3A 4V0NA 4NE2A 3C8UA 2KBEA 4Q9IA 4KYUA 4EQ6A 1FX0B 3VX3A 3BGWA 2PLRA 1I2DA 1MV5A 5EXXA 3PEYA 3RABA 2B7CA 4G0NA 2XOKA 1GUAA 3BFVA 3FKQA 2NPIA 2GWHA 4BE7B 1Z08A 4PHTA 2BBWA 2IUUA 2ZJZA 3CONA 1NVWQ 4B3GA 5LD2B 1DELA 3BIFA 4PR0A 721PA 3VKHA 2QSZA 3A1TA 3E1SA 3L43A 4PPFA 3HU3A 4AKHA 1E32A 3OFND 4DKXA 2Q9AA 2R6FA 3B7GA 2RHMA 3QXXA 4IDPA 3UANA 2G0NA 3VHXA 4B75A 4RY2A 4NZYA 2O8FA 3EA5A 4RD2A 2GXAA 3WP0A 5AUQA 4DHEA 4DLYA 1W2GA 1II8A 5K8LA 1KIMA 1G19A 2WPDA 3ZIAA 4C2UA 1UM8A 1FZQA 2LKCA 2XZLA 4M2LA 1X1SA 4URZR 2ODNA 3IIMA 3AVYA 4KBFA 1B0UA 2FMXA 4ARZA 4N3NA 1L2TA 1T4GA 1G7CA 1W36C 2O8DB 1UDXA 3E2IA 1M1YE 5D3QA 2Q0HA 4Q4JA 2W6JD 1NBME 4NP6A 3CB4A 4PQFA 3MWYW 2FFAA 3THXB 1Z0DA 2GJ9A 1MRNA 2ANBA 4UNSA 5FL7D 1NBMA 5FPKA 1XTSA 1X3SA 5FBLB 2GXSA 4O2LA 3P20A 3OEEA 4JKIA 3CW2A 2FSIA 2ZSFA 1ZUNB 3L0OA 4MKHA 4KITB 4QBHA 3RS0A 2QENA 4Q4JB 4RCZA 1JAHA 1OFTA 2VEDA 1NLYA 2OE2A 1XFAA 1GM5A 2ZAMA 1IN8A 1AGRA 3DVLA 1JECA 1UJ2A 1WBDA 4CGZA 1Z83A 2JIZD 3L82B 3LDAA 2PEZA 4FINA 2BJVA 1P60A 4C7OA 4YMVA 1G3MA 3PUXA 2Z6VA 3Q3JB 4EKDA 1IXRC 4P4TA 3AF1A 4BZQA 2OUKA 1VECA 5J4LA 2JAQA 3C41J 4OHZA 3REGA 1ZNYA 2VHCA 5BN4A 2WWWA 2DY1A 4NL4H 3BBPA 1ODFA 2BC9A 1CEEA 1E2NA 3KJHA 1TQDA 2LWIA 1A82A 2AWNA 1IBRA 1XXHB 3R7WB 2DFNA 1TEXA 4WZ6A 5G3ZA 3L8YA 4B33A 1QF9A 2BEKA 3GJXC 1S9HA 2NZ8A 1N5IA 4Q9KA 1COWA 2ZM5A 3DOFA 4MDFA 1W44A 1G3QA 2H17A 4D4MA 1VCOA 4MA4A 1LV7A 5SZHB 4Q1CA 3ZIAD 3UG6A 4II7A 1YQTA 521PA 1E0SA 1ZP6A 2ZYUX 4DDTA 4G5SA 2G1JA 2E1RA 1U9IA 1VG9B 4DT1B 1CXZA 4M1YA 3WNCA 2NIPA 3J81k 2FGJA 1MABB 1G5RA 4MUAA 4PTLA 4HB0A 4X8HA 5L3RA 3W6OA 2WKRA 2ORIA 4XH9B 3ADCA 2BV3A 3V4FA 5J4HA 1A1VA 2P0EA 2WHXA 2QG6A 4Q4AB 2GJSA 3KFVA 2XX3A 4X8LA 1W4BA 1OH6A 1G1MA 3UMFA 1UF9A 3QOFA 4BFZA 3FPAA 4K8OA 1N6PA 5CIQA 4JLDA 3SYNA 4TYWA 4B2IA 2KB0A 3AUXA 3PEUA 3T06B 1F3OA 1UDWA 2ZRPA 4JLAA 4UNRA 1Z22A 4TQAA 4OJQA 4QJ4A 3UG7A 4WZAE 1JEDA 1KI2A 4FXPA 4DUGA 3LX8A 4GDFA 2NO7A 1KDOA 4I4LA 5JS8A 3EASA 4J0QA 2Z4SA 1R0YA 2JASA 4M0LA 3K0CC 4Q18A 2ZRJA 2BOVA 4DCTA 2HDNB 2ZSBA 3AF0A 1XCMA 2QQ0A 3UMSA 1EFTA 3PUWA 3PCRB 2OLJA 1XJ0A 3U44B 4LHZA 5P21A 2AK3A 2EQBA 3K9NA 4YMWA 3BFXA 1OYWA 1XU4A 1EX6A 1FTNA 2CVFA 3QUSA 2RAPA 3D3QA 1F2UA 2JDID 5IT5A 2OILA 3OE7A 4JLJA 4KFSA 2Y8EA 3BK7A 4NYMQ 2GZHA 2CCJA 2V9PA 1JJVA 4Q02A 3EA0A 5JHGB 4B76A 4HYYA 3T35A 1QBKC 1QHHA 1W47A 2P5TB 2W2XA 5CJ2A 3FB4A 3KX2A 3D31A 1N0VC 1LF0A 3A4LA 3AF4A 1E2HA 1KZ7B 3CRVA 3QKUA 4NTZA 2C9CA 5GADl 1UFQA 4C0QC 4BFTA 2IS1A 1ZM3A 2VP6A 3GLGA 4RD0A 2R44A 4DIDA 3U5ZB 1P61B 4DB2A 3C5CA 1H8HD 4QHSA 4G3XA 4JL8A 3T1OA 4HZIA 3IDQA 5KNDA 1GOTA 4OHWA 3RC8A 1ZRHA 3SC3A 4PXAA 5E4FA 1OFIA 2IEZA 3IPXA 5E3HA 1AJEA 3BB4A 4AY2A 2SHKA 3LVQE 4ZDWA 3QF4A 3ADKA 1K5DA 4G5RA 2JLUA 5JEDA 5TB5A 4EPWA 3M1IA 3BD9A 4QM7A 4QGHA 2QNRA 1GL9B 3AVTA 4BLOA 2MMCA 4V0MA 3U3RA 1E2QA 2JJ2A 4D6PA 1HE1C 4Q5IA 1I2MA 1VTKA 4QBGB 3I5YA 1W0KA 3TUIC 1SVKA 2JLXA 1KO8A 4WW0A 5K8TA 5KU1A 1DBSA 3KB1A 3R9IA 3GCGA 3I4LA 2J7PD 3B1VA 2Z4RA 2W6IA 1PVOA 1HA3A 1Z0AA 2C03A 2NO0A 2OFOA 3FKSD 1GNQA 4IFEA 4F91B 2OFXA 5CDFA 4D26A 4L9WA 1RYHA 2XNDD 4IJMA 5DI9A 2F3RA 1YHNA 3LVRE 3H86A 2OCBA 2C9YA 3JVUA 4NCHA 1CF4A 1G7RA 1DAKA 4I1SA 4IDOA 4Z1MD 2EU8A 621PA 5L8VA 4NH0A 5DH9A 3TSWA 3SFZA 3KXKA 1WB9A 2BHRA 2W0SA 5DI3B 3QEOA 4EUNA 2V1XA 1G64A 3LY5A 4GRAA 4HLUC 2JGNA 4B48A 1OH8A 2ZRCA 1E3MA 4XSGA 3KXIA 4L8GA 1XF9A 2Q3FA 2NO6A 3P26A 4BASA 1IXZA 2RGAA 5FOSA 1E1RD 1VDZA 2XTMA 3P4XA 3VU9A 3IKJA 1OIVA 2XZOA 3G5UA 1R0WA 5EP3A 3MG9A 2WAXA 1W0JD 4A36A 1WXQA 4ITRC 4JLBA 2IYRA 4XOIA 3LFUA 5JWHA 3TUJC 2BKEA 1DVRA 1FNMA 4BZXA 1S3SA 1SXJE 3IHLA 1A2KC 1KSFX 1DS6A 4NKRA 3VR3A 4OK5A 2GZDA 1CRQA 3WYGA 1KO4A 4DVGA 4Q7KA 1VIYA 2FNAA 1DE0A 1TF5A 2WTUA 3R8CA 2FJUA 3WBJA 1W48A 3EC1A 2NMVA 2Z43A 2RGNC 1W1WA 1Q1ZA 2IEYA 2QL6A 3I1FA 4C0LA 3WMEA 2VYFA 2YNMA 4TWZA 3UWOA 4DZZA 4KU4A 5KNBA 3RLFA 4B73A 3HPRA 4A8JA 2LCFA 4D4LA 3ASZA 3CRRA 1OH7A 1E98A 2ZITA 1FUKA 2OBNA 1I4DD 4MDEA 2OEPA 2E9SA 1OW3B 3Q8XB 4D2IA 2W6JA 5DGXA 3AQ4A 3U60B 5B64A 3TKLA 2Q6TA 2VP4A 1XNJA 3RNLA 3TGPA 3U6KA 2FPLA 3GJ3A 1KJZA 2IS6A 1Q44A 3W9YA 4GNKA 1PUIA 5J40A 1H8ED 2E87A 3WYAA 1KMHA 3NHBA 5C46F 1KZGB 1GTVA 2QI9C 4MITA 1CRPA 2QPTA 1E9CA 1R5NA 4Z8XA 3SHFA 2OLKA 2IYQA 3GLFE 4PX9A 3FMPB 1QHHB 3BFKA 1PV4A 4LPSA 4LBYA 4AI6A 1M6NA 3CNNA 5J47A 5KPJA 1OB2A 1IN7A 1U98A 4JLKA 5TMPA 3T1QA 1ZNWA 3GEIA 3SJCA 2AL7A 2G3YA 2ZYTX 3B82A 5DO9A 3EARA 4B71A 1KAGA 3LAWA 1ZCAA 3TVDA 2HV8A 1A2BA 4V0OA 4F4JA 1FNNA 4TT3D 3SBEA 2TMKA 1HTWA 4LHYA 1XD2B 4O25A 3PEWA 4A2QA 4GOKA 4KLNA 4LJ4A 4MRVA 4EJSB 2ZRHA 2X8AA 1SULA 3U4QA 4XWAA 1WRBA 3PQCA 1OPXA 3WNDA 1G9XA 4M53A 4B34A 4AD8A 4AIIA 4NYJR 4QNRA 2QBYA 3BWDD 1W5SA 1T3LA 4TMKA 1Z63A 1S96A 3TUZC 4C0BA 3K70B 2FF7A 4F7WA 1T6NA 3ZZUA 1NF3A 1P3JA 2ZJ8A 1YU9A 3FGNA 1G4UR 1JAIA 4DSOA 1ZMXA 3A1UA 5EZ5A 1JR6A 3IGFA 3NEYA 4RFVA 2J0QA 2VF8A 3QPVA 4I1UA 3SHWA 1AK2A 5JI3E 3M6AA 2B21A 2BBSA 2NGRA 2J0SA 1JALA 2BMEA 3VQTA 1D5CA 3RAPR 4XWOA 1GNRA 4JSYA 2R6GA 1N6RA 2V54A 3KJEA 3ZQJA 1E2LA 3FMFA 5AJYA 3H0KA 3V00A 1X86B 4QKQA 2O8CB 3QPWA 5JWRA 3ZDQA 3IEUA 3THYA 4ARZB 1FL9A 4UNNA 3LH5A 2F1RA 3A1SA 4PC7A 3FWYA 4BQSA 2A2ZA 1P9NA 2JLRA 2GJAA 1IHUA 1X1RA 1NI3A 3QF4B 5EUMA 3U3MA 2JIZA 2FFBA 3LLMA 2BMDA 1S3GA 2EWVA 2WJHA 2DCUA 2GA8A 3K0SA 1EK0A 1E6CA 2OAQ1 1FUUA 1M2OB 3CR7A 4GT1A 2NOAA 4QGAA 3LW7A 5KDLA 3QKRB 2O0HA 3OESA 4URXR 1E69A 1Q1QA 3I32A 1XTRA 5AR1A 1GNPA 4BLQA 1QG2A 3LV8A 2FH5B 2A5GA 1WBBA 4LK2A 5CYPA 4JT4A 5AJXA 1NKTA 2XXAA 2REOA 3P32A 2IX3A 1LS1A 2GHIA 2CL7X 3LO5A 4TL7A 3EWAA 5F3WB 3AVQA 4R9UC 1Q3TA 2OCYC 4A0RA 1US8A 4RZUA 3RS2A 4JT2A 4GSYA 2X2FA 2AN9A 4LPKA 5HE9A 2DFTA 4QRHA 2ZI3A 1R4AA 4LJ6A 2GJKA 4Q66C 3SBDA 2JLVA 2RGDA 4MGZR 3QQ5A 2QN6A 3SZRA 2P67A 1ZC3A 4M9SA 4KVGA 4TYQA 3WMGA 2ZRKA 4UNQA 5DNYB 1HT2E 1ESMA 3EX7C 2J87A 1H8EA 1MKYA 3CIOA 1RJ9B 3Q7QA 3X1XA 1U0LA 4UQOA 2GF0A 1XEXA 1ZVQA 2YOGA 1J2JA 2IYSA 2GEDA 3LNCA 4PC6A 4NCKA 4QHTA 2CE7A 3CRW1 1BYUA 1OJLA 3CR8A 1P2TA 1NN0A 4IW3B 4IXMA 1W4CA 4HUQB 1TQ4A 4BFWA 3FHTA 3KQLA 1P73A 4YQFA 1FMJA
chains in the Genus database with same CATH superfamily
2XCTB 2GS9A 5IVIA 5ICSA 4J29A 3AF3A 4FE4A 5DW0A 3RUAA 4B43A 1KMHB 3A4YA 3JQCA 3K1YA 3KHTA 4OXYA 1I4LD 3TLGB 3U40A 3VNSA 4GX0A 2VK8A 2ZYDA 1XTQA 3ZLVA 4H08A 1QFXA 1ZBDA 1C9YA 4RFSA 1MB2A 1QNLA 4HWTA 2JBAA 3TMKA 4PO3X 3GRCA 3L41A 1SOMA 4UVEA 1TVMA 2C82A 3QNUA 4KPFC 3L5OA 5T4BA 3D6MA 3NANA 5CH3A 3IAUA 3QELB 4JOQA 4RZQA 3NOXA 5ALNA 3R3YA 2FEXA 4MWTA 2JGLA 3I01A 2GNOA 3SD7A 4K6CA 3TQHA 1Y4ZA 2NZXA 2QDXA 1AKEA 3HXLA 1LFDB 5B4UA 1OLSA 5B2FA 2JBAB 2I4TA 3HCNA 1SQFA 1FSGA 2ETXA 3KAKA 5TXGA 1DEKA 2GHQA 2O5VA 1XN1A 2OXEA 1W88B 2ZTHA 1N8TA 2F64A 3CLUD 1EXDA 3GBSA 1YS7A 3MTEA 5ARDA 1IUNA 1GL6A 4TLAA 1NY5A 2N1BA 4FTWA 3FPCA 1E7QA 1PHRA 1PJTA 5DBFA 2C7BA 5IAGA 1GILA 4FIDA 2NZYA 4X20B 1MX9A 3NXKA 2IFTA 3I37X 2V58A 3L6DA 1KYXA 2OGTA 1CB7A 3DTYA 3JQFC 2I66A 2XMSA 2YMLA 4G5XA 4QPPA 1JG6A 4CLRA 5HKOA 4S1VA 2K5UA 4MCJA 4GQIA 1H2RS 1XZNA 4N49A 1QGUA 2ST1A 3RAJA 3E6AA 4E07A 2GAOA 3EEOA 1Y6JA 3N75A 1L4MA 4PZYA 1GG2A 2J6HA 5EUQB 4I4NA 1OFUA 3W6ZA 1IK6A 5C81A 4AQYB 3HTXA 3A3KA 1KZ1A 5C4MA 3F6SA 2IKSA 4UW9A 5BMVA 3R3ZA 3H9UA 1P2FA 5E4YA 4GXQA 2H2HA 2IOHA 3HACA 5EJIA 2AHOA 5ALZA 2M32A 4LVOA 3THSA 4C0HA 4YPVA 3KQMA 1YR8A 5NLLA 3ADOA 2Z2IA 3DVAA 5EWMA 5TF4A 3ROFA 1W0JA 4QDUA 2HFKA 4Q37A 1M0EA 1Z75A 2E55A 2GO1A 1QO9A 1F6DA 2H8KA 2HMUA 2Z1MA 3TMAA 1I01A 4DLVA 2O19A 1D6MA 4JJZA 3CEAA 1JQ5A 5ITZB 3AFIA 5I8PA 1P4JA 3V8RA 3R7FA 4AUEA 1G3UA 1P2GA 2CLSA 2Q50A 4ZI7F 5BMVB 3FMVA 3ROZA 1PZEA 2C2GA 3C3PA 3GT4A 4HDKA 4KACA 5L3ZA 4B6PA 4B81A 4BFCA 1MMFB 1J42A 3KKOA 3UGKA 2DE0X 1XC7A 4KVZA 1GRCA 4HXYA 4JUDX 3S3TA 3SQOA 1TK9A 3QBTA 1YV9A 4H15A 4JGBA 1IQ0A 1OTHA 2JATA 4QT0A 4EQZA 1EAYA 3LZ6A 2JZCA 3KJQA 4FFBB 2B2NA 1M6YA 1QMPA 2YWHA 3O95A 5C31A 5INTA 4W5JA 3GPIA 1P6UA 1UKBA 2A33A 4N0EA 4W7SA 4EUKA 4BFVA 3WHKA 1SUAA 4YT8A 3KLBA 3OQMA 3KTFA 5FAXA 3KOXA 4N8DA 3ZOZA 3GK3A 2XCQA 4Z7QB 2FYTA 4I3HA 3EDRA 4HV4A 2IXBA 3A32A 2NUPB 1LLQA 1V41E 3MQ4A 3BM5A 5JMTA 5KNBD 1X7ZB 2QTFA 3AB7A 3PE3A 2FA9A 2CCKA 2R8OA 4A2CA 4HFRA 4QXPA 4HEA1 3RU9A 3ND9A 2ETVA 1CE8B 2OV1A 2OXTA 1OQAA 5KOJA 2WHEA 2PUTA 2XMDA 4CLEA 2DB3A 3WJ1A 3OPQA 3KKLA 3LUGA 1MOQA 1QDUA 4LIPD 3A05A 4PGFA 4WNCA 2X1MA 4XIIA 5EKUA 1DQSA 1UPTA 2PVSA 3I6QA 3O8QA 4OGLA 4TKVA 5JBNA 5A3RA 3B3QA 5AVKA 1F2VA 2DX7A 3G9ZA 3L46A 2I4IA 1DXHA 1MQAA 2GBGA 2QV7A 5FFMA 4B3BA 1J0EA 4B9EA 3F67A 2WQZA 3ASYA 4AP6A 1DDOA 2TECE 2PG3A 4TYPA 3TLJA 3SQXA 4Q01A 4P36A 4W6ZA 4RTJA 1U0OC 1OZHA 2B92A 5KOJB 1W2WB 1DAFA 3V1NA 3W5JA 4M3NA 3GOHA 1BE8A 3GD5A 4BC1A 5JH7F 1KEWA 2X3YA 3GMDA 1KI4A 1LDYA 3OWXA 2EP5A 4FCCA 4R2IA 2H4YA 4K87A 4UUBA 4WASA 4U7DA 2BUBA 3FMGA 3W04A 5A2GA 5CAEA 1L4GA 3R5SA 2XWPA 2FAXA 5BVGA 1QP0A 2VBCA 4Z2YA 2Z5FA 4XYGA 3WAJA 5IJXA 1AF4A 4FMCF 4G97A 4DGQA 1KWKA 3K7EA 4CL0A 2I29A 4RETA 4W5HA 3NT2A 1K86A 4FFPA 3T3GA 4C2AA 1IVYA 7MDHA 1KKLA 3ITEA 4BMOB 1SC1A 3NDIA 3RM3A 1TAUA 2GB4A 3GGOA 1MO6A 1IEWA 1KI9A 2JB9A 2FSSA 3IIKA 3PQEA 2PMBA 4FGJA 1CY6A 1YJXA 4JCOA 3U3KA 3GJSA 5TJ9A 2RKBA 3ER6A 2RJOA 3TI7A 1QJ4A 1JX6A 2EKQA 2FUG6 5TPZA 4R3WA 3DTTA 2WY2D 4J1SA 1TKRA 1EVEA 3W9SA 2XECA 1DBVO 1UJMA 2JBWA 5L4LA 2VDPB 2H16A 3O4JA 2QE7A 4BY9E 4H7PA 4X1KA 3OLCX 4LHEA 1IPEA 2G1PA 2BH2A 2FV8A 1DJMA 2EKBA 2BM8A 2DUMA 3GRFA 4EG7A 4WZBE 4BDTA 3HA3A 5AT1A 2FPMA 3HUDA 1HC7A 4EVRA 2I6UA 1JIIA 2EFEB 5HUJA 3FZEA 821PA 1SVNA 2J7PA 2QKYA 4F3NA 1VFNA 1UC4B 5FULA 3KD3A 4LDNA 2Q7OE 4Z49A 3NNSA 4D80A 1ZHOA 4IXNA 3LLCA 4GF5A 3ZGNA 3TNDA 2ROQA 2H2WA 5I9MA 4J0DA 2QV0A 3U09A 2GTHA 1CF2O 2ODAA 5I3CA 2OORA 1SELA 2NUTA 1BVUA 1L3IA 4DRXB 4JSTA 3WX0A 3CNOA 4XJTA 5BYJA 5KKCA 1G21B 1ESNA 3BMOB 1E7YA 3EVAA 2A6PA 1BXKA 2QHXA 1VE9A 2QT0A 4NIMA 3KBOA 2Q5LA 1PG2A 1ZGHA 2BDTA 1WXXA 5JCPA 1NM5C 2ZIXB 2PMEA 2X19A 4HVAA 3AVUA 2WUVA 1IN1A 4UDYX 1EEHA 3I5UA 1XZEA 1THGA 3MMPA 4NHEA 2JGAA 4L73A 3ZI4A 1H2XA 3UG7A 5FNVF 4X6XA 1N7IA 4HDNA 1A8SA 3BMCA 1OKKD 3EQ2A 1G21A 4FJ2A 5E0KB 2VPYA 4U4AA 1ZD8A 4PZAA 3ZV5A 1UP6A 5KVSA 5DIFA 3SE7A 3KZNA 4QL3A 4L4RA 5K0GA 3U7JA 2PJZA 1TVCA 1U7PA 1NMXA 2JJ2D 3MJRA 3SSMA 3P45A 4ZPXA 3V97A 4BLPA 1E2BA 2H8GA 4A6EA 2V7BA 1I80A 1RKXA 1R27A 3BMCB 4KWIA 3D81A 3FNRA 1OWOA 1SVIA 3URMA 3FPBA 1I51A 3ESXA 4FBGA 4L1KA 1UIRA 2RHJA 4EUSA 2ZS7A 4G1EB 4L2IB 3JQGA 1NAHA 1H0HA 4U2FA 1DUIA 2E89A 1OF1A 1RBMA 3VSCA 1H69A 5EFZA 3VKGA 4HFJA 5H4GA 4BTLA 3CUTA 3JR7A 1NN1A 3D64A 1C14A 3EEBA 4CG2A 4EY8A 3WG9A 4Y6LA 1Y3DE 4JC0A 4TL8A 1E6KA 3P9PA 2BGWA 3SVLA 1JDBB 1KO7A 1BW9A 2WI8A 2C83A 4BP1A 1PFVA 1O6FA 4RZ3A 3VJMA 3WDLA 1ZD9A 4B8WA 3W5IA 4GGOA 4ZANA 1U5BA 4C6TB 3V1KA 1EHIA 2XV1A 3PF9A 1JWBB 1NIPA 2GEUA 2YIDA 1V47A 4M9ZA 5K51A 3FPLA 4Q6BA 4CKYA 4HNQA 3NOQA 2AUNA 3CUWA 3H83A 4JB0A 4BX2A 3F5FA 3ADPA 1NAIA 2DHDA 3RYTC 3FIUA 4KC0A 1J5EB 2ZJ1A 2JI7A 1M0SA 3E82A 1NXTA 5CX4A 3O47A 3EPLA 1X15A 3IPYA 7YASA 4A27A 2GO7A 3T3EA 4CKCB 1U5BB 2ADOA 3M81A 5IUNC 1Z47A 1XP8A 4WUTA 3KPJA 2ZFUA 5AMXA 3GZNB 1R3UA 2XITA 2ZT6A 2H31A 1NW4A 4MVJM 5FA6A 2A14A 3JALA 3VOBA 3ZXIA 1Y6QA 2I3ZA 5EZYF 3RYIB 1M74A 3PHIA 4K9PA 1HTTA 4FYJA 3TPZA 1KJQA 1YMUA 5FT9A 1SHJA 3UVEA 3TTYA 1EFHA 2OFWA 4GVXA 4X97A 1XAJA 3W5UA 5G41A 4HQ0A 4IL5A 3JQAB 1MF7A 1OXUA 4UUOA 1OX4A 3M6XA 1SUWA 2AOTA 4MLZA 1UOQA 3PX7A 3C15C 2CLDX 1WXEA 3FM9A 2A57A 3N0RA 4KGDA 4DLTA 3JQ7A 4U00A 1U8TA 3EGIA 3MYRA 5JD3A 4YMUA 1ZVMA 2IZ0A 4UAJA 3ZU3A 3HJFA 1VHQA 5I9TA 3R23A 2GFHA 3VH1A 1RAFA 5CBPB 5CCBA 1O8CA 4ANFA 3NIBA 4YIKA 3N8GA 2PSEA 2P6OA 5J2UB 4ZVRA 1OX4B 2VN8A 4QIHA 1FU4A 1UKZA 4DYDA 2OQ2A 4FU0A 4UHCA 3RF6A 2H57A 1QVRA 2X5NA 3I5AA 4IIXA 4LV8B 4EFDA 1FIUA 4CMCA 2X22A 3RTEA 3WGLA 2X8JB 3VSBA 4B7CA 1X9GA 2ZCJA 4K9RA 4A16A 3T3PB 3NJRA 3GV0A 4NYJQ 1JI0A 2ONCA 3KXLA 1A71A 3HJRA 1U2EA 4B17A 5CA0B 4YCLA 3OG9A 4YUZA 3WJ2A 1NQWA 3RFCA 1LVHA 1WZEA 1IHDA 2B94A 3JAKB 3LE8A 1AUQA 1ZI9A 4NBSA 3IPCA 4E5VA 5BSVA 4IDDA 2HU5A 3OOWA 3AVVA 1PNOA 3JW8A 3G0CA 3TDNA 2SICE 1MJGM 4C29A 1U1EA 1C1DA 2AEFA 1NF8A 2FMKA 2JH8A 1WV0A 2FGKA 2NVUA 2P4SA 2V65A 2ZAOA 3DE3X 4HWOA 1RXEA 4B7XA 3DYBA 1YAJA 2JHCA 3LKDA 1WCXA 4KAJA 1RBZA 5CT6A 5AIAA 1Z0FA 3SIPA 1XIVA 4QQKA 1XAIA 5EHGA 5KHOC 2A1TR 3QM1A 2A9PA 3HM9A 1Y4SA 4KO4S 1UOOA 3RRXA 4ESOA 4IZHA 4KMSA 1N2CB 4Z86A 5DOZA 4GZ3A 5KQPA 3VR5H 3TLMA 1UINA 1XQ6A 2DTXA 2HM7A 4DIFA 1D4AA 1AKRA 4ZCRA 5CM2Z 4KFUA 1DO2A 5C1OA 1W2HA 4BP3A 5KYXB 5KNDD 1IY1A 1I3LA 2ZGVA 3FR8A 3G2PA 2VZLA 4EY5A 4BXOB 1EX7A 1AUPA 3KTAB 4RL6A 3V55A 1V3UA 4Y6OA 1NXVA 1DUSA 2WWHA 4P4LA 4UMEA 3T0FA 4WCFC 1AO0A 1H66A 4DQ0A 1N0WA 1TUBB 2QL7A 3D8BA 2OVBA 5HIKA 5LWHA 1G5PA 1SK9A 6GPBA 1ZI6A 3GLFB 2NZWA 4UCXA 3VYWA 4NPHA 4XX0B 3IT1A 3TIGA 4TWBA 5G4LA 1VKHA 3BEDA 4KO3S 2PBLA 3K1TA 3NBKA 2J9RA 3ZJ4A 4LTNA 1A5SB 1CJBA 4RVCA 3ZV6A 2ADMA 4EVQA 2EWMA 2IELA 3HNOA 4M1OA 3U37A 3KIPA 4YBRA 4ZEMA 1P80A 1JWLA 1FDSA 4J9UE 3FCCA 3DWEX 1OXKB 3R0QA 3W1EA 1TEVA 1VG1A 1JQ3A 3FLEA 4KXQA 3IEKA 4EG3A 1NTOA 1Z5NA 2F3UA 2DQ4A 3G0DA 3QP9A 1HZZA 3PE6A 3SC4A 4YMIA 4TXJA 3LBNA 4D4JA 1H6CA 1XLUA 3AFOA 3GO4A 3M2TA 3ORHA 3QLEA 5K4GA 1JFTA 2X8BA 3HDQA 4JI3B 2QP3A 5FTLA 1X8JA 1MIHA 4QHYA 4EM6A 3PQ8A 3WKEA 1I33A 3EH2A 4X91A 3EZ6A 3LDUA 2GZAA 3ICPA 3HP7A 4OKIA 3HBLA 1QR2A 1D7AA 1XMQB 5FFFA 2ZQZA 4BNWA 3OTGA 4IQ4A 3U7HB 1U4NA 3GPCA 4ZKEA 1GGJA 5JBIA 3ZBPA 2Z6AA 4FHCA 1SKAA 1F2UB 5CT4A 1NOIA 4LQCA 4XASA 4YALA 4N7RA 5TGTA 4JXXA 1XVTA 3CPSA 721PA 3GP5A 4WK6A 4OA5A 5FO1A 1ZUHA 1TO1E 5EKDA 2HRCA 2QM3A 3DFFA 4FI3F 1IEXA 4DG5A 1I2CA 4Y2JA 4LF7B 3WSWA 1DPFA 3S44A 4A73A 1Z6TA 2V03A 3G8BA 3HN2A 5DHUA 1NJ6A 2V4UA 5IYZB 3W5CA 1K98A 1U2PA 2YXNA 1ZUIA 2QSJA 5AWFC 3AV0B 3QUCA 4R54A 4Z53A 2CK3D 1WETA 3LCJA 1MJHA 3IT0A 2PO7A 3FOEC 1MDFA 4LVNA 4UXHA 3SR0A 3JATB 1EUCB 3B60A 2I8AA 4LZNA 4NBLA 4C04A 1P0PA 2FSFA 3REOA 2QVXX 5C32A 3F98A 3OTOB 1P75A 3HMQA 1M2HA 1NQVA 1T8RA 1XB2A 3FFXA 3HSSA 4CRWB 1FYVA 3AM3A 1GNVA 3ROKA 5FOQA 1COZA 2R4TA 5FOXA 3ZCSA 1TRKA 3HC7A 3N07A 4L0DA 1CUIA 3OJXA 1HKUA 1HE2A 2B1GA 2FPSA 2KWIA 3O03A 3ZVMA 4LF6B 2QVBA 4XJXA 1XTKA 2Q49A 2G9VA 1GYQA 2HRDA 2CW5A 1U9IC 1WS6A 2ODWA 3KKPA 2E6KA 1TYCA 2J9FB 3LO8A 5GGXA 1Y3AA 2QG9A 1IY2A 3HCAA 3IUYA 4V03A 3LTEA 3ZHUA 3IQXA 3S8EA 1F5NA 1DJQA 4I1VA 4E2WA 2OVFA 3OKFA 4IDHA 1CRWG 2CDNA 4Q7LA 2XE8A 1NKVA 4TXHA 4MX8A 4A2WA 2XPCA 1R9MA 2C1XA 2DSNA 3IB6A 3AINA 1PGOA 1QO7A 2YWRA 4OGGA 4YCBA 1ZN8A 3SYKA 5F21A 4RF2A 2HD4A 1CQZA 4Z1MA 3FZNA 3F78A 4CU2A 4UJ3A 3U6BA 2ERYA 4Z7NB 1LNZA 1CU1A 3GIWA 3E1GA 3QX8A 3C8DA 1NX6A 4FNOA 2BELA 5IMSA 2QLTA 4HY3A 2GK4A 4WCFA 3EHDA 4DVJA 2OQVA 3UWMA 2EP8A 1Q22A 3DHVA 1VCIA 4EGJA 2HF9A 3RC7A 5D8DA 1M3SA 3AG6A 3OFJA 2QUHA 4QREA 4BMNA 1T5LA 1BO6A 2JI8A 4CXMA 1BSVA 3PNLA 3R4VA 2GGSA 3I6MA 5FCDA 5HKBA 1I94B 2DCMA 1P1FA 2ZBUA 4JYPA 5CB0A 2C3OA 2DPYA 1P81A 4R1LA 1QQ5A 2HDWA 4OKSA 4WJZA 2GM9A 1F6WA 1E9SA 2WAOA 2X1VA 1N2EA 2N0SA 8OHMA 5ESWA 1B1CA 1U8EA 1QCCA 5BWBA 3QEKA 4W8GA 3NH6A 1N3BA 2VFAA 4CIXA 4DGSA 1W49A 2CVHA 5JSUA 3G6KA 3IE1A 1DMSA 3IHTA 4ZAXA 3S5JA 1QTIA 1DU4A 1G3IA 5FBKA 3TAUA 2M2IA 4P7FA 1CUVA 1SFRA 4OMCA 3L1KA 2YW9A 4GLBA 1J9ZA 2A5FA 5JQGF 3TGLA 2R8RA 1QIDA 3ANTA 5HP4A 4YP5A 4N5IX 4FGUA 4FZRA 1D8TA 3OJ0A 1XX6A 4RAOA 4EH1A 5BVHA 4ZALA 5JXJA 3OIYA 1ENOA 5EJFA 1I7NA 3BHIA 4EYQA 2WWXA 1S02A 5CBKA 3G0OA 4PZLA 4V38A 3KLNA 4IHAA 1W73A 2ZYHA 4MCIA 3N6RA 4JHLA 5TV2A 2X9GA 5DHRA 4PZZA 3NQ41 1JRLA 5EE9A 1QIIA 4UZFA 2EP7A 2OOSA 1MB3A 2I99A 2GFIA 3B78A 3GT0A 4IILA 4KO2S 1PO7A 4LZZA 4PLPA 4BFXA 1ECCA 1NW7A 3C45A 1ES9A 2GCGA 1KJYA 4L9AA 3FTPA 4EG4A 2OV2A 1T34A 1ZK3A 2JGFA 4DJTA 3LP6A 4DRZA 2C0QA 1FP2A 2ESRA 1EHYA 3IBFA 3LA8A 1NZJA 4BPBA 1SBYA 2FEOA 1P72A 3R20A 1Q7GA 4LYFA 3KCQA 4O63O 4HAIA 2Q5CA 4TVOA 1H2FA 3L8GA 4CF7A 3MAAC 2CMDA 3JTMA 3Q9NA 1I14A 1EE1A 3EF0A 4HEJA 4K6FA 2BKAA 3ZLJA 3SXJA 1A9RA 4O8ZA 4AY6A 2XVAA 2ZJBA 5F5XA 1O96A 1P1RA 3GGSA 3TLGA 3UA3A 4AZSA 5M7EA 3V8QA 1XYYA 2J5XA 5K7SA 2FN8A 2R68A 2WR8A 3EZ2A 4QAJA 2AR7A 2O2DA 5G02A 1D8AA 4NULA 2Y1FA 1NBMD 2OCDA 3B3GA 2AMJA 4HEA6 1BQEA 2RONA 2IPNA 3LDHA 4P83A 3COVA 4PG5A 4ZVVA 2H1CA 5KWSA 1G8JA 2J5QA 1KY4A 1X13A 2EBHX 2ZROA 4LN1A 2XNCA 3M6WA 3DBVO 1O96B 3WQHA 4Y0VA 4BO8A 4RJKA 3DZGA 3PUVA 4O2BB 4BTEA 1W5FA 5TY0A 4MAAA 5KNBH 3M8KA 2ZKLA 1PX2A 1SN7A 1WB5A 1WMBA 1GGFA 5LLTA 2AI1A 3O8DA 1BYIA 3G9QA 2OENG 5HRUA 3DBRB 4D8VA 1GQQA 3HRHA 4RWZA 3N8KA 3T12A 5AW0A 3LCVB 2P6UA 3DZIA 4LRYA 3AEUB 1LK5A 4JZYA 1E59A 3ASUA 3KOUA 4MHOA 1LC3A 4PFKA 4U9HS 4F3KA 5LXTA 1VL0A 1B8UA 5D7NA 1J2TA 4JP3A 4M55A 4FMDF 4OYHA 4C88A 1ENZA 5A6VA 1Q6ZA 1LPSA 2WWTA 3DXXA 3DO6A 3GFOA 3QXCA 4BVGA 5JZBA 2QD5A 4ALKA 1B0PA 4ZT6A 4IXDA 5CLFA 2AE1A 3CNQS 2J0UA 5BR1A 1QDLB 3O31A 2VP2A 3DB1A 4I5IA 3ZCPA 3SWWA 1KC3A 3DCJA 4DLNA 3GLGB 3GIDA 4PO1A 1AQ6A 5I7VA 1GGKA 4RK5A 1RAGA 3K4QA 2A9QA 1XQXA 4BV2A 4HNAA 1ORHA 2O7SA 3KQVA 3Q3HA 2IOFK 4BFLA 4RTLA 4MVXA 1VJ1A 3AP2A 3ETNA 4AZ3B 1TEZA 4DMRA 2FETA 1LEHA 3F90A 4LJ7A 1M5UA 4PRZA 2H2GA 4BNKA 1E7MA 3DQQA 4FIZA 1D03A 3BQ9A 5BRNA 4BRWA 3Q72A 3N5KA 16PKA 1DINA 1TJ3A 3OP1A 4MW1A 4ZIRA 5B1HA 3UUWA 1GPDG 3G1WA 2FZCA 1G1AA 1HFJA 1REQA 1AN0A 1OTYA 2WSYB 1UBMS 2HJSA 1Q21A 2FQ1A 1YDFA 2WT8A 3VDRA 4B35A 5B1DA 1P6QA 1TNDA 4YR9A 2WFAA 2C20A 1N6OA 1SGWA 1MHPA 2RH4A 4H6WA 3R74A 4WA7A 2PZAA 3T5CA 3T6KA 4AZWA 4F4UA 2VF2A 3QK7A 1NG1A 2WF7A 2OYSA 1RWNA 2AYZA 2GN1A 4R8RA 1YA8A 1WM1A 2HA0A 1ZVKA 3OIVA 4GM0A 2WYOA 2I87A 2QIPA 3ZGOA 3PIIA 4AYTA 3QKWA 1RRMA 4ZAZA 1XYVA 1J0AA 3EIEA 3PR2B 3LK6A 4CIVA 3IEVA 2B7LA 2NSHA 1II8B 4N39A 3CVXA 1TAQA 4TMXA 1DTEA 3IDAA 5KYWB 1E1DA 3TQQA 1ZCJA 1QOQB 1Z73A 2ZI6A 3CIFA 4JI6B 1VL8A 4K7JA 5BYKA 2QAGB 3PXDA 5CB6A 4QUIA 3HR7A 4XR9A 5KVQA 1VGRA 1KMQA 4DMLA 1GFWA 1JILA 4YP0A 8ADHA 5JZOA 2J3HA 4QEZA 5AJWA 2PKYX 3L02A 1JR4A 4ER5A 2FN7A 4LWOA 1JXAA 3CLTD 3HY4A 5HIJA 2J9YB 2HIGA 4BVHA 2LD4A 3D6VA 3OFSA 5B3KA 2B4AA 4CZ2A 2OT3B 1SM4A 2DQYA 4YS6A 3EW9A 1UBGA 3TH5A 4X8OA 3TRFA 3UMCA 1JPNA 4HFMA 1XRPA 3VZSA 2XUGA 3ZU2A 4AMYA 1PKXA 1J2EA 3UGTA 4CLDA 4X94A 1SJ9A 2AF3C 1BKYA 4K3VA 5AK3A 1B0AA 2JGJA 2OBFA 3GLIE 3IDZA 3F7MA 5KMGB 1EJBA 1YDWA 2RB5A 2V5VA 4I55B 4PPGA 3LT1A 4AX4A 1AK9A 1TCBA 2NZUG 3VDMA 1EJ2A 3IUMA 2WSBA 2V8BA 4YJHA 3T7SA 4KGZA 2SNIE 2D5IA 3L0IB 4EA6A 2GVDC 2C58A 1HOTA 3BN3A 1KY3A 3HSYA 1EFDN 5IPFA 3L5KA 1KI1A 2QLFA 4R3NA 4TRJA 1Y7LA 4BNGA 2PTHA 2WSIA 1AD2A 3H1GA 3O94A 4FCWA 1EFRA 3FF4A 4XSHA 1BS1A 2JLWA 1WLYA 2DPLA 3BCSA 1NP6A 3GMIA 2FQYA 3JWHA 4ZV7A 4EX7A 1T1RA 1GITA 4DNPA 3ZD6A 3BGVA 4IDAA 3RCBA 2PS9A 4ZYWA 4MW7A 4PNEA 3TE6A 4UASA 3TIFA 1NC1A 3E9YA 2CMHA 2W2QA 3LLVA 4MKXA 5JECA 1KTVA 2POQX 3BS4A 3Q1KA 4MHSA 4LNUA 4IHJB 2POCA 1U0HC 3NWEA 2F1HA 1SMKA 1D2EA 4U5QA 3GLTA 1JKFA 3HYTA 3NHLA 1WMEA 3SF8A 1N2ZA 4HK4A 3TQTA 4UUPA 4DLWA 3RYCB 3O93A 1H3FA 2QT9A 4CT4B 2J3EA 2RJNA 5L7YA 1Y5MA 2QA5A 2VCYA 1JKJB 3DDHA 4DCMA 4RTNA 4DV3B 1KHHA 4KMRA 3ZU4A 1P4HA 3GY0A 3O1LA 1R0BA 1J49A 2ZAYA 1O6BA 3BMOA 3CU5A 3GUYA 1KORA 1WZ2A 2CBXA 2GBLA 3I5MA 3CZMA 1E9EA 4M0DA 5KYUA 3UCFA 3P9YA 4EGSA 5JASA 2EGGA 5CFQA 1F8FA 3GNTA 1N4DA 4D4IA 3AETB 4A26A 5LP1A 4JVNA 4PQRA 5BR7A 4QT4A 3AHEA 4KGXA 2YV4A 2ZTLA 1RAIA 3LWZA 4FFLA 3TJRA 2RD2A 4KRYA 3QY9A 3ICEA 4OLJA 4EZBA 3ETCA 4HDNB 4OHUA 1HZZC 2P69A 2UKDA 2OCKA 1AM4D 3IMKA 2UZ1B 3KDPA 5AFSA 2JVJA 4DF3A 3EVGA 3RSOA 1CKEA 2WP0A 3WGIA 4UZEA 1K06A 4R8SA 4E51A 5BSTA 1OKKA 2Y9MB 3WYBA 3NJ8A 3H4IA 4E14A 1BMFA 2BM9A 1S8NA 3AHJA 3RARA 4E22A 2FW1A 3CF4G 5H70A 1ODSA 4YRFA 4R1PA 2PGIA 1O94D 1S2NA 4LE0A 1XKLA 2YRFA 5C3MA 2OGZA 1CVRA 1SG0A 3DZ8A 3E9QA 3MGGA 4I9FA 3QF7A 4JDUA 1U6JA 4W9RA 3GYBA 1OU0A 4QXMA 2QBYB 1MV8A 4WADA 3IAS1 1Y3CE 3L1VA 4RQTA 2V59A 2K7FA 1Y9AA 4EMTA 1QQ6A 1JSCA 1G63A 4RVUA 2Q6IA 1JW9B 3MERA 3ZCQA 3E9MA 4MV1A 5ALYA 1L4LA 3ETGA 3KJNA 2O2EA 3MTBA 3S7TA 2GZ1A 3PNMA 3SX0A 4ZHSA 1TJ5A 1HEUA 2EW2A 2GPSA 2RHWA 4R8VA 2YZNA 3RJ9A 4XD7A 5T6MA 2IUEA 2REQB 4PIVA 1OWNA 4CV3A 2VHXA 5FWNA 1G0NA 1S5PA 2O0KA 1MOZA 2QTVB 3PGA1 1ZJZA 1SBZA 2NPFA 3X2FA 3R40A 4L5JA 3KOZA 3UM9A 3ESDA 1E1QD 3DMTC 4G01B 2F1OA 1U0RA 1JKIA 4WNIA 1KSGA 4RGBA 1DO0A 2O0MA 5CJPA 1E3TA 4CQNA 4IIJB 4OSEA 1G21E 1QE3A 5CB4A 2QYSA 5HFNA 3KQWA 1SXJD 1GFZA 4M98A 1QANA 2VHVA 3NJ4A 4KPYA 2XQVA 5EP1A 3NYIA 4PX3A 2V9CA 4DJ5X 2EKZA 3LQYA 1ZAKA 2ZANA 3UATA 1EFVA 2IPXA 2IUSA 4BQNA 2EKDA 4JYMA 5IM4F 1AK1A 3VZQA 4MMYB 5KU7A 3LT5A 3ZZNA 3Q85A 1CJVC 3OQJA 1JG7A 2YS6A 3TGWA 4ZVTA 1OA0A 3MAJA 3QVXA 3B1FA 2PGNA 1CY1A 3ZV3A 1QU3A 2QUBA 1RQPA 1W4RA 2ZPTX 3PSHA 4LYEA 1UZNA 4Q9JA 3Q9LA 5A0TA 1Y8RA 3CZ5A 4J2TA 1RHMA 5JQGB 3VVMA 5CVCA 1XF1A 3VC2A 3V4RA 5DN9A 3H0EA 3M1AA 5GJWC 3WGTA 1H8HA 4CQJA 3QJYA 4EKEA 1EDDA 5AI8A 3HXKA 2XCUA 1HT3A 1V4NA 1Z8FA 3IUQA 4JP1A 4PHFA 4X54A 3TMYA 4P32A 2C7QA 1HK7A 4CMIB 2JCXA 4DUYB 3NYRA 4I0WB 4P4NA 5DHFA 2RCNA 2R8EA 3OA2A 1FLAA 3QMWA 1TIKA 1C8LA 2GD6A 3REFA 4HQNA 5JWOA 5J2UA 2DT8A 1FBNA 2EFYA 2XI4A 2FMUA 3A28A 3AKZA 1RI3A 2FR1A 1MO3A 2FW6A 4QDTA 1QAQA 4PYNA 3N6XA 3ZK7A 1H5UA 5AVJA 1FTSA 2WVGA 1RPAA 1Z2CA 3D7SA 3EGCA 3TO5A 4C0AC 4EK9A 4BNZA 1MA3A 2R48A 5CX1B 2LCQA 1YK0A 4BBZA 2LGJA 3EFBA 4D8TA 5IAOA 5ARCA 2O8VA 2NSJA 1NL3A 2FCRA 4B40A 5LR6A 1XZIA 2PGJA 3O4FA 2P77A 4RLFA 1IZYA 1Q83A 3OEYA 3PA8A 3GFFA 5PGMA 3FWZA 1MH9A 4JEHA 4BLUA 1GFIA 3DC7A 3QG5A 5H4HA 2ZYWX 3AUUA 2AKEA 4DBLE 4TWRA 3CCFA 2Z2KA 1VYTA 5D87A 3RTDA 2C7VA 4MO9A 5DNVA 4DBVO 1U99A 4HPXB 2IWHA 2DKNA 2F1JA 4BGEA 2WAMA 1H3NA 2BZSA 1E9BA 2C2OA 1AQYA 1NVGA 4L8WB 4QELA 5LQSA 3OIGA 4AY3A 1U9YA 5T8KC 1I6LA 2ERCA 1KTIA 1QIMA 4O4LB 1VPLA 4RF4A 4Z51A 1IM2A 1YDHA 3HCRA 1D9ZA 3KT8A 3NI2A 1XPUA 2MR6A 3HR4A 3AF2A 2NQ2C 1XTIA 4GI3A 5ERGB 4ZHQF 1T3SA 2VF5X 2WTNA 1JAYA 2FR8C 5JG7A 2X2OA 5A4AA 5HZKA 5JSFA 4EW3A 2H0AA 4G8JA 2YHSA 4R98A 1TX4B 2P91A 2ZJ6A 4WWHA 3SBXA 1J0DA 3THRA 4O4LA 5DEIA 4R0MA 2LPMA 1W46A 2IC5A 1NOJA 2XAUA 2CWDA 1UMBA 1VSQA 3JVVA 4R0VA 1DC4A 4MEBA 1E1CB 2H3EA 4ZTBA 1MD9A 4NCBA 4ENTA 3CJTA 4S1OA 2B5WA 2P4UA 4RKWA 1F38A 3Q41A 1W1UA 4HDOB 1Z38A 2KSQA 2DKFA 1I8TA 2A78A 4B6JA 1NX9A 3MNFA 3Q98A 1VMKA 3SHTA 4RMIA 5ECGC 1EVIA 4OQDA 1ZPDA 2BCEA 2C4MA 5HEKA 2XWJI 2NX2A 1MCZA 4XDHA 2N75A 5TGZA 2HBYA 1OI2A 4NFYA 3WJAA 2DH5A 1QV6A 3NEJA 1TPYA 2JZNA 5KSOA 3H3XA 3NDJA 3T5GA 1WUYA 3TL6A 4PNHA 2YZMA 3JQBA 2WQ7A 4MRSA 4PZCA 2ZUCA 4DWVA 3U39A 5L3SA 2IDKA 3KYDB 3DF9A 2AA3A 2GNAA 4ZVKA 1U8AA 3H84A 1VL6A 3ICWA 1PFYA 5T3UA 2IUTA 2FHSA 3SQDA 2PRYA 3RBXA 1X38A 5CP8A 4J16A 1P1HA 3FYDA 3PCXA 2H07A 4XCXA 3OCUA 3TSCA 3WQQA 5IF9A 3ER9A 2M6KA 1SXPA 3ETDA 3H1FA 1WD7A 2B36A 2Y76A 3D6FA 3KZCA 4G5YA 2FSPA 4P4GA 3VAAA 4EI7A 1J8FA 2YOHA 4MYSA 5KNLA 2Z2YA 4F2DA 5HUQA 1TM1E 3DE4X 4E12A 3ZY3A 2XB4A 5BPFA 1VJCA 1UH5A 2AJCA 2A9RA 2JFVA 4QPJC 4J4BA 5EZ6B 4PLZA 3PX2A 3K8YA 4L85A 2RGEA 3RVPA 4E30A 1E8NA 5A5VA 1LWNA 1F4LA 3M83A 4LC1A 3I9JA 4ZEXA 2WLSA 3FWNA 1SBCA 4AYXA 5B7QA 4LRUA 3ZW7A 3E4DA 4KCGA 4WXMA 3DHWC 1S89A 5TARA 1EGMB 1Y48E 1Z5ZA 4FB5A 2YV5A 4PSDA 4EWLA 1T6YA 3RR2A 4GPAA 1V16A 1RP1A 3DMNA 4H1VA 5DBIA 5EESA 4AC9A 3BHJA 1TTQB 4Z9BA 5E95A 5CFNA 4B1FA 4FFNA 5DXFA 3OIDA 3GJ4A 1WULS 2H7CA 3F7TA 3GRPA 4LGVA 4RGVA 5GZ1A 1QFJA 5LDDC 1N5KA 4U2CA 3MWKA 1WCV1 4KR7A 3IAEA 3M6FA 3A4MA 1I9CA 5FF9A 1LZKA 3U3XA 3RC3A 1BROA 1K4YA 4TM8A 4Y2UA 2VJCA 2GCEA 2W37A 3GMSA 3HADA 4MEAA 4S0XA 2PM8A 2N47A 1PL0A 2H54A 4L08A 5AOVA 3Q8KA 1VJ0A 3GN1A 1XEWX 1UEIA 4ALIA 2O2ZA 3BE8A 1JH8A 1RR6A 1EVKA 3GZ4A 1N36B 1Z0ZA 2O8NA 4TMTA 2HIMA 1KAOA 1VI6A 3KKNA 2VK1A 1D7OA 3I3SR 1EXNA 3L93A 4I55F 4D8YA 4KXNA 3BIJA 5B30A 1ZU5A 1NXQA 3RJTA 5JNRA 1EIZA 1QFZA 2IQ5A 3IBSA 4XAQA 3HXQA 3CZPA 3HDTA 3HG7A 3ND5A 3QU9A 5TMEA 1RWWA 2IF2A 2RHDA 3WFJA 3FVRA 1CIVA 5DE3A 3ZXXA 5B12A 1O4WA 4ESEA 1PK7A 2WD8A 2XWSA 3MCUA 1FLNA 3A0RB 3WYNA 3PXAA 2QRMA 4DIOA 1I7QB 4CEHB 2O8EB 1I5EA 4NU8X 2XMQA 1EK5A 2W0MA 3EG9B 4Y1EA 3T4PA 1O2DA 5DTIA 2PS1A 2B9VA 2A4MA 1L5MA 1X74A 4KVFA 1IQUA 1AGPA 2C2WA 4WKNA 4K9LA 3U31A 5J23A 4GHWA 3ISJA 1ZMRA 3OE5A 4TLDA 2GLTA 2RBEA 2YZGA 3H17A 3MMSA 1ZN2A 4EVIA 2O54A 1YKFA 4HH4A 6ABPA 2GFQA 2VNIA 5CCEA 5HQ3A 3LQQA 5FI1B 3GNLA 4YAFA 4Q7QA 1IRXA 4A4DA 3GU3A 2WHRA 2R62