2FEKA

Structure of a protein tyrosine phosphatase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
147
structure length
147
Chain Sequence
MFNNILVVCVGNICRSPTAERLLQRYHPELKVESAGLGALVGKGADPTAISVAAEHQLSLEGHCARQISRRLCRNYDLILTMEKRHIERLCEMAPEMRGKVMLFGHWDNECEIPDPYRKSRETFAAVYTLLERSARQWAQALNAEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight protein-tyrosine-phosphatase wzb
publication title The solution structure of Escherichia coli Wzb reveals a novel substrate recognition mechanism of prokaryotic low molecular weight protein-tyrosine phosphatases
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 56
structure length 147
sequence length 147
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2005-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fekA00
2DRIA 2P4UA 2FEWB 1SXIA 2PL1A 1SD5A 1MB0A 4KFCA 1LJUA 4HNQA 1M5UA 4MR7B 4RZSA 3TO5A 4DN6A 3HS3A 2H3HA 3CZ5A 2JCGA 3R0JA 4EYOA 2JB9A 1JFTA 2PUAA 1SXHA 5HSGA 4YS6A 1P6UA 2M1ZA 3CS3A 3NNSA 2JBAA 2NT3A 5IEBA 3KYJB 3IP5A 4MR9A 1RPJA 3OLWA 2MYUA 4MS4B 2QV0A 3GA5A 4Z99A 6CHYA 4GPAA 3GRCA 4QPJC 3IPAA 4KV7A 1KRXA 1RZRA 1JHZA 3CU5A 1YS7A 2FN9A 4JOQA 2I6FA 2YHBA 1LBHA 1Z12A 1VKRA 4RK4A 5KQGA 1YK0A 3SY8A 3L6UA 1DBQA 4Z4HA 1ZHHA 2IDMA 5IC5A 1L5YA 2ZAYA 1U2QA 8ABPA 4LDZA 3HCWA 5FWXA 3QELA 1FFSA 2X7XA 3JVIA 3LUJA 5CNMA 2XDYA 4YLEA 2FEKA 3RVMA 3DGFC 3OLZA 5JNRA 4D6YA 3CG4A 3GWGA 1JDNA 3EODA 3G1WA 1DCKA 5FWYA 1EWTA 2WWVD 2FTKE 1JL3A 2MSWA 3SNKA 1JF8A 2NT4A 1GUBA 1JLKA 4ZJPA 1YS6A 3B2NA 2CWDA 4LZLA 2MYNA 5IBQA 2WB4A 1KGSA 5KQPA 1NXSA 1VPWA 5D2CA 3HM9A 3RVNA 3T6KA 1EAYA 3EULA 4KREA 1C4WA 1CHNA 3O2QB 2F8SA 1MVOA 3H6HA 5I4CA 3CNBA 1RNLA 3BREA 3CRNA 4N0PA 4YP9A 2PMCA 5ABPA 5FWXB 1P2FA 1BDIA 2M98A 1ZAYA 2J48A 1B00A 5TPWB 1JYEA 3MIZA 5C5EA 1Y1LA 3OM1A 1YMUA 3URMA 1EFAA 1WETA 1CYEA 3QLTA 2PUEA 2OQRA 4F12A 4MLCA 4Z0NA 2NZVG 4B09A 3EGCA 4QICA 1BA2A 4EY3A 1E6LA 3VNBA 3LUHA 3N53A 2R47A 4MS4A 1NXXA 2MSLA 3KJXA 1VLZA 2E4ZA 2RGYA 3NBMA 1DBWA 1QQBA 4OLBA 3OO1A 5TPZD 4NCBA 3FDFA 5TPWA 1U2PA 2OENG 2E4WA 3Q7RA 4MR7A 1NY5A 4KRFA 4EYQA 1DBPA 2L2QA 4G0XA 4IRXA 4MPTA 4DADA 4JASB 5BQ3A 1PUXA 1A04A 5TQ0A 3O2SB 4PEVA 4HNRA 4RK1A 1AB5A 1S8NA 1QO0A 1NXPA 3KYIB 4D74A 5TPZA 3RVKA 4TLMB 3BILA 4Q7EA 4ETIA 5KC9A 4IGAA 3LFTA 2R48A 1F4VA 1Z18A 4MRMA 2RDMA 2QVGA 1DRKA 4JAVC 1JYFA 1LK0A 2JBAB 3CTPA 3LTEA 3N75A 5BRAA 3HUTA 3I5AA 3C6QA 4P98A 2KYRA 1PHRA 3N0RA 5JNUA 3BRSA 5IULC 3HZHA 4OLAA 1K66A 4S04A 4WXMA 3MM4A 3HXMA 3S99A 3CZCA 5IUNC 3O21A 2MSKA 5EWMA 5HKOA 4PE5B 1KMIY 2WRZA 2PL9A 2RJNA 5F64A 1BAPA 1BVHA 4G0YA 1QPZA 1D2AA 2GI4A 3DBIA 4ZMRA 4KNYA 3O1IC 4NQRA 4QYMA 4RY0A 4EYGA 5EWJB 2PLNA 2B1JA 3LKBA 1FSPA 1SRRA 3F6PA 4ML3A 1Z15A 4YWHA 4E7OA 4W5QA 2IOYA 1RXIA 3M9XA 1PEYA 2LBPA 4MQEA 1P6QA 3DGEC 2CD7A 3K9CA 3H6GA 4P1ZA 2PUGA 1QP7A 1Z25A 5IUKC 5JNSA 2PUFA 1IIBA 1YTUA 2WJWA 3ILYA 3K4HA 4IF4A 4KK3A 4RK5A 3F6CA 2L19A 4G0QA 4TMYA 2FW0A 3EJWA 1TMYA 2CHFA 2IPNA 5JS1A 1Z2DA 4QYWA 4JB0A 3LMKA 2HQRA 2Q5CA 1Z16A 2P9HA 4Z4FA 1UDRA 3O1JC 1NXTA 4MAAA 3Q7SA 4O1IA 4YRZA 3C97A 5KWSA 3RVJA 1DRJA 4N41A 3O1HB 3ILHA 3E61A 5FBHA 1ZDMA 5DLEA 3C3KA 5JS2A 4XXHA 4LRQA 3RQIA 4TLLB 2F8TA 3N8IA 4YO7A 1JWLA 2HSGA 5EWLB 3KLNA 3ROTA 5BRJA 1K68A 1QKKA 5IEJA 1ZY2A 5CHYA 3T8YA 3Q7TA 4D6XA 4YCSA 2W42A 2A9OA 1Z2EA 3I42A 4W5OA 4WWHA 2IPAB 3OQMA 2VK2A 4O5AA 5HQJA 5T3YA 3E3MA 1A0OA 4Z4EA 4LDAA 4RK7A 3RVSA 4MS3A 5GOTA 2PUBA 4N47A 1E6KA 4F3TA 2FQYA 4Q6BA 2AYZA 1QO0D 5DGCA 4YGXB 6ABPA 4RS3A 2HQOA 3IDOA 3DZDA 3P9YA 5FBKA 2L17A 2E4VA 2FMIA 3QEMA 2O20A 2QXYA 3LKVA 2GKGA 3QLVC 4TN5A 3KTOA 4YR7A 2PKXA 3D02A 2IPMA 3UKJA 3IPCA 1P8AA 4NICA 5HM6A 4MS1B 2RJOA 3UUGA 4N0QA 2JVJA 4FE4A 3TMYA 3JS5A 5TQJA 2QW1A 1BDHA 1AB6A 1QQAA 3H1GA 3H5IA 4KVFA 4PZ0A 2YHAA 4JA2A 4RDCA 1ZN2A 4IILA 2HQBA 4CBVA 3A0UA 1M5TA 4Z9BA 3FGZA 3KCNA 1GCGA 3JPWA 4KZKA 4RV5A 1H9CA 7ABPA 3QEKA 1JX6A 3LUFA 4N76A 2L18A 1ZGZA 4MQFA 4MYRA 3UK0A 1JBEA 2LPMA 4WUTA 2A9QA 3HK2A 1ZH2A 4ZPJA 3NHZA 2IKSA 3LOPA 4ZMSA 3GL9A 3H5TA 3N6VA 4MR8B 4Q6WA 1NXWA 4PYRA 3SM9A 4F06A 4IMIB 4RY8A 4Y9TA 1USKA 3I09A 1QP0A 1NXVA 1FFGA 5TE9A 3SAJA 1ZITA 3O75A 4OBBA 3OQNA 3F73A 3IP6A 3RVOA 4RU1A 3OQOA 1L5ZA 4H60A 3HO1A 4M88A 4EYKA 2TMYA 3DLBA 3H5LA 3OM0A 5TQ2B 3FFWA 1D4ZA 1MIHA 3FFTA 3GT7A 2PUDA 4XARA 2V0NA 3KKEA 2FQWA 5B3JA 2R4QA 1DCFA 2E4UA 4PICA 3EAFA 1EWVA 2FLWA 1U04A 4OTZA 4E7PA 2FLKA 4DQDA 3M9WA 2FMFA 5CNIA 1MB3A 4G86A 4KQCA 4RXMA 4W5RA 3C3WA 1FFWA 5JNVA 2QSJA 2QZJA 2A9RA 1GCAA 1USGA 1ZESA 4EVQA 5GQSA 3DLHA 2GWRA 3HDVA 3QLUA 1QMPA 5KQMA 5KQLA 3L49A 1QNLA 4LE1A 1PNTA 3KHTA 3Q9SA 3HV2A 5JNTA 4RWEA 3KG2A 3RVRA 1RXEA 3I45A 3H75A 1ABFA 3LUGA 5T7BA 3OMXA 4MQFB 3JTEA 2WJAA 2A9PA 2MYTA 1USIA 3MQ4A 3SQNA 4G0OA 3MYYA 1DP4A 1EHCA 1ZVVA 3QX8A 4H3KB 3RVLA 1ZGGA 1SXGA 2JVIA 3CHYA 4O1HA 3LUCA 1ISRA 5DKFA 4G0ZA 2JK1A 1GLGA 3NNNA 2H0AA 4UHKA 3H5VA 2MYPA 4XASA 2PUCA 1DC7A 3A3KA 1DJMA 3W9SA 5E3JA 4Z4CA 4HYEA 1LBIA 1U8TA 2HJ9A 5DTEA 4EGSA 5JNWA 4KPYA 3HVRA 1D1PA 4G97A 1XHFA 4IMJB 3F7NA 3LUKA 3LUDA 4YV7A 3Q41A 3QX9A 2WY2D 3MF4A 1APBA 1DG9A 1E2BA 4MRMB 4WZZA 4F11A 4RK6A 4JP1A 4HNSA 3RH0A 3TB6A 1J56A 4GNRA 4MR9B 1EWKA 3SG0A 2GX6A 3MMNA 1DC8A 5IX8A 5KC8A 1URPA 2IYNA 3EDCA 1T34A 4RKRA 4OATA 4KMRA 5IUJC 4XFKA 2VUIB 2VUHB 4ETMA 1BDJA 2HPHA 4ETNA 3CG0A 3Q15C 3NHMA 1DCMA 1C0EA 1TM2A 3OO0A 4L85A 5FWYB 1YIOA 1ISSA 3JPYA 4Z4GA 2PE5A 2FN8A 3G85A 4EVRA 1Z17A 5EWMB 2PAFA 3HUUA 1I3CA 1FQWA 1YMVA 5TQ2A 2QVCA 3QELB 1OXBB 3N0XA 1JH9A 1PEAA 2VYCA 2LIVA 3D8UA 4OG2A 2FMKA 3BBLA 4NCAA 3CFYA 2FEPA 3EQZA 4LX8A 3T95A 4MLDA 2FXIA 3KLOA 1ABEA 1JDPA 4RK0A 2NZUG 3LUAA 3QEMB 3OMWA 4L4UA 4MR8A 1Z13A 3KSMA 1R8JA 3H1EA 2CHEA 3JY6A 1YVUA 3RVQA 1JFSA 1DZ3A 1XHEA 1Z26A 2E4YA 2FQXA 1NATA 3OLXA 3VNAA 1U0SY 3FFXA 1W9HA 4KQ9A 5DCLA 1CEYA 2FSPA 3H5OA 3NNDA 3A0RB 4WT7A 4S05A 9ABPA 4Z9AA 4JB2A 3HJFA 1E6MA 3BRQA 3T38A 4MS3B 4XAQA 1LJLA 1KRWA 5TQ0B 1HEYA 4EVSA 1TVMA 3RVPA 1D5WA 4EUKA 2PJUA 5KI6A 3M6MD 3MA0A 3OLYA 4N03A 3ROFA 4ZYLA 2FVYA 2JRLA 5ED4A 3EQ2A 1RZRD 4KK4A 5B3JC 3GBVA 3GYBA 4MQEB 4FB4A 4W5TA 1JFVA 1F51E 1MAVA 2ID9A 3HSYA 3HEBA 2FMHA 1W25A 3H5WA 1YK1A 3GBPA 4FE7A 2BGGA 4NV3A 3JVDA 4F8JA 5CNJA 3QK7A 5CNKA 2B4AA 2AYXA 2E4XA 2ZWMA 3CLKA 4WXEA 2QR3A 2QU7A 2N9UA 1TJYA 4MGEA 1GUDA 4RXUA 1TLFA 3O2JA 4H3HB 5EWLA 3HDGA 3OLVA 3H1FA 3FMVA 1M2EA 4MS1A 4G0MA 3KS9A 4W5NA 1VRVA 3O74A 1NXOA 4UHJA 1A2OA 4Z4IA 4RY9A 3N0WA 2IPLA 1NTRA 2JVKA 3TD9A 4XLTA 3IP7A 4RSMA 1OXKB 3QLUC 5EWJA 4G0PA 3C3MA 3GV0A 3A10A 4RXTA 4LE0A 2LP4Y 2FKAA 3TX6A 1QP4A 1D1QA 2NUBA 5BR1A 3QLVA 1PNRA 3IP9A 2WMYA 3CKMA 5PNTA 4RKQA 2ID7A 1ZH4A 5C5CA 2R25B 1M2FA 2GBPA 2LUOA 1XWWA 4LE2A
chains in the Genus database with same CATH superfamily
4P34A 3X1KA 2CL7X 1XU4A 4ZQIA 1VP9A 3VR6D 1MAHA 4EYOA 5T4EA 1L4FA 4OFWA 3HACA 1DINA 1EFUA 1FJHA 4C0JA 4P5PA 3WYNA 3IQEA 2OA0A 3MJFA 5K3EA 4IDGA 3PR1A 5BSFA 1YRAA 4L4RA 3BULA 3UWPA 2QPLA 3GQBB 4L0CA 4GPAA 5BWOA 3RSOA 4ISBA 4ZVRA 2IDKA 3AJ8A 1E77A 5CBKA 1RSZA 4LZJA 1ILEA 3BJMA 5JNLA 1QH9A 3JQGB 4K05A 4FKMA 4P7GA 1Z8DA 3QY0A 4O4IF 4GOMD 4E5VA 3WGZA 2P77A 2XUHA 2NPIA 4IFIA 4HGYA 1IK6A 3NKLA 3GZJA 2XVYA 1YVEI 3JQ9A 3VOTA 1AXRA 1FFSA 2BMAA 2BFAA 2R8XA 2X7XA 2ZPAA 3FWPA 3D3WA 4LSZA 4O2RA 3GCWA 3HXPA 3NC4A 3O5AA 2C5GA 4YECA 4ZAVA 5CDFA 4XVCA 2XCSB 1YIAA 4E5UA 1X39A 4RVDA 3C4QA 2ZDQA 1HZJA 2GHTA 2JBWA 2PQMA 4IDFA 2ES4A 5EJAA 4BASA 1QRSA 3LPDA 2E37A 3IUNA 3LBHA 4OHPA 1YS6A 4PRYA 2FPGA 3O4IA 1BJTA 1DIOB 3DQZA 1F1BA 2VAVA 4FLEA 1WVMA 2WB4A 5FWDA 5BSGA 1CS0B 2GCOB 2XEXA 4GUDA 1TPYA 1Z0UA 2IK8A 1T4MA 3T6KA 4Q9AA 3AIKA 4MAMA 2YICA 1HDZA 3O2QB 4E6PA 2ZIUB 1ITZA 1CUSA 4MVXA 3VMMA 1DV1A 1XBTA 1EUCB 4N0PA 4ZWNA 1AKQA 4G56A 5BNIA 1VZ3A 4DLWA 1JYEA 3MN1A 3E7DA 2ZUFA 3RNLA 1I5OA 4NSNA 5DX1A 2BH2A 3QLTA 1M34A 1LPBB 1YS9A 521PA 1RWOA 4EW6A 1CYEA 2BFEA 5A04A 3FPGA 1NYTA 4XIJA 2XSZA 2XGSA 3AKCA 2VEDA 4J0QA 5G1NA 4ZYXA 4ENPA 1DO0A 1QV9A 3PDCA 1JHAA 5HS6A 2O3TA 5CVCA 2X0RA 5KYGA 1JQLB 1CZOA 5GV7A 1LK5A 4UAVA 4MITA 4XFJA 1L8AA 5TF0A 1HTTA 1TLTA 4QTYA 4WFJA 5KTKA 1WNFA 2AFVA 2GA9A 2AJTA 1K2WA 3VA7A 1KAOA 1MVNA 1XR3A 3CC8A 4HPXB 3MS4A 1R2QA 3GJ8A 3LAWA 1RVV1 4DPLA 1V5WA 3MGGA 1GZ5A 3W5CA 5TY0A 3DZBA 4WFKA 4G0XA 3VGJA 2AOTB 3O3NB 4DADA 5IG2A 5ICMA 2X1VA 5FLXA 4RK1A 2QGFA 5C8XA 2PHZA 3ADOA 1JS1X 1C3OB 2YIMA 3OT4A 3QMVA 2Q1XA 2GFHA 4CMEC 4G26A 3C7DB 4KH1A 4REQB 3P8ZA 3FOZA 1YQQA 1IYZA 1QM5A 1GUAA 4Q1VA 5JEEA 4RULA 2XA2A 1D6SA 4Y3UA 3R0VA 3VU9A 4PCLA 1SIWA 1OFTA 2Y1FA 2QLMA 4GLBA 3REQB 4B6SA 1KFCB 3I9OA 4HUJA 2VHZA 3BRSA 4KNWA 1H8HA 3F5DA 4JOBA 4MO9A 3U37A 1ISGA 5EIXA 5JAHA 3UPTA 2QD4A 2EP8A 5D7BA 3KVOA 1RS0A 1XCMA 4LX0A 1Q0QA 3WMWA 1Z07A 2HZ7A 3ZH9B 1FU8A 5E1DA 2Q6VA 3HKCB 4RHFA 4DV7B 1B8NA 1J9GA 4ZIRA 2OP0A 2DUMA 3DWFA 1D2AA 4WOKA 5K8UA 1CVRA 3PHLA 1B2RA 1J23A 1TKRA 1Q1NA 3G2NA 2K7FA 4RY0A 1WHTA 1MOZA 2ATXA 2IEBA 4GS5A 1AOXA 1ZNWA 1AH2A 1S2MA 3AEKB 3K8ZA 4J9UE 5H3HA 1E1MA 3OQBA 4MI6A 1HKHA 1C1DB 1GL3A 1OV4A 1RXIA 3GJQA 2INGX 1VFNA 1P75A 3DGEC 3WWDA 4J0CA 5DYNA 5BNFA 2FPOA 4G8BA 2C1EA 1MENA 4FCCA 3DZGA 1MCZA 4FVTA 2LE0A 3ZCRA 5HJEA 2WU8A 3DUWA 2H1HA 2Q3LA 1SQSA 3G0CA 4KK3A 2C7BA 1G2IA 1Q44A 1DAOA 3R7LA 1YTLA 4PGHA 5JZOA 5GIOE 4M1TA 4I1IA 2A92A 1LTQA 4MKGA 1BYUA 3F1LA 4OM7A 2PMDA 3FPJA 2IPNA 5BQ5A 2CLSA 3UUFA 1LBQA 1SVUA 2D8MA 1WTCA 1UMCA 3Q12A 1TCCA 1ZW1A 1I5EA 2FFAA 3PD1A 4E32A 5LFAA 3FUUA 4RV4A 1UDRA 3O1JC 3I5YA 2QJWA 2WDPA 1L5QA 5D85A 4JOSA 1WHSB 2DECA 4Q4HA 1TM7E 5COAA 5LUBA 3M3DA 3UK6A 3UWSA 1J09A 1XK6A 2MR6A 2HV8A 1QFZA 5DRYA 2JW5A 3NBAA 2GVZC 5EMMA 5EMLA 4I4CA 1KA9H 1QAMA 4J7AA 4L50A 5LKAA 2A1TS 2FE1A 4TLLB 2WYVA 3JW8A 4M1QA 3FPSA 2QPOA 5C1DA 4XOUA 2AG8A 2WU4A 1JJVA 3OZDA 3RSZA 4LGCA 4WKGA 4CWAA 3FSGA 2F62A 4Z8XA 3VU8A 1RWWA 4YGYA 1F8XA 1E94E 2X1LA 4KPFC 1JH8A 2YS6A 3DXYA 1D03A 1EB8A 3DYIA 3FOWA 3G6WA 1PJ2A 3M6XA 3QU7A 3L6OO 4MV5A 4TZKA 4L6CA 4CZ2A 1C1YA 1L1QA 2XB4A 4YALA 2N1MA 1N7IA 1S2IA 4I9UA 4Z9FA 1A9ZA 2VK2A 4BVJA 5DYIA 3BKWA 5IVIA 4Z1MD 4E11A 3A1NA 2VXBA 1ZK0A 3WB2A 3LVRE 3RVSA 1XDGA 3I34X 1KSGA 3OJFA 4LHEA 2GYYA 3D2BA 4ZV9A 3RTGA 2P6RA 2PSFA 4Q00A 2O05A 1AKTA 4OI4A 1FS6A 3PNYA 2IE0A 1BXGB 2UYYA 4F96A 1FIUA 2DERA 1BMDA 5HOQA 1VE5A 2HQSA 3ZZMA 1KEWA 4YR7A 4J6FA 5JRDS 1JIXA 1S0UA 1VXOA 3RM3A 2V74B 2LZ0A 4UFPA 1D04A 4YCMA 4RTPA 3R23A 4EG0A 2FG5A 2Z0MA 3QVMA 1RI1A 4K9DA 1FTWA 4AJEA 2QW1A 3HJRA 3VGPA 2XOEA 4DRZA 2QUIA 4HNVA 1MU0A 4AY2A 3HJAA 5DNVA 3WKEA 2ECFA 3QVKA 1L3CA 3L8ZA 2Q5LA 2XVAA 3B1JA 4NAUA 4YXWA 4YXWD 5KYUA 1RMQA 1BD3A 2IF0A 3EAQA 1ZR4A 2H2FA 1BD4A 2JIBA 3ZWCA 5CYFA 2HHAA 4RESA 2ZXEA 1LTKA 4IJWA 4D9GA 3KQHA 2XUOA 4FYWA 3X1JA 3ZCXA 1M6WA 5LP6A 1QE3A 2LKDA 1PK8A 1S3GA 4MV8A 3RT1A 2JDIA 2DHRA 2O1EA 3MFQA 2GTIA 2WA2A 3F96A 3O2NA 2WHPA 2ZYTX 1X7ZB 5G0SA 3TQSA 4PRLA 5BV0A 4RTNA 4ZJZA 3O8QB 3SYNA 2HIHA 2IXEA 3QMMA 1PT9A 3HMQA 1IHOA 1WU8A 4ZMSA 5FL7D 3H5TA 1IN1A 1FTYA 1M73E 2YUIA 3RSLA 3S1SA 4N8DA 2H1CA 4DHWA 2GESA 1A4RA 2F1HA 3ESDA 3FJYA 3TJMA 1TCVA 1FS4A 1WP9A 2W6JA 3C6XA 1JSCA 2QN1A 4N4AA 3T7IA 2QRZA 1ZMRA 2YV5A 4HDRB 3F73A 1Z2CA 1QH8A 4H0CA 2WW8A 1L5ZA 4EZEA 1DEAA 3DM9B 3KEGA 1BFKA 3B3FA 4U7TB 3IBYA 1TA9A 4QVKA 5TQ2B 3CONA 3BN3A 3MINB 2XH8A 2W6ZA 3K73O 2C07A 5DV9A 3G9UA 4BFYA 3K6SA 3O7WA 3A1EA 3K94A 3THXA 2GYUA 4N5MA 2P3SA 3YASA 2GXAA 1ONBA 1Z8HA 1ZJ5A 3DAHA 3Q3GE 3EZ7A 2EWMA 3HXKA 4QXPA 5DOZA 121PA 1JJFA 1X9GA 2GYVA 3MBIA 3OMLA 3B1KA 1G5RA 4J90A 3OPQA 4G86A 2DPYA 3DONA 1RPAA 2OXRA 3W5DA 4OBXA 4R7ZA 4JYAB 1NIPA 2DTXA 4J1TA 1A5TA 5A9SB 3INRA 3MAGA 3O83A 5GWXA 3N70A 5ULLA 3CLUD 4HZUA 3PWSA 4X71A 2MSEB 3OPYI 1YBMA 2G9QA 4IO0A 3U3KA 3K6SB 2B9EA 2X1HA 3MERA 3DEKA 4JVMA 3LK7A 1FTGA 4B4WA 2OCKA 4L5JA 1GGHA 1U3TA 1RXEA 1ZVQA 2QY9A 4PLYA 1K63A 4WY5A 4A03A 3FYDA 2IRWA 3FYHA 3DPUA 3NG1A 5P8WA 3TTVA 4D8WA 3GLHE 4I08A 2QLTA 4J94A 4HNAB 1DVRA 3ZW8A 2A9PA 4E5PA 4EEXA 3HJHA 3KQVA 5REQB 4KWTA 1JA9A 4QO8A 3FZQA 3FCYA 4Q1BA 3AF2A 1XIVA 4LTDA 4WLUA 4TXMA 5EQJB 1PJ3A 1ZN7A 3WAKA 2JVIA 3THSA 5CB4F 1H2RS 4O1HA 4V02A 3HI4A 3ZC3A 5KS2A 3IAHA 2E5WA 1TAHA 2BM8A 2WJHA 3LLCA 2O8VA 2DWPA 4NDAA 1YV9A 2NTNA 4IGIA 2WF6A 2H0AA 3PXEA 4TXNA 1HO3A 5CDFE 2A0UA 5FA5A 4AWBA 3NAZA 3S2FA 3CIFA 5TF4A 1DBIA 1BN7A 3UJCA 3MBKA 2HJ9A 3Q85A 3HVRA 1Z2AA 3AKDA 1NFRA 1P0MA 5CW1A 5AHXA 5IJ0A 2AUMA 3RTEA 2YMLA 1ODTC 4J03A 1S3IA 2Y1OA 3ACBA 4TWBA 4DCUA 2VHEA 1K7XB 3ES9A 1GUFA 2ZT5A 2AX3A 3FRJA 4KQJA 5ARBA 5JZBA 4QGHA 4DS3A 1O94C 5ALMA 1CUFA 1NVUQ 2F2TA 3NVDA 4RDXA 2ZCJA 4KH0A 4Y6PA 2GK4A 3F2VA 3STVA 1XDWA 5JDIC 5KC8A 3EFOB 4RPCA 4S1OA 1T34A 2YZ7A 4ZYWA 1E2DA 3L3BA 1JR6A 2Q8QA 3HWSA 1I9GA 1EVZA 3G68A 5IVDA 1S6YA 3HJBA 5K3DA 4AZVA 1PX2A 4G4JA 3GLGE 1F0KA 1NF8A 3KYDA 1NI5A 2GAFA 3T4XA 3ZCQA 5KU1A 5HUQA 1VXRA 2X40A 1Y5IA 1YZYA 5LZ5A 3AYZB 2LIVA 2Z8XA 4GBMA 1Q0ZA 1KE1A 3V33A 1IOVA 4YNBA 3AHHA 2A3RA 2H8GA 1YR3A 1B0UA 4OOEA 5ALLA 3H2ZA 3CJTA 1TUGA 3FCSB 1JDPA 4MUXA 2Z09A 2NZUG 5F7ZA 4ENRA 5CXQA 3EIEA 2ZRCA 1KP3A 3L7LA 3GXOA 3VRHA 1QDUA 1NF9A 2RK4A 4ADSG 3QVGA 2IITA 3ESBA 2DJ5A 4LHSA 2IYQA 5JSFA 1J1UA 3CLTD 4KO3S 1SM4A 4IAOA 3G89A 1ZGAA 1A88A 1MABA 4WOPA 5BV7A 1CUJA 3B6JA 3GT4A 3I4FA 4WEQA 2DCMA 2E4YA 1A8HA 1UMBA 3EIUA 3N1UA 1U6IA 4TWRA 4BQOA 5EJ9A 3TNYA 1OR8A 3IIIA 4EI2A 5J2UA 2H2HA 5ER9A 2F3QA 4KCGA 1U65A 3JQBC 3A0RB 2LCQA 5CDHA 5KKCA 1CQJA 1X7HA 2H4XA 2PVPA 4KR9A 1QCCA 3PIIA 3EH1A 2OYRA 4E15A 5IDWA 1OLXB 4F3NA 1ZONA 2VYQA 3DOHA 3JWJA 2MJLA 3DBVO 1V7QA 5NLLA 1UPAA 2NV6A 3A26A 3AHGA 4DV6B 3PT9A 4G23A 3QRWA 3K05A 5JWHA 3WY9A 3G5MA 1YJ8A 1KK3A 1QDLB 2BRUC 2AZ4A 2J3IA 2PV0A 3QX7A 4KDEA 4C76A 2W22A 4IWNA 3E58A 4LJSA 5CCBA 5JXGA 3IB6A 4KK4A 4MK4A 3GYBA 3LHKA 1U02A 1HY3A 1EB9A 3ABZA 3CZRA 3TRKA 4Y2JA 5HG0A 1C3XA 2ZRPA 2ZXFA 4EGFA 4EW1A 4Z7QB 2J4FA 1PVDA 3RFTA 4F92B 5DSZA 1BZYA 4MUBA 2XZDA 3GCXA 4YQYA 4P82A 5LVAA 1GOTA 2YDYA 1PQUA 1PR6A 2Q3EA 1N1EA 1OWOA 2CL0X 4CV2A 4KPEC 3ETEA 4P2BA 1W48A 3K9LA 3U16A 4HFMA 2X5NA 3M82A 5J4YA 3GLUA 2ZK7A 2QN3A 1E2PA 3ETJA 2I7VA 3PGKA 5FJIA 4BBZA 3M81A 3GOQA 1FJGB 3HDQA 3DR3A 1WBJB 4HC4A 4IVQA 1ZUNB 5HMMA 1NBMA 2FETA 1NFFA 1NVFA 3DTTA 1JGTA 1I36A 2JGJA 2WJ6A 5CCEA 3A3OA 3RFVA 6PFKA 1LNSA 1H0KA 1NXOA 3OE5A 2PX0A 4KXWA 3U9LA 1I2AA 1QH1A 3M89A 4D9BA 1NTRA 4DVJA 1ZVMA 4RAQA 2IXAA 1H0HA 3TS1A 1N7GA 1W8IA 4I1UA 4BQPA 3O9MA 2B8EA 2ZJ6A 3IUEA 3O9VA 3S3TA 4PM4A 1CJMA 1FP2A 2A33A 3H7AA 5DYTA 4IHKA 4UUBA 5FTJA 4YA6A 4WXRA 5KOIA 2PNJA 1YJ5A 1SU7A 3JQRA 5DVZA 4Q7QA 3N28A 3EUEA 4IGFA 4RTQA 1L5HB 4HWGA 5JMPA 1ST3A 3AFIA 3FGPA 1DSSG 2X19A 3RQSA 3ANMA 2PJRA 1V1RB 1N8TA 2BL4A 5K45A 1CE8B 4X0EA 4MR7B 3CTMA 3R0XA 4ILKA 2GNPA 3V80A 5TDHA 4NECA 5CW2A 1Q74A 4YLGA 5JY6A 4D0GA 3G2OA 3TPFA 3IP5A 4BQIA 1A8SA 2WB2A 3GN2A 3BIWA 3GA0A 4G41A 2ZJBA 3I37X 2VK8A 4S1WA 5DT2A 1X7GA 1BS2A 3G59A 2NV2B 3MB8A 4TV8F 3PPYA 2ZBUA 1OZAA 1I4DD 3AESB 3QG1A 3HUDA 4Y2YA 5JATA 2BE9A 3R09A 4R01A 1T9GR 4C01A 1LBHA 3INYA 3L02A 1NZJA 1SOWA 1VKRA 3EA0A 3EZYA 3L7NA 5F3RA 5LQMA 2XMQA 4GSLA 3UJ8A 3HDTA 3L0DA 4M0CA 4V2IA 2IYPA 4UEQA 4B5KA 4J0JA 2WMOB 1MUUA 3ZQ6A 1HG1A 3QHQA 4JS0A 5BN1A 3R6GA 3SDZA 2BHRA 3STTA 1H2YA 2LGJA 2R1UA 3BE4A 3JVIA 4W9NC 4X8MA 1FLVA 1CKEA 3MELA 3WGVA 2GLTA 3IB3A 4LJKA 4BNIA 4BMVA 2BR3A 1VKOA 4JENA 4ZT2A 3NBFA 3BGVA 5FUMA 1ZC3A 1PQWA 4WNYA 2JIZA 1E2NA 2J32A 4XVHA 1TIPA 4L75A 3UC5A 3V9AA 2GN0A 2WNHA 4F12A 2FB9A 4ZDJA 4QARA 2HA5A 2F8SA 1UQRA 4OQEA 4PY2A 4KGVA 3V8QA 4QOFA 1YCFA 5ALTA 1D2EA 4DKJA 2P2CA 1SK8A 4F72A 3A9VA 4EB6A 1BW9B 1MGOA 3MC1A 1XA3A 3HU3A 1JG2A 1N6KA 3FIJA 4MVJI 1QVAA 3WLAA 4BEJA 5CFQA 1FNCA 1YQ9A 3G0GA 4XSHA 1XI2A 2PFKA 2V0CA 5CLGA 4B85A 3KFLA 5BN5A 5L4NA 3C6BA 3DTVB 3IPLA 3G9TA 3JQGA 2NO4A 3MNFA 4HAYA 3OCUA 4HOYA 4MLCA 5G4KA 3X0DA 4JBLA 4YHHB 1J5PA 3DJYA 3M7IA 3GVCA 1T6YA 2KE5A 2ZLBA 2HD4A 2CN1A 4EY3A 2H5IA 2K5UA 3K8OE 821PA 2R47A 3MRTA 1JSZA 4AVYA 4RGQA 4YO8A 3TI7A 3DXZA 1Z0ZA 4DUZB 3WXBA 3LYLA 4I5FA 1GTVA 2CFCA 3F2IA 5IXYA 3VNUA 1ZD8A 1JG3A 1V39A 2E4WA 1L7OA 2O23A 3IEXA 4RADA 4B6QA 1AKNA 4ZV7A 2AF3C 4YRFA 3KQTA 3P71T 5YASA 4KZPA 5JTTA 1ZD4A 1VJCA 4AJJA 1SKMA 3MUOA 1S8NA 2PXXA 3EMBA 3IMKA 4KVZA 1JYSA 4RAOA 4QXMA 4D7AA 3IJRA 1GHTA 4FFLA 4OHCA 2IYAA 5JCOA 4ETIA 2CV2A 3NPMA 4GM4A 3PHBE 4XCXA 4RD4A 5F76A 2EHDA 3COPA 3I32A 1LI7A 4Q66C 4ZANA 5FOUA 3RB8A 2P2SA 5H02A 1E3EA 3TQFA 3HWX1 4UTZA 2QVGA 3EWIA 3OLCX 4BFXA 2Z58A 1Y9DA 3ICQB 5A5EA 1WXHA 4TM7A 4ZAZA 4BBJA 1GCIA 4WLOA 2GETA 2VATA 4R1PA 5L3ZA 1YBFA 4BVEA 2BUAA 3WGJA 2G6BA 1M6EX 2VF8A 2ZSEA 1D07A 1YD7A 2PA3A 4FZ5A 4B7CA 3T3IA 1G3IA 4GC9A 4KXLA 4MWCA 5BV2P 1E3TA 3PQ8A 3N86A 5DK6A 1KE2A 3IPXA 4G3XA 4YMVA 4MLZA 2H59A 2A58A 1GSHA 3KQSA 3P0HA 4PTLA 2WKQA 4R69A 3VFDA 2ZM6B 3O21A 1T13A 1OFUX 3QPAA 4Q15A 3AR4A 4YVFA 3LNCA 4GWLA 2OAQ1 2C88A 3G8YA 3A6KA 2H0RA 2OAEA 3SS9X 4E31A 4HGRA 4YMTA 3CT6A 1Z88A 4NJEA 1MNQA 1OGYA 1ULUA 2XNJA 4FGLA 4CLDA 1SOAA 3H65A 4NQRA 2VXCA 2WMDA 4QRHA 3CE6A 3LGSA 2J0UA 5LR6A 1KAHA 2FAXA 3AM5A 4RSGA 4X3OA 4CMGA 1WO8A 3EFOA 2Q4RA 1C3OA 2QYSA 3NHWA 2PTGA 2ZVQX 4HB4A 4MQEA 1HFJA 3VZDA 2VDUE 1K6XA 2L69A 3AY6A 4NJEB 1ZK3A 1FLAA 1LI5A 1SUBA 1B1AA 3WHPA 1YBHA 2CXUA 1Y1TA 4D8UA 4NDNE 3ONDA 3VR2D 4GQIA 3IKVA 2DC1A 2GS9A 4Z3OA 4RHEA 2FZ5A 3ZDFA 1HNXB 1KH3A 1N4DA 2O8DA 2EFEB 4P81A 1BTOA 2XX3A 1SBQA 4A0HA 5T41A 2D5AA 3AVYA 2X3YA 1CHDA 1VMEA 1VJ0A 5AVTA 4P31A 1XHLA 2YASA 1FRFS 1KDPA 3I04A 1OLOA 3DMTC 4YRNA 3R4VA 1RXWA 3IKMB 3V8BA 4LZPA 1JE1A 1OXSC 3FW1A 3R5TA 5TJHA 3V1UA 1XMOB 4LK3A 2ZJ5A 4XEHA 3F6SA 3H13A 4N41A 1IH8A 2OCYC 4LGVA 1ZUD1 1YA4A 3A14A 4BB6A 5FBHA 1J0BA 1FFXB 2XUJA 4CCSA 3FI0A 2QZZA 4P22A 5AUPB 5L45A 3FYUC 3C3KA 5A62A 4G5SA 4CM4A 1YR2A 1V6SA 5BYJA 1T3TA 2HMTA 3ROTA 4II2A 3SZUA 2IUEA 3RCBA 4D9MA 4GLOA 1OC2A 4I50B 2AEMA 2C7VA 4NZZA 3TRDA 2I6XA 3FVWA 4N7JA 3NC0C 2JFZA 5CLIA 1YFZA 1IG0A 3H99A 2PMWB 4BX0A 5IJXA 1Y6GA 3ZGZA 2BMWA 2OV8A 4WWHA 4LYJA 3AF6A 1NNLA 3F5FA 5DRTA 5EIHA 5CPFA 4I8IA 3X43A 1XDUA 2JFGA 2D1QA 5IU6A 2YMPA 1KBZA 5K5EA 3IV9A 2IP4A 1RW4A 3ZNPA 1Z6GA 2I2AA 2FDRA 2Q99A 1J8DA 1ZAKA 2CF6A 1TQ4A 2NN3C 3H8JA 4GX1A 4RK7A 4IDNA 5GOTA 4M7WA 4A6XA 3NYWA 1XO1A 1JFLA 2FQYA 1C0PA 2YFQA 4W7SA 2XCLA 2PX8A 1DIRA 2G71A 2NU6A 5THQA 1JZQA 2D5BA 2QP9X 1GAQA 3BXOA 4JQCA 5AJTA 2XKJE 2O20A 2CXTA 3KX2A 4LQLA 1DIBA 5H68A 5KTNA 4EELA 2GPJA 2XRYA 1ZL0A 4V3CA 5MF6A 3AF1A 3SJZA 1CK4A 1F20A 1ECBA 2HRRA 4YRBA 2H5JA 1MH9A 2CFRA 2PLWA 3L5KA 1G20A 1V2GA 2O1XA 3E2PA 1GQRA 1SXJE 2QROA 2Q3HA 3C98A 2PPVA 2AEFA 2A4KA 2WE7A 2WHRA 5G02A 3K30A 4FWBA 4QG3A 2QR5A 1EIWA 4RDCA 1EDEA 4KN9S 4BLSA 2OHFA 5F3WB 421PA 3GRAA 4ENTA 4B34A 2FZEA 1QF6A 3RSHA 5KNCH 3NO4A 1QAOA 4KDRA 4JJ8A 3HJCA 3IBTA 4L9RA 3OF2A 4BVAA 4C6TA 1BXGA 1KVQA 3RR2A 2QPTA 2A9KA 2VS1A 1Y6ZA 2CNOA 4U6SA 3UB2A 3WIVA 4WBNA 5GVRA 3RDPA 2CFTA 2KHZA 2A9QA 5CB4A 5JCZA 1GPMA 4MZDA 5JV5A 5J2TB 2EW2A 4HWPA 3NHZA 4C7KA 1AIPA 1AKYA 2O5RA 1OPRA 3PLRA 1H2AS 2CZGA 1LQUA 1VG1A 2CVHA 3D0QA 3H3FA 3OQIB 4O2AA 4RVGA 2IH4A 2QE7D 2Z08A 4O4JA 3KTDA 1VI2A 3S28A 3FUVA 5FFNA 4B3BA 4E2YA 2HSEA 2W70A 1GQSA 3W2IA 1GQFA 5KYUB 4C2UA 5F9HA 1YZFA 4ND2A 3D4LA 2IHNA 2WSSA 3HJGA 5FUVA 2LRHA 1NURA 3T94A 1IJFA 4IDEA 5DCYA 2C5SA 1YRHA 8LDHA 1ECJA 2NSDA 2AR7A 2WUFA 2ZYAA 4PV7A 2FJ0A 2JIOA 1YJXA 1VLMA 4HGQA 1AGRA 2V0NA 2FQWA 3UUEA 2VP3A 5CB4B 1XZJA 3DEAA 3G5AA 3TINA 5JAPA 1MOSA 1U3UA 4PQYA 3LPLA 4E7PA 2JH9A 4QDUA 3CH5A 4ZVVA 4IUDS 1T9CA 3INTA 3QJYA 4KEAA 4FKBA 2ZG6A 3X1ZA 1TZCA 2WPDD 1HQDA 4K28A 4LZOA 4AJLA 3L1JA 4AX8A 3EGVA 4QUIA 4LJYA 3DW3X 5AUQA 4ILEA 4MUEA 5CM8B 4YRPA 2R0QC 2FSHA 4WL0A 3PXAA 4XM0A 4FJ2A 1PV2A 2X7HA 3MPOA 4H4DA 4UTOA 4B87A 4I6JA 3LC0A 1MDFA 1EP3B 4R1QA 3HV2A 4LBVA 1YHYA 2O19A 3LQ2A 3AFNA 1W34A 3A6LA 2P11A 1OIXA 3DL2A 3Q3HA 4JKIA 4N40A 3VYSB 1QK4A 4F1WA 3BXHA 4PNPA 2BDUA 1XEFA 1S01A 2X8JB 4JUCA 4RQBA 4BNKA 3THWA 3QU5A 2XTAA 5DB4A 5J4KA 2XT9A 1TB4A 2JGIA 4B4VA 4JZKA 4EJFA 1YFKA 4HPWA 5LU9A 2F1IA 4D3DA 4B8ZA 2FI1A 3TBHA 1A98A 2PYZA 1OGIA 5F51A 4C4XA 2NZXA 1KZHA 4R41A 3B9QA 1P0CA 3HFSA 1L8QA 3B3GA 1FFDA 1UBRS 4K6MA 3S2YA 4QUAA 5DKFA 5F2KA 1HDXA 2RKOA 3PNPA 2CT8A 4JB8A 1IWOA 3EGEA 1PTJC 1ND6A 2GT1A 1T8SA 4IV8A 4Q48A 4XQ0A 4PSUA 5LXTB 2PUCA 2JASA 1N9GB 1TA4A 4OJNA 2O0MA 3TVTA 5L6MB 4NPAA 4JD5A 3WGHA 4EGSA 4EPTA 4U4AA 1IUKA 1LY1A 1RDFA 2Q7OE 2CDBA 1CPYA 5DYYA 1FLDA 1BCSA 3U5TA 1NDQA 4JJGA 1P29A 1IY0A 1X2EA 1GGVA 2D06A 3AEZA 3OEED 5JMOA 1LC3A 3BUSA 5KNBD 4AKHA 1G16A 4OFZA 5J9FA 2AE1A 1TW3A 4BNWA 4II3A 2H54A 4CUJA 4P86A 4ER7A 2OOSA 2F3TA 2QS9A 3NYIA 1V2HE 2AFHA 1SQ5A 4P8RA 5GOZA 1X0XA 1Y3HA 3NVAA 5IX8A 1J9ZA 3UV3A 2R84A 2EZ4A 3A1FA 5HF8A 5U1PA 1PU2A 3GLFA 3LU1A 1E7WA 1V48A 1QQTA 4OJYA 2CLMB 2E21A 2Q5JA 3L4JA 2B2NA 5THKA 1Y98A 3NC1C 4CR6A 4AKEA 1NVAA 1BDBA 1ZC4A 2CSUA 2V7WA 3ZI0A 2OLJA 5CG1A 1R5NA 1DCMA 1YQEA 5JXJA 1E58A 1EK5A 1GGFA 1FP4B 2NXWA 1UWVA 3E22B 4PIPA 5EWMB 4EVRA 5F98A 1M2KA 3HLKA 5J43A 1MEOA 4UUQA 2YVUA 4C0LA 4F6CA 5K0SA 1J99A 1T35A 2Q6TA 2R8RA 1FSSA 3M4JA 2CBZA 5LOVA 1CLEA 3PJRA 5FPQA 4Q4JB 2GBFA 1UUFA 5B55A 2L42A 3ZWKA 3K0EA 1KIFA 1QCYA 3H1PA 3I9NA 4OQMA 3KQLA 5D3ZA 1ORRA 1P4AA 4J76A 3UNXA 1DE0A 2P79A 4BC1A 3CUSA 1E4EA 4Y6RA 2V3CC 2AN5A 3GRKA 5ENZA 5IXJA 3IAM6 4Z3KA 3PL1A 6AT1A 4IPTA 4E22A 1S4MA 1E2EA 2JZCA 2W11A 4PC2A 1D7AA 1FA9A 1VMIA 2H7YA 4Y1EA 1FNDA 1GPAA 4X7BA 1XCGB 1SUWA 1LDGA 3OPNA 4MVJE 3LC2O 3GG9A 3ZU3A 4UDYX 2GCGA 4PVCA 4P80A 4P4UA 1FP7A 1YF3A 3N58A 4JT8A 4EUFA 2O6LA 3HZOA 2G4LA 1RKVA 2CL5A 1BWRA 2GJSA 3KOZA 3D81A 5EEGA 2A14A 1N2BA 1SXJC 4MZXA 1OT3A 2O2XA 3AV3A 4GW3A 5JJIA 3B78A 1PFWA 3ROQA 2EFHB 3SBXA 4BNXA 2VHXA 3BRQA 3R0ZA 1OX4A 2DQSA 3MK31 4FIDA 1PGQA 4IVPA 5J2UF 4CCAA 2JGNA 2Z5GA 3I64A 1JPNA 2FOXA 4L6IA 3I05A 3EWNA 4ZVNA 1MG0A 5HYVA 4Q3DA 1GYRA 4IZHA 1ADFA 4J91A 4N03A 3U60B 2F4VB 5DM0A 5JZVA 3DSRA 1GG9A 2XAAA 3IOEA 4F2PA 3IBFA 2ANCA 1JFRA 1P33A 1F51E 3D7KA 1SU4A 1IPHA 5EHGA 4DG8A 4V1CI 1TZ2A 1Z3IX 1J8QA 2GO1A 2WJGA 4IUCS 4NCJA 2QRVA 4AF8A 4QBKA 4F4HA 1VIMA 1EJ2A 2FWNA 1P5ZB 4YCDA 1TTHA 5AJUA 2Z2KA 1V4BA 1OROA 2A9VA 4U3JA 1U3DA 1US8A 5M34A 2FUNB 3TWOA 4U2EA 1RU3A 3L8HA 1MAWA 3H1FA 3JQ6A 2DHDA 2H2AA 2Z4SA 4C3VA 1SBNE 3RYHB 4DCGA 1A8UA 5E6UB 3C1OA 3KDPA 1I3LA 2FUKA 3V4VB 2WJZB 1VHQA 3HNRA 3ZE8A 4POAA 2IS1A 5EMKA 1DAKA 4GI7A 5ITWA 3ONEA 2IHUA 3F46A 4P4SA 2VP9A 4MEJA 5ALKA 3NTLA 2XGOA 3KZKA 4G24A 1XYYA 3L77A 1OA1A 4R81A 2Q8PA 4BRWA 4PTYA 2YN0A 3CLRD 2XCQA 4BMOB 2CHVA 2BGRA 3BK1A 4OGKA 3MMXA 4LYFA 2NADA 4RPGA 5KZMB 2RHDA 3NJ8A 3TTYA 1QQ5A 1Z0IA 3B52X 4HQ0A 1NLYA 5ANRB 5KQRA 1H6CA 4JUFA 5MN5A 2CXXA 2QUJA 4Q1AA 5GONA 3VPFA 1J7KA 2H3HA 1PGOA 4HB3A 5EJGA 2JB9A 4H1HA 4EK9A 5HSGA 4D0SA 3KOOA 2E85A 1L7DA 1KH2A 2IPXA 3D6AA 3HWRA 3K72B 3ZIDA 2FR1A 3LT2A 2RHMA 2IHKA 1PQ4A 4MWZA 1WUJS 3RWBA 5CU7A 2XYGA 3F7TA 3HXQA 4ZEMA 3S8MA 1EM8B 2ICAA 1FXWF 5CH5A 2FH5B 2OUKA 5CITA 4JX8A 3TQHA 5HPYB 3SY8A 5ALFA 1PWHA 2DXIA 2O7RA 4Y9SA 4BVFA 3O90A 4BNLA 4Z4HA 4AG6A 4JJKA 3FHLA 3RANA 1M8PA 3SS7X 3NIBA 1BX3A 1NTOA 4LDZA 3LUJA 4KP7A 3RVMA 2A67A 1W59A 1E0JA 2N3ZA 4JJ7A 2RHTA 1I0IA 1GPLA 3HNPA 5SY9A 4D6YA 5ADWA 1JDNA 4RF4A 3L7IA 4TT8A 3QPWA 5CVDA 3CY6A 3ADKA 4RJKA 5J1TB 3VTZA 1JLKA 1X1CA 2J9FA 3SC6A 4C0BA 1ZR2A 3FRIA 2OYCA 3CZMA 5K6TA 4YREA 4QOSA 3TRFA 3LT4A 4KI7A 4GI2A 2QU8A 3G1TA 4XLLA 2GBCA 4LBZA 3UJ6A 3T99A 5I8ZA 1ZXXA 1EXWA 3LFHA 2XJ4A 4KLNA 1RI2A 4D5EA 2AKAB 4BE4A 5JRZA 3U7FB 5AO9A 3QEOA 1NU8A 1LWOA 2FN3A 3KFXA 1PS9A 3ZN2A 3PA8A 1CUGA 2PMCA 1P2FA 2AMYA 2XMSA 3QUSA 1T2EA 3ZZTA 4EMSA 1YGPA 2OESA 3C3XA 3ZY3A 3UY4A 3L1UA 2OQRA 4RZ2A 2ZYVX 1XVVA 3L1KA 2W8BB 2RC5A 2H51A 5K3SA 3CW2A 3IQHX 2WWHA 2N47A 2CXQA 1BA2A 4F2HA 5FPSA 2Q7XA 5ICSA 3FPFA 3BWCA 1D2MA 1RAEA 1F2UB 1GZSA 4EKEA 3TUIC 10MHA 3A7DA 3LXUX 4D98A 3KE9A 2X8BA 3P20A 5H80A 3C14C 1KYIA 3ZLJA 4R5HA 3RS2A 5FRDA 4AY3A 3GYGA 2VJYA 4M89A 2WHYA 4GI3A 4KN5A 2SICE 4L76A 1UAAA 3AVQA 3GHYA 3H8VA 2FRVA 3KEQA 2O8EB 2L2QA 4E70A 4UEWA 3DBHA 2VH1A 4NV1A 1LNQA 4TRRA 3UAWA 3RYCB 2V9PA 2C97A 2ACWA 3KVRA 1KK1A 1BE8A 3KUUA 2IY8A 5BVGA 3EXHB 1F06A 2G9VA 4GP7A 4IGAA 2JJ1A 4KO8A 2B98A 2KBEA 4XDZA 2JLWA 3P0FA 1E3DA 4OGGA 2XCRB 4NWIA 4M37A 2E87A 4HQLA 4LKRA 1UFRA 4EGCB 1PZFA 2TMKA 3N75A 1QS0A 3CVVA 4PIVA 1KYTA 4P98A 4AYXA 2V0GA 3N0RA 5K8JB 1XD9A 4US0R 4JSTA 4RPHA 4YJ2B 2VSYA 5ALRA 2IU3A 4Z1OA 1RLMA 4AROA 4HG2A 4RVCA 2Y0PA 3BSWA 4XYMA 4A73A 2WVHA 4NMLA 3EXFA 1EMDA 2PRIA 1E4EB 4IXWA 4IV5A 2OD9A 4R6WA 1TK9A 3T4UA 3KSAC 3EPLA 2J7PD 4CMJA 3NANA 3A9RA 2V7VA 4DMUB 4UU0A 4ER6A 4BRZA 1Q0TA 1N0VC 4FDLA 5C18A 2VYND 2PD6A 1DDOA 1O77A 4CLXA 1SEPA 1L7QA 4DQVA 5J3JA 1YDHA 4L08A 5EINA 5KBYA 4KYTA 3V42A 4BO5A 3SDSA 1UWCA 1LGYA 3NZEA 3VO8A 4C4TA 2J6HA 1DMRA 2JAHA 1IVNA 3BBPA 4MYUA 4DM7A 3KT8A 3JQFC 5DNCA 5HUJA 4R1TA 1L6IA 2V8BA 4U9UA 4DXDA 4OI2A 1RLIA 4OQYA 2ZTHA 4OD0A 3BQ9A 1QP7A 1R1DA 2K87A 2Q0SA 3IUSA 4MUAA 4XUCA 3FHTA 3HO6A 2DPXA 4J0EA 4LS3A 4L5CA 5AK4A 2NNWB 2ZSFA 4RK5A 4LY9A 2A86A 3QE3A 3F8WA 1ID1A 5G0VA 5CA0A 4MUJA 2VTKA 4D4JA 1U2DA 2J46A 4G5XA 4BO2A 1WMSA 1YONA 2N1BA 3AUAA 1UM9B 3BXZA 4RLHA 2H7VA 2J3EA 2P4QA 2HGZA 1Z16A 2ZUUA 5KYTA 1U8AA 4ZI7B 1JDSA 4X20A 5IVKA 1O6GA 1QLHA 3AIOA 3NAQA 4IHJA 1XNGA 1NSFA 1X8KA 4NTZA 1XG5A 4BRSA 5KWSA 2YRXA 1YJQA 3HL4A 5DWDA 2OFOA 3F9CA 3DAYA 1ENYA 4GPZA 4XH9B 2KPOA 3ANSA 3A2MA 3U3JA 1JWLA 3NBQA 1Y0BA 5C7OO 3NIGB 1WAMA 3WNDA 3DDCA 1WB6A 5FFMA 4HGOA 5D3MB 3WLPA 3OF5A 1AS2A 1WB9A 3RG8A 1JI3A 3CF2A 2CGEA 1PR1A 1ISPA 2CBGA 3KV3O 5ALOA 5K6AC 2V1UA 5JBNA 3AHFA 4WLFA 3CJRA 3HGMA 1Z2EA 1ZIPA 3H2SA 2WLSA 1G8YA 2OO3A 3DD1A 3HCAA 1Y5MA 1ZOSA 3AM3A 1K08A 5ALWA 1N9GA 3L82B 2Z5FA 4HDSA 4KODA 3VDNB 4P0QB 2CXPA 4FD2A 4XX1A 5T3YA 2FMTA 4Q3AA 2C5BA 2D0PB 1OX4B 1R0XA 3D7NA 4IW3B 4QBTA 3AR9A 4HXEB 3TW8B 1G0NA 1P7ZA 4M0LA 3R8CA 2V6BA 3DE4X 4LOJA 3RK4A 5ERYA 2YIJA 1Z6YA 1NJ6A 4WGGA 1F4LA 2NYAA 3I28A 2IQIA 4EA9A 3BWDD 1IG3A 3K96A 1EDOA 1OZ0A 4ND7A 2NO9A 2BP7B 3EPRA 3RRBA 1GTL1 2GCPA 3E23A 1UXGA 4ALIA 4YV1A 1PSWA 3UATA 5I7FA 4CEIA 2OSVA 3D3JA 5HTKA 4D82A 5DNYB 2I03A 3QU4A 3BMOB 2C04A 4CT5A 1BDHA 3UOWA 3OCXA 1P5RA 1J33A 4O29A 3GAFA 4JA2A 3RJMA 3U1BA 1SGWA 1HG0A 1MAUA 2J30A 3IHWA 1ZN2A 4RMHA 4IEIA 4ES6A 3SSNA 2IS2A 3UHFA 1FXUA 2J87A 3HCEA 3M6VA 2PZLA 4MRVA 2XCUA 4J43A 4W6ZA 4KAXA 1E0KA 4E5SA 2NO0A 5AWFC 2B3TA 2WBLC 3EEIA 3INNA 4HXGA 2VNKA 1T0UA 3CUYA 4N76A 1L7MA 3X2EA 2ETVA 2EF0A 4C5CA 4TTSA 4LJAA 1EK6A 2X42A 2R9VA 3UK0A 5A03A 4D79A 1LRKA 4UCWA 1Q0LA 3TEMA 1G7RA 1OFUA 3V7YA 3RJTA 1Y3DE 3VKUA 4Q6WA 3GOHA 1QH0A 4PXAA 4C22A 2GF0A 4J4TA 4B3XA 2BBOA 2HWKA 1E1RD 4RA9B 2G70A 3T9AA 2REOA 4UFNA 2HM7A 3UFXA 1H22A 4I4IA 4WRRA 3JYPA 1XRPA 1N32B 2CMFA 1U2SA 4YMLA 1H1LB 4TOIA 5BYBA 2AX4A 3GMIA 4COKA 2HMWA 3KKMA 2PD4A 5EP4A 5LP6B 3B7WA 1RRMA 2XZPA 3OM0A 3ICEA 1KP2A 1MX5A 4MV9A 2QLNA 2RAUA 5IC4A 1XNQB 2WSIA 2Z1NA 1U90A 2RHGB 4RACA 2G1KA 5K8TA 1UINA 4EFMA 5B1DA 1JKFA 3ISVA 4WCFB 3SJ7A 1U2GC 1VG8A 2AV6A 2YX1A 5JSHA 2E4UA 4CLEA 3G0IA 3BPSA 1FDWA 5JRJA 4CG2A 2R85A 2VT6A 3DHEA 3VZQA 3TB4A 1V3TA 2WTBA 3ZXSA 1MV5A 1THTA 3PTZA 4FUQA 4ZU1X 2RFLA 2QI9C 3DKRA 2RGUA 5LZ9A 2P4SA 2YZGA 3ODGA 1B14A 2X0IA 1M83A 4KMMA 2DT5A 4C30A 5JJBA 1SZCA 1AURA 2H1VA 3PI7A 2WABA 4JGGA 4JMPA 1ZOLA 4UMFA 4BECA 3LCVB 4OK5A 3LY9A 1GCOA 4PBRA 3VU0A 2BHNA 4NBRA 4OHWA 1KDVA 4TL7A 4WCDA 2X4LA 3JARB 3AZOA 1GDDA 4BNUA 1GA1A 3CXRA 2B7LA 3P2JA 4ZO9A 5TB5A 1ZHOA 2EP7A 5BSWA 2FY8A 4PNHA 4MQFB 1K3TA 2OO5A 5C4GB 5JJLA 2R7NA 4UATA 4RCYA 1ZHFA 2GCIA 2YWDA 2BYTA 2VP6A 1ZVVA 3MSCA 4MPPA 4H3KB 1V41E 4K6GA 3QBDA 1ZGGA 4HNAA 1I3KA 3SC3A 4MYDA 3EVCA 5AXDA 4A16A 3DE7X 4TSFA 2ZRIA 4JI2B 1NJ5A 1Y3IA 1ZKDA 1V9CA 4HEHA 4TV9A 3OEHD 3VHQA 4JUAA 3A25A 2Y99A 1UPTA 2VT3A 4RTKA 2FZGA 1YHNA 2NG1A 4Z0HO 1B26A 5A4IS 2RC6A 2HYIC 3PXUA 3FOFC 4JVSB 2A0XA 1ZU4A 4LTMA 2GB4A 2LKCA 3MHPA 4LYYA 3L93A 1JU4A 4L15A 1PFYA 2XPCA 2BELA 4O4HB 4K5QA 1JDUA 3Q41A 4WAUA 1RAGA 3WXMA 4B0PA 2V4MA 2WY2D 1ELOA 1O95C 3ILVA 4R2LA 3T7RA 4AZSA 1GPJA 2VHWA 4NOJA 1R7RA 3GG2A 1QHFA 2QMZA 4PAWA 4E2ZA 4ROSA 5JSQA 2PGDA 2O4UX 4ZCRA 1QUEA 3WJ1A 4TYPA 2XUGA 4HDAA 1CY1A 3JRWA 4QTTB 3R5FA 3VUFA 1VI5A 3GCGA 4JLPA 4P3XA 2CNWD 4G84A 4MO2A 1TO1E 1RM5A 3I4LA 1BKDR 2WJ4A 3FUWA 1N5LA 1P1IA 1FRNA 2FRDC 2HTEA 2IP1A 4C5AA 2QX6A 3EGWA 1K7FB 3RUEA 3QENA 4J2OA 2HY7A 1UKZA 4YP7A 2WFLB 5HA5A 4HNHA 3COVA 1KZ1A 1GFSA 2PS9A 3PFCA 3IR6A 4IY1A 3SVZA 3V4FA 5IT4A 2ZTUA 1ESCA 3FLBA 4HQFA 3I2FA 3T1VA 2DQKA 3NV7A 3H9GA 4R40A 1YMVA 4CQMD 1PEAA 1DL5A 1H65A 4KRYA 3MAAC 1XCPA 7ADHA 2ZS7A 2WWGA 3CFYA 1XPRA 5E0OA 3EQZA 1XKXA 3H9EO 4EYEA 5F2NA 1KYQA 5F5LA 5AOVA 3E4DA 3LUAA 3K4QA 1JHMA 3HYRA 5KOHB 2ZU6A 2V65A 2FSUA 2JLAA 3FPAA 3EEBA 3PKJA 3PU6A 2M6LA 2WKPA 4IS2A 1E3JA 1V0JA 2XUDA 2ONZA 3LF2A 2PT7A 3FI9A 4PZ9A 3V4SA 2RAVA 4OMUA 4DTCA 1ZK1A 5CIQA 4YUWA 4K46A 4HHEA 3OQPA 2FQXA 4DLXA 3P0JA 1W35A 3I12A 3LHIA 5AHOA 1DKRA 4MEBA 5LDHA 5AI4A 3MWYW 1SG6A 1M8JA 1PL6A 1PZGA 1NN3A 2YH2A 4FNGA 3SEQA 4DDMA 1HR0B 4UQOA 3G1UA 2AXEA 4P3KA 5ALDA 3ZHYA 5HK9A 2I2FA 2ZE5A 1WMDA 4LXHA 3T5PA 4BCCA 4KJXA 3IOCA 4AJPA 1HSOA 1KZ9A 5AVXA 4G5YA 4MQBA 4YJDA 3U40A 1QMGA 5IJ0B 3T41A 4RHTA 1GRVA 5JAQA 3FOBA 2I80A 2Q3BA 3H1TA 1H5UA 5EYPB 4YCAA 2H16A 2QD3A 2D5IA 4LC1A 1XL1A 5K0LA 4M9SA 1X86B 1E3LA 3IAXA 3ND9A 4COOA 3CRMA 1AK9A 1QUFA 1USWA 2QSUA 3DVQX 4XRRA 5DISB 4NV3A 3NHYA 1WA5A 4XQEA 5IXSA 1FFBA 1HFWA 2B4AA 2IYOA 2AD1A 2QG4A 4QDOA 3CVOA 5FL3A 2E4XA 2AQ8A 2J9RA 1DAMA 3ADCA 1MF7A 2QR3A 4YJ3B 4HR7A 4B7AA 1AF4A 1GM5A 3TDKA 3DFFA 2XHEA 3E9ZA 4K6OA 1AX9A 3OLVA 4J7XA 1QGED 1QORA 1C9YA 2KWIA 3MW8A 4NDZA 1TYBE 3CLVA 3TIFA 1Y7TA 1U4NA 4CIAA 4RCZA 3WRWA 5TS3A 3GHHA 4LGMA 3H3XA 4OX9Y 1DAHA 1PFQA 4MIYA 3G7SA 2BKXA 1QYXA 2ZI6A 3FH0A 1IU9A 4JIGA 4OQXA 1LDNA 2IUFA 3BZUA 3GV0A 1UJBA 2IUSA 5EGNA 1G3UA 2DFLA 5JSZB 4KQ2A 2YXPX 2QNIA 4BAZA 1HQKA 4XRGA 2D4HA 1D1QA 3D64A 1MPXA 4PRZA 4BU1A 3FF1A 1GYPA 1TE2A 2B99A 2IIPA 3FPHA 3NGXA 3CKMA 3S2EA 3L92A 4ZKDA 2ID7A 1Z22A 3VPCA 2XKBA 2C9OA 4LVUA 3OIDA 1P1KA 1Q21A 4MV4A 3WJ2A 3RAGA 1M1NA 1MB0A 5FOQA 2ZSUA 3LD9A 3LBIA 3PCTA 4LNUB 4PS0A 3OH8A 4MIKA 2JBAA 2O8CA 1CJBA 3ZUPA 4XCVA 3IIEA 4PSDA 4MDYA 1K7CA 4XGRA 2BSQA 2HJHA 1DPFA 4QQFA 4MS4B 4ZCSA 4EY4A 3KPJA 1TVCA 5K0GA 1J2YA 1G7TA 3FY4A 3AF0A 1KRXA 4BVBA 2XZLA 1FUIA 4ZICA 3VISA 1DWQA 1H6DA 5FBZA 3AK4A 1S5PA 4RK4A 3CQ9A 4A4DA 3ZDCA 2WVJA 3RFXA 2I6QA 1ZHHA 3BYZA 4HFJA 1XRMA 4IX9A 4KQ6A 1D2CA 1UC9A 3SR0A 3H05A 4BZZA 1NR5A 5A2GA 2G1PA 1DAPA 3PC3A 2D3TA 4YJ3F 1NLFA 4MINA 2C8VA 3F6RA 5AW4A 4K03A 1CUYA 5D5PA 5HM8A 5JNRA 3ELWA 3NP9A 4FFRA 1ZLYA 4DLSA 4URVR 3DMPA 3DF9A 4D42A 5IS2A 1PTJA 4R51A 1PUIA 4BPRA 3W34A 1HOTA 4O2AF 3LQ1A 1P3Y1 4GRDA 1NHWA 3BIXA 3TLZA 4TYWA 1KK2A 4L16A 1TT7A 5F5NA 2RAFA 2QTVB 3HA5A 5FADA 1RMTA 3HM9A 2Q45A 1EBFA 2C9CA 4X45A 3VX4A 4I19A 2WQZA 1E9EA 1NC1A 2QX7A 3G5UA 1P5HA 5LJIA 3PUWA 2VTEA 3CCFA 1ZAYA 2D1RA 4MUNA 1NJGA 2PGAA 4JJEA 1N2OA 4CTKA 4MHTA 3QOYA 2XZTA 2ATEA 4RH0A 5GJCA 4AECA 2HW8A 3LLVA 3MCUA 3JCZA 1KMQA 3GJTA 3FRHA 5C3UA 4XR4A 1PQYA 5CMLA 3GLTA 2WKSA 4GOKA 3IFSA 4BJ1A 2ECQA 4OGFA 4D0RA 3VNBA 5BWMA 2OP1A 3WB1A 3S5JA 3ABIA 1MOQA 4OU4A 1WSBA 4J9VA 4ZVLA 1MTOA 3HM2A 4MI9A 4LF4B 4I1OA 4HSGA 3E22A 3F4LA 2H9AA 3DF7A 4M4SA 1SCDA 1I5RA 1E9AA 1PRYA 3DNPA 3O91A 2OENG 5AI8A 5TPZD 3Q7RA 4ENSA 2BEVA 2D0OB 1NMEA 1V71A 1EFPB 2GO7A 1SB8A 2MDTA 2WNIA 2YZKA 3FYUB 4QGGA 1G55A 2HR1A 3HABA 1A04A 2W8BA 5K3AA 4UUPA 3NKFA 2G82A 5SYNA 2TMDA 3L8YA 4CIDA 3QE9Y 1G8HA 1HBJA 2IV2X 3VZSA 1UKCA 2GXSA 3IGFA 2ZS8A 3GFQA 4TLMB 2CLLB 4X8OA 4Y1FA 3ONNA 4QPNA 2H7CA 1SD1A 4RKEA 3U26A 1EX7A 1EFRA 1V8OA 2DTDA 2GM3A 3B89A 3R41A 1Z47A 3UV7A 2VWPA 2CVZA 4CHTA 1E2GA 2FRXA 3IUYA 3TRJA 2SECE 3U7HB 4EP1A 3BTUA 1UP7A 4GKKB 4KXNA 4MIOA 3FTQA 2WV9A 2QJFA 1AA6A 3JZDA 1K66A 3JAKA 3IDSA 4FN4A 1KF0A 2AC7A 4NAVA 2AEEA 3DC2A 4QM7A 3ILXA 4JLAA 2VNAA 3ZS8A 2QQFA 1G2OA 2X8WA 3BG5A 2DE0X 2V03A 4MQUA 4DIOA 1GPUA 1FMFA 3DW1X 3D8NA 4R4JA 1E7YA 2D2IA 4Z54A 2HIAA 5I4IA 2GHQA 2GI4A 1HPLA 1MQ8B 4G37A 3NGMA 1DDIA 1ZU5A 3O38A 1OXVA 4EYGA 1DOZA 3GN1A 1S2OA 3FBGA 1GPWB 5LWQA 4LY6A 1ETHA 3M9XA 4HQKA 4KWHA 3ZBUA 4ER0A 4R9RA 1E61A 1T0PA 2QRKA 1F8FA 1RLTA 2FZKA 3PNVA 2X0KA 4MKZA 4QSHA 2Z30A 3L0PA 5CR9A 5TNXA 1E3QA 2P91A 4DFDA 4JBNA 3HBAA 5JNSA 4GBGA 2Q1TA 3KSUA 2V1XA 2W4IA 2XRMA 4ZO8A 3RAEC 4BPBA 1EESA 1LCIA 2PD3A 3PQ7A 5CP8A 1PR9A 1XZQA 2PL3A 2GKOA 4MARA 4NJMA 4TMYA 5F73A 2Q3CA 4F45A 3RSSA 2HKIA 4I3HA 4J29A 1BGVA 3CH4B 1LPNA 4Q01A 1JHRA 4JC0A 4AJ1A 3OP4A 3TFOA 3V3TA 1Z6QA 1W1WA 2SHKA 2WA1A 2YZMA 2P9HA 1W19A 4CL3A 1HGXA 3W6NA 2C0PA 3DKPA 3HBNA 4XUGB 4ZVMA 4EHDA 1EJBA 4QUBA 1N2ZA 2I8LA 2ZUCA 1V7CA 2EKQA 4G65A 5C31A 4X1YA 4BZPA 1HNZB 2W2VA 1E9BA 1IZYA 2Y2VA 5BSRA 3H8WA 2P1DA 1Z5OA 3A31A 3H2YA 1G8PA 5EWLB 1E8NA 3KLNA 2YOFA 1K68A 4RM3A 1CUCA 1WDTA 2J0VA 4FHGA 4ID9A 2JAPA 1H8HD 2X7JA 3PUKA 2ZJYA 4RD1A 2JI4A 4GXNA 4KQHA 4ACBA 1VZ2A 5DCWA 2Q9CA 2M1XA 5MGBA 2AUTA 4ZP1A 1NJSA 3LY8A 4JLWA 5H9WA 4DIDA 4PN7A 2CDAA 4CLRB 4FQ5A 4EABA 3IJEB 4LCJA 4RTSA 2RCNA 2F64A 1QG4A 2UZ1B 4PX5A 4KSCA 1KDOA 3QVXA 4RGYA 4F8YA 3AUJB 3KSDO 5AKZA 3UJDA 4B31A 4EYSA 5KKNB 1F5NA 1PJLA 2WP0A 4JBXA 1KQOA 1SC1A 2HU8A 5CLQA 4JN6B 2OUIA 1Z83A 4FT4A 2B8WA 3F3KA 1H6AA 1HQCA 2C3UA 3V8RA 5F52A 2YFYA 2PU7A 4RS3A 3ZWMA 3SX4A 1WCYA 5KTMA 2IXFA 1AHIA 4BKMA 3EXAA 1YBAA 2WD9A 3EGDB 4GRIA 5EIAA 1XN1A 3BMXA 1WXQA 1E9CA 4FE3A 5E38A 5JECA 2WU1A 3KTOA 2EKZA 2C00A 1QCZA 2R6DA 3R6WA 3OEEA 1HSZA 1FSFA 4JT2A 3WIUA 3K9QO 5AD1A 4W8OA 1QIMA 4URYR 2NSHA 5AQEA 4CTMA 1HWYA 2B37A 1VYHA 2YJ6A 1XOIA 3TL2A 4TL9A 2Z8YM 1KI9A 1GN8A 3KYDB 2HQBA 2E82A 4R1SA 2CUTA 3AB3A 3KC2A 1SC9A 1ZWKA 2B4TO 3HDHA 4NU8X 4DMHA 1E4VA 1XNHA 2CJFA 2FSVC 2VDPB 2YWJA 3E9YA 3OA0A 5HGJA 3VH2A 1QFXA 4RH3A 3ETLA 2GILA 2OCPA 4GE0A 2AN4A 2I22A 4BN4A 4PZPA 3M6IA 1ZGZA 5LLSA 5L53A 4AJ4A 1L1RA 2XRFA 3KPYA 2D0IA 4RS4A 4IZ6A 5DP2A 1Z33A 2ANBA 2FPIA 4QA9A 3X1MA 4MHSA 4UUMA 1NVVR 4LOIA 1MOPA 4JJ4A 4XFDA 4WKNA 3NR2A 2XB2A 1M34E 3F7OA 1IQUA 1EFTA 1KMMA 3WMFA 5JAOA 4JYBA 1NUUA 1USKA 3BMNB 1E2IA 1W5SA 4QT4A 4P38A 5AM2A 1K27A 2LCIA 1U3WA 2YVLA 4QNRA 1CUWA 2G63A 2B2CA 1OIVA 3UMMA 5TMBA 1TZMA 1TW2A 1XZFA 3KTFA 3IP6A 1BRTA 4HH4A 1ETUA 2E55A 4M88A 1E20A 2QMEA 3K0BA 1R0SA 4IXNA 4QYXA 1MJGM 1TLLA 5CT9A 4M1MA 1AQ6A 1R5BA 2NXCA 4HH3C 3KZCA 3R8FA 3HXOA 1EX1A 3GGJA 3Q40A 2CNKA 3DMTA 1T4GA 1FS5A 2XXAB 4X95A 1U04A 4OM8A 4QDXA 4ZHQB 1QHHB 3PNKA 5ELMA 3E5NA 1DRUA 2C96A 3DDOA 3LCCA 4IIBA 4C7VA 5KYNA 3ENWA 1T3HA 4W82A 4CMCA 2XYQA 2QZSA 3C3WA 1Z39A 1FE8A 4FS3A 4R9VA 4BO3A 3WKCA 2OGZA 2A1TR 2Q5OA 1KU6A 2R6ZA 4KAAA 2C58A 1W1UA 4U0KA 3WYGA 4M9QA 5GQSA 3UFXB 3LK6A 4IXMA 1FZTA 3K92A 1Y7HA 5A02A 3QA3E 2O54A 4HEJA 4K9PA 3NFYA 3HVKA 3PPIA 4LZAA 4Y0NA 5FEMA 1EFKA 1TJ5A 1LLQA 3G6KA 1NNSA 4CIVA 4FGJA 3ASUA 4B6FA 3BGWA 5KTRA 1U9ZA 8ATCA 1QFJA 3W8DA 5TIIA 3HCPA 3U4QB 1B0ZA 5GGYA 2A0KA 4WY8A 3UG7A 4RSRA 5B5SA 2J5KA 1C30A 1S2DA 2FWJA 3MTGA 3NBKA 2JNWA 2YOHA 3NHJA 4BQSA 2WJAA 3UAXA 1C7RA 2JJ8A 4YAIA 5I8WA 2C4WA 4DLLA 3QTTA 3OZXA 3ZUGA 1T9ZA 1J2EA 5F9MA 5F1YA 4LAFA 2SNIE 1JHDA 1KO1A 1N2EA 3IKTA 4NNPA 3THWB 3KOMA 4FFWA 1A9QA 4G1FA 4G0ZA 4NRDA 1VA5A 2FHSA 3N5KA 1VL8A 3ICWA 3DQPA 3DWGA 1N6NA 3EZXA 4EHJA 1C1XB 3EVNA 3H5VA 1IY1A 2A78A 1G5IA 3CNOA 1LBIA 1QKIA 1M6NA 3JAKB 2X8JA 3EF0A 3OP1A 5LSAA 1RIIA 1JBKA 1KORA 4YHBA 3L79A 3O3CA 2VDRB 1XHFA 1TQ6A 1G5PA 4BX3A 4KXFB 1T4DA 3AI7A 3LUDA 4E08A 1KO4A 3FPBA 5ELLA 4E03A 1G2PA 1T2DA 3KJIA 1G2QA 1AQJA 2Z6AA 1JWBB 4AKGA 5CDGA 4DV0B 1VJ1A 3AFHA 1C2YA 3K7EA 2NZ2A 3B2QA 3Q72A 5E8RA 5L4SA 1W44A 3L04A 1LSSA 1P4GA 1OAKA 4Q9LA 4Q16A 1UBCA 2O6HA 4EZBA 2EATA 1QRRA 1J0DA 5K0CA 1UXJA 1EFDN 1B3RA 4L3VA 4E2XA 4JU8A 1DHRA 3DAGA 3ZK9A 3Q15C 4FOPA 3NHMA 1NE2A 2OGTA 4L8VA 2W6MA 4RELA 3PTAA 3S4YA 1EVKA 2J5QA 1CJCA 2FPUA 1UQTA 2QD1A 4GL4A 2B4QA 5CA0B 3GRFA 1Z17A 3G82C 5FBQB 5T8KC 1Q0RA 1QK5A 3K53A 1GPKA 3V1TC 2PWZA 2AK3A 2P75A 4DNPA 1I3MA 2KS6A 2A5GA 4IVNA 4QM6A 1C0KA 1VG0B 2B69A 2Z1DA 5M5BA 3AM4A 3N2LA 2JA1A 4BWVA 3W2FA 5DHSA 1SHLA 2I2CA 4DZZA 4L28A 1BE0A 4Q1EA 3SJUA 2Q62A 2WPNA 1OBOA 2Y05A 3QEMB 1GZ3A 1X1RA 3GGDA 3GNLA 4EHAA 3CEPB 4YDHB 2AI2A 1JVNA 5EJ2A 4QHYA 1U28A 5KYKA 5C1PA 2YWGA 5DEIA 4MUIA 1LA2A 2WSLA 2IUTA 2QXUA 5BSEA 4YUYA 1BXKA 1NX9A 1U7UA 2QTWB 3G3EA 3S44A 3K70D 2Y66A 1B6SA 5I9TA 1XTPA 2H29A 3OLXA 4NMHA 3C6KA 3DDZX 3VNAA 5K8CA 5ED0A 1JLLA 2CLFB 3I6ZA 3G02A 2A1UB 3A9UA 4Q3EA 4EPVA 4GX2A 1U3GA 4G2TA 5TRTA 1NV9A 3QV2A 3ERCA 2W43A 1B8OA 3H19A 3O4VA 3CSDA 3GZNB 4WQMA 1R5OA 5PGMA 1LJLA 1QHYA 4MDFA 4ZJYA 1IQPA 2VJBA 2CDNA 4HTFA 3PJEA 2AG1A 4M8IA 2BBSA 2IT1A 3TXYA 2DY0A 4HCJA 5T3UA 1UDWA 2ZEJA 5DHAA 5KI6A 5GZ1A 2YQ4A 1WW2A 5ED4A 4H77A 5JASA 1JKJB 3COSA 4G4SO 5C4IA 4J8PA 4GR5A 2XIQA 3ZX4A 1LDEA 4M6WB 1UJ2A 4GM0A 3TG2A 1W25A 1XTRA 3BH6A 3T34A 3PSAA 2ZAIA 4LV5B 3LCJA 4K2AA 2IS4A 1XAJA 3EOBI 4A8JC 3B38A 2O5VA 1P72A 3GEMA 2WJPA 1MN6A 1UXHA 1C7FA 4MQMA 4Q9KA 1ABBA 2H52A 2CNLA 3F7MA 2QU7A 2N9UA 3C7KA 1KAEA 1C29B 3ZGOA 4EENA 1TJYA 3AUFA 4MGEA 4RFLA 4DV1B 1TLFA 2DLCX 4AUEA 4ALMA 4QUEA 2HWYA 1R6XA 1EUZA 3WGUA 4DR4B 2HIGA 1L5NA 4R7GA 3ORSA 4MS1A 1MC1A 2NXJA 2DFTA 2BGMA 3KV1A 3MJHA 3ZDRA 1E89A 1FNNA 3AHDA 4HQ6A 4KTVE 4QYIB 4ARBA 4EKYA 3HN2A 1TUEA 1IMJA 1M7BA 2IYXA 3KVYA 1XQ1A 3O3OB 1W0KA 5BXYA 4V1CA 3DWEX 4MJ3A 1IB0A 1ZOPA 5F1KA 2QRGA 3N7UA 3I0NA 1TU0A 4RSMA 4HKTA 2JDID 2CNWA 1EJ0A 2WM9B 3JWEA 4R05A 4XB2A 4AZ0B 1SXPA 3IAS1 3JD4A 3ZZ1A 1TKBA 3BOSA 3GR6A 5I7SA 2Y68A 3U0VA 1TVEA 5B36A 2GRJA 2WMYA 4KU4A 1DEOA 4ZO6A 3VKHA 4JSRA 3PGLA 4ZT5A 1ZH4A 1GILA 5C5CA 2BGTA 3O0TA 4LHZA 1KAQA 3HA2A 5EHIA 2AKEA 2VQ3A 1FVFA 5KYWA 4ERNA 1AO0A 3HB1A 3ZEAA 8MHTA 4KFCA 4MKHA 2VPYA 4HNQA 4AF7A 4EUHA 2BFEB 3AKEA 3R0JA 2W2LD 3W5VA 4WINA 2XDQA 4D9CA 3RUHA 1J0CA 4JQZA 4YJ3A 4DNOA 3WP1B 1DLJA 1PR3A 3KYJB 4I81A 4CV0A 3DDNA 1TJNA 1FC0A 3WKDA 2NVUB 2ORIA 1E9FA 1SBCA 2OMKA 3LYAA 4CM8B 3R74A 4AIIA 3TEFA 4IMRA 1SC4A 1Q50A 2V6GA 5I7WA 3ZU5A 5CFOA 2YHBA 3CR7A 3QJGA 4QXQA 4BDSA 2Y1WA 4E0BA 1XEWX 1EP2B 1YA8A 3WGTA 1YRWA 2AOTA 5IC5A 3VDXA 1PAUA 2RGRA 3BFJA 3N2KA 3H17A 4BX8A 1AZLA 3JSAA 4EB0A 3O8QA 4IIXA 1M2JA 1WZIA 4UM9B 1Z2PX 1ZM7A 2HK9A 1G3MA 1WKCA 3OOEA 3F4KA 3WGIA 1ESMA 4PIMA 1DCKA 5I9LA 3QW4B 5C4MA 3ANXA 3R3JA 4EO7A 3OOJA 5EVJA 1JFFB 3VZRA 5E6SA 1FF9A 2C4VA 2IY7A 1OI2A 3DO5A 3X1WA 4AJIA 3A4MA 1NG9A 3KAQA 3MTBA 4FMCB 3L9XA 2IXTA 1XTIA 3R5HA 1VP3A 5B3AA 1PO7A 2I0FA 3REQA 4JXKA 2XNDA 3RVNA 3DBOB 3MFYA 1F2VA 1IZ0A 3OJOA 1J2TA 1UL1X 5FTWA 3WR5A 5LIRA 4X1KB 3CRNA 3DEHA 5AW7A 3AEXA 3E3NA 3OQ1A 1KMHA 1CVLA 4LYHA 4TUYA 4ZU3A 1HRKA 4ZDKA 5JXIA 5EQTA 3Q0EA 3URMA 1W87A 3IA7A 4U2KA 1H6BA 1XDZA 3K0FA 2WF9A 2WSBA 4YRCA 4WNAA 2X6RA 4Z0NA 1WUKS 4I9HA 4IGEA 3BMQA 2UZIR 3GLGA 2IZ5A 3NVKI 4J0FA 6GPBA 3L4SO 3QPBA 3IVRA 4OHYA 4MGIR 4POOA 2POCA 4NE9A 1R3DA 3B9PA 4BUCA 4OI0A 1H94A 3TUZC 2Q27A 4Z4QA 2CCJA 4N39A 3UHAA 5BWCA 1YGYA 4JBYA 5EZYF 1NVBA 1CW2B 4KPUB 1U1FA 1J00A 3A9SA 1FK8A 5F35A 1MX3A 5A4KA 5JCXA 2GPBA 3MB5A 3VI4B 1U0FA 4UUAA 4CIBA 5IASA 1Z08A 1JR3A 5BWNA 1O94A 5AVSA 1D9ZA 5TQ0A 3EVBA 2O14A 4RHUA 4D8XA 4EUEA 5KHLB 3O6VA 5REQA 1O87A 1DC3A 2G3YA 1U63A 4Y30A 1M2OB 3CN7A 2HA4A 5JTUA 3GEHA 2DTEA 1FLNA 1SIBE 2FWPA 1FXWA 1NN5A 3LFTA 4A6EA 2VWQA 3GQBA 4BLUA 4DLRA 1TRHA 3SYRA 3ZE1B 1Y6JA 3C6MA 2ZJ8A 4ZOQI 4YI3A 3HWWA 4AYTA 3FVQA 1NUHA 2ID8A 4CN9A 3GT0A 3CUVA 5E4JA 3VQTA 3LFUA 2B82A 3FTFA 3T7EA 2QRPA 4B33A 2W2NA 3U44B 5IULC 1DXHA 1OVMA 1YS1X 1G21E 1X1DA 1QGOA 3DFKA 3QXHA 1Z75A 4NCXA 1KOFA 2DR0A 5J58A 4FLFA 3GLHA 1Z6ZA 2QDXA 4FDTA 5C46F 1VKNA 4MVJG 5ALJA 3U4CA 1OYVA 1WVGA 3QFRA 3ZXXA 4DXHA 4ESEA 3GNSA 1HV8A 2HX1A 2PMBA 3CNLA 3KT3A 4G0YA 5NULA 4AJ2A 2ZRNA 3SFVA 3IHKA 1DI0A 1I10A 2BFOA 4OAOA 2HCFA 4R5MA 5A7GA 1P45A 5KEIA 4YRKA 1VLHA 4L73A 3NWBA 3CYFA 2HCJB 1MEJA 4W5QA 3PGJA 5H8WA 3VTAA 2NIPA 3AEUA 2ZBQA 2P0YA 4ASUA 4E1VA 3STXA 5DBIA 3T7KA 1LFDB 3X2SA 4NYJR 4MWTA 1CG6A 1E18A 1FMLA 1MB2A 1IIBA 2Z83A 4RWZA 1GG8A 2NYRA 2Q3FA 2Q3JA 4LG1A 3U3OA 5EZYB 4DUGD 2P6UA 5AW3A 2VPQA 4AAYA 3U4MA 5LB2A 2YNMA 2L19A 3DOUA 3T9FA 2EQ5A 1R0LA 2ZR8A 1K0UA 3HCNA 4AMBA 1XZNA 4FEYA 3WWOA 1RM3A 2QVXX 1KZYC 1NNUA 2XVMA 1R8QA 4PZEA 4LHWA 4CMKA 1PW7A 1OH8A 2ZTLA 2Q5CA 3IIJA 3SE7A 2RGBA 4DCPA 1JJIA 5B4UA 2WIGA 2HF7A 4RTLA 2BZ1A 3U6KA 4MWBA 2GPNA 4ND1A 4TKVA 3G23A 1COWA 1VRCA 2QUBA 5HXAA 4CE6A 4URZR 3OPVA 3SVLA 3OEWA 4E5KA 2I3AA 4LXYA 1KTIA 2ZWAA 1U9CA 4XIIA 4XUDA 1DJPA 5JS2A 4LRQA 3NXSA 3N8IA 5LP6C 3AXSA 3PQDA 3FFBA 4D6PA 2ZVJA 1EBUA 3OFND 2EKPA 1CR6A 3OHMA 3OE7D 1UWKA 3RBZA 3IVMA 4I1PA 3EDYA 2IPOA 2C3OA 3EWSA 2A9OA 3PHJA 4A6PA 5KWEA 1E1QA 1V8DA 1VL1A 3QFHA 4GHWA 4MUKA 4Q18A 5JDCA 4XW2A 2O8EA 1BG6A 1FNSA 2Z43A 3F1KA 2VQ6A 3IT1A 4QELA 1PZNA 5B7QA 2AN9A 2NVWA 2UUOA 2H9IA 2EEZA 5CT4A 4NZ9A 3OQMA 1W6RA 3C3YA 4NOLA 1KTVA 2R6JA 4LVOA 3DZIA 1R0YA 4DJAA 3AR8A 4QIHA 4XYBA 2OPHA 3H4MA 1GTRA 3FMFA 4R2JA 4TLCA 4R8SA 3P9ZA 2Y1DA 1ZXLA 2G04A 4OBWA 3MWKA 1IJKA 2YFKA 1YQGA 1VBKA 1QOZA 3KHUA 1PLKA 4XE5A 3Q7PA 3VBCA 1TFRA 4NKRA 4NYJQ 5CT6A 1P7CA 2HNAA 3F8SA 4JYPA 4MTCA 4UMDA 4PO9A 3UKJA 1K3UB 2OGUA 1P8AA 3DL4A 3PA6A 3SOPA 1ULZA 4CUKA 1RBMA 2M6SA 4FE4A 5FTNA 1C4XA 5TQJA 3WSWA 1BROA 2FLVA 3UG6A 1OLSA 3DC7A 1MA0A 2OK7A 2WT4A 1EHIA 3DOJA 3E9EA 3FHJA 3TZEA 3AQ4A 1MAAA 1TA0A 1IUPA 1B42A 2NSLA 3FA2A 1BU8A 3ZJ5A 1ECPA 3FGZA 3DE2X 5IW8A 3UJ3X 4TVSA 2V58A 3TOCA 2P6OA 4DPKA 4YT8A 1XQYA 3IKLA 4RV5A 5DI9A 4YRSA 4Z8YA 3A2LA 4EPXA 3N9IA 1CIPA