2FPGA

Crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
305
structure length
305
Chain Sequence
SYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial
publication title Interactions of GTP with the ATP-grasp Domain of GTP-specific Succinyl-CoA Synthetase
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 116
structure length 305
sequence length 305
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2fpgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2fpgA01
1SAYA 1U4SA 2DBVO 2D1YA 4Y6RA 5TS3A 3JQBC 3AFMA 4PCVA 4HWKA 2C59A 3MOIA 3WOHA 3ZV6A 4AJLA 4BNKA 2AQKA 2PZMA 5ILGA 1WVGA 1E77A 3PGJA 3PXXA 4E5MA 1NR7A 2R2GA 1QXSA 4ALLA 3RD5A 1V3VA 3QY9A 4Q3CA 4CMAA 1HDOA 4A03A 4PLZA 3W8EA 2QG4A 3AW9A 3O9ZA 2Y66A 5BNFA 4U5QA 1DRVA 1YDWA 2JAPA 1F17A 1ZUD1 2O3RA 3B6ZA 3Q9NA 2NTVA 2JKVA 3DL2A 3QWHA 3V2HA 4DPKA 3UXYA 1DHTA 3F4LA 1Z74A 4PZDA 4WE3A 1NPDA 4Y67A 4ALMA 2CZCA 3K2EA 1H9BA 4D45A 1BVRA 4A7PA 2DBQA 3ZW9A 3WGYA 2OP1A 4NG5A 1YBMA 1YXMA 4J9UE 3WX0A 4A5OA 4GPD1 3H4VA 5ILOA 3AOEC 4WECA 4EDFA 1N1GA 4IDDA 4AL4A 1NQTA 2JFGA 3RIHA 4WNCA 3LLSA 2OZPA 4YAKA 3GVCA 4XQ9A 3R0IA 3LC1O 1F06A 4HNHA 5TLSA 5JO0A 3W4JA 1DHRA 1M76A 3AUTA 1W0CA 3G17A 1YRLA 3JQBA 5EERA 1V3TA 3K30A 4DRYA 1EUDB 4XDZA 2ZB8A 1CDOA 3TPCA 1A4UA 4CM6A 1EK6A 2VT3A 1A9YA 4MDHA 4LVUA 4DIBA 2HMWA 3FNHA 1YDEA 3JQ9C 3O8QB 4XIJA 1TLTA 1Y8QA 4XRRA 5JNLA 2PD4A 5AXCA 4PZEA 3H65A 4TWRA 4RQUA 1A71A 3I83A 2Y1DA 3D3WA 3JV7A 7MDHA 1B16A 4IDBA 2AW5A 2I99A 5KJ1A 4CMIB 3ZDFA 2FP4A 3X2FA 4QQRA 3PK0A 4NU5A 3G79A 5B4VA 4YRDA 5THQA 5F3RA 3RBXA 1E7WA 3M1AA 4CR8A 4MIOA 3JQAD 4JX8A 4W4TA 2ZCVA 5L45A 3LYLA 4BS9A 5KJ6A 1N5DA 1P45A 2EGGA 3MEQA 1UR5A 2J8ZA 2B5WA 3DTYA 3JD0A 2H6EA 3HNPA 1HKUA 1M6HA 4OIMA 2FZEA 3GVHA 4K28A 4GMGA 4J7XA 3ADOA 2JFFA 4NBWA 4ND3A 2AG8A 3ZWOA 2NM0A 3ITKA 4CJXA 3OQ6A 4CL3A 2PD3A 3BMQA 4AJKA 3FWNA 2UDPA 4YT4A 2VHXA 3W6UA 2DUWA 2JAHA 1VSVA 3WDSA 3OHSX 1Q7CA 1LSOA 3PGXA 5A4DA 1CJCA 4WGGA 3AM4A 2GERA 4E0BA 4AJIA 1JU9A 4PLHA 3VAZA 3FF4A 1MP0A 1R4NA 4WLEA 2PZKA 3NDIA 3OJLA 1WZEA 4D41A 4GX2A 2X1HA 5TQVA 4KWIA 5KIAA 1A4IA 3ONFA 4MO2A 3ROPA 1C0PA 1EVYA 1B2LA 2NU7B 2EG9A 3DAPA 4F45A 1MV8A 1BDBA 3WNVA 2YHIA 2B83A 3E8XA 4DXHA 3HHPA 1IHYA 5KCZA 4XQEA 5JMPA 4E12A 3HN7A 1SO8A 2JCYA 1FF9A 3PQDA 3S2FA 4YJGB 3WGGA 1HT0A 4DL9A 4R69A 1TT5B 3WQQA 1J4AA 1JKIA 5JAIA 2O7QA 4XDYA 2LDXA 5ADHA 4YQYA 4N5LA 3BMCA 3VTZA 4ALJA 1F8GA 2FSVA 4U6SA 3OEYA 2GR9A 4R54A 4XYGA 5K9ZA 1UAYA 3G1TA 3EDMA 2X6TA 2SCUB 1WMAA 4TKMA 1A72A 1L7EA 4G65A 2QZ9A 4OKNA 1KS9A 1NQOA 4O63O 2GN9A 4J6FA 3ANNA 1ISHA 4CM9A 4DTIA 4YRAA 2WM3A 4R4JA 4IM7A 3TL2A 1DC5A 3UN1A 1LLCA 3ZNPA 1PTJA 3FPCA 2EKPA 4LSMA 1HDCA 1JTVA 3UCFA 2XAAA 3RBZA 2X9VA 3SVTA 1FDUA 3WICA 4DLLA 2NU6B 3EVTA 2ZQZA 4GWKA 4GL4A 5JC1A 4HNGA 5DCYA 3ST7A 2C5EA 3PI7A 2HO5A 5JDCA 1ADGA 3GNSA 4J3FA 1C0LA 3H9EO 3U62A 2LDBA 2ZATA 5GZ6A 3GZNA 2AE2A 5KTKA 3C7DB 2VCYA 4LISA 3H8VA 1ZZEA 1E3SA 3C8MA 3RSHA 4GLLA 5HWSA 4XKJA 1E3WB 2OFPA 4YDRA 5G0WA 4EGFA 3U4CA 5L40A 5CG1A 1KIFA 4G81A 3MCVA 3RI3A 2ZB4A 4RVUA 1I33A 1VL8A 3PHHA 1VI2A 3VDRA 4GSLA 1O9BA 3NJ4A 5ES3A 3TFQA 3AFNA 5ER9A 2I5PO 4L9RA 3WR5A 2UYYA 5TIIA 1T26A 3JQ8B 4JJFA 4R3WA 4FB5A 1E1NA 2E49A 1Q7GA 5KJCA 2B36A 4R51A 3VKVA 4BNWA 4JP2A 1YB5A 4GKBA 1YL7A 2IZZA 2WYWA 3HJAA 2Q1UA 4L4XA 1T1RA 2I65A 2F00A 3LC7O 1GYPA 2HRBA 3JYQA 3PIIA 4OJNA 4Q3NA 4E32A 1YE3A 2V7PA 1R0LA 3GVPA 3KHUA 2VWPA 2QRJA 2IEDA 5FWNA 1HSOA 3I6IA 4XWYA 4BKUA 2NU8A 1Y81A 2R00A 3DMTA 1NAIA 4NZ9A 3VPHA 2RAFA 1AE1A 3BIOA 2XPCA 1YBVA 2JL1A 4PVDA 3MTJA 1UZNA 1NASA 2W2LA 4AJOA 1LSJA 4DMLA 1ONOA 1SNYA 1RYDA 2FPPB 1EUCA 4P8RA 1NFFA 3LT4A 4ZRMA 2GZ3A 3PZRA 1WW8A 2J6IA 4CLRA 2DFVA 2ZTVA 1YBAA 3RUFA 3JQEA 4WOKA 4LRTB 1E3EA 2X0JA 1NWHA 4FFLA 4W7HA 2VTDA 3AI2A 4E31A 3TZQA 4TRJA 4AJ1A 2AE1A 1KOLA 3UF0A 1PJSA 1UH5A 5DT9A 1GZ6A 2QYTA 1PJTA 1PS9A 2DPGA 1ENPA 4E4YA 2DQ4A 1GZ3A 4XJSA 4IXTA 3JYNA 1HZJA 1VL6A 3FTPA 3FTNA 5L4LA 3DZFA 2VHZA 4UUNA 1CRWG 2D59A 4IDFA 4J4HA 3Q11A 5JAMA 2TMGA 4FPXA 1T4BA 2GF2A 4J2HA 3TOZA 4CLHA 4FBGA 1NNUA 5AXAA 4CMHA 4NFSA 4BNJA 4J4BA 4XGNA 2Y0EA 3GNTA 1UAGA 3ETDA 4BO4A 1DLJA 3D5TA 1Y6JA 3FBGA 4E6PA 4YYZA 3IIEA 2HJRA 2VTEA 1EUDA 1FDSA 5DOZA 1VJ0A 4NK5A 4XQGA 1I3NA 2X9NA 3ZV4A 1HE4A 3S2EA 5TNXA 4E21A 3M6IA 2WE7A 3Q9UA 5L9AA 4LN1A 3QVOA 1R4NB 2VRCD 3GG2A 1CWUA 5DDIP 2WSBA 1QYCA 3H2ZA 3JCZA 1UDCA 2IODA 3FR7A 1GFSA 5IFLA 3NKLA 5L7WA 1DDOA 2OP0A 4OMUA 3BMNA 1Y5RA 5L7YA 2CUKA 2O3SA 5IZCC 1P44A 1AHHA 3OIGA 4GGOA 1KVTA 1DJQA 2AEJA 4R3NA 4OM8A 4MVJG 1U3TA 1U5CA 4PLCA 3WGOA 5JBIA 3A14A 3BHJA 3ZNOA 4HXYA 3HG7A 3C1AA 4M55A 3NGXA 4CODB 4BV9A 5IXYA 1BGVA 1T2FA 2YYYA 4AJ2A 1E92A 1W73A 2BI7A 1ISMA 2IE0A 3D0OA 3NDJA 5KVVA 4DPMA 4KQWA 5JSFA 1YS4A 4BNMA 4LMRA 3IMFA 5G4KA 1D4FA 1E7QA 3B1KA 3GMSA 4FD3A 1JQBA 2IYOA 3UAGA 1H6CA 3COSA 2CDAA 4JGBA 2PGLA 2CF5A 1V8BA 2Y68A 3FI9A 1SZJG 2YQ5A 4MVJI 5DF1A 1GTMA 3SLKA 2EXXA 2X0NA 3O4RA 4BMVA 4D3DA 3OSUA 1B3RA 3PRJA 1GPJA 2D5CA 3KETA 1DRUA 3OJEA 3ONEA 5A5EA 1Z73A 3EVNA 5JW6A 5ITVA 2WTBA 4GKVA 4N7RA 6LDHA 2DT5A 4EYEA 2DTDA 2AG5A 3KSDO 4D3FA 3GDGA 4J7UA 3JQGA 1IB6A 1U3WA 4IDAA 2EP7A 2NU9A 4DGSA 4DREA 2UV8A 3DOJA 2BMAA 2BI8A 3F1LA 4PLPA 3VZPA 1BW9A 3RUHA 1WZIA 2VZ0A 4TVBA 4BO2A 5CAEA 2G17A 1ZIDA 3CTMA 5TJHA 4IZIA 5AVOA 3OJFA 5C3MA 3D4OA 1R0SA 3GQVA 4MVJA 3W8FA 5HS4A 4TZTA 1ZEJA 2VWQA 3D1LA 4GX0A 3A06A 4ND4A 3FNFA 4Q3EA 1M6WA 4CUKA 2ILTA 1J6UA 2XXJA 1WPQA 2QIOA 3ZU4A 2A35A 3CZRA 4H7PA 4JBGA 1FDVA 4CM8A 4I1IA 2VYND 3PPIA 4U7WA 1E6UA 1Y5MA 4A73A 3HE3A 1LNQA 1PGOA 4YWJA 4EUFA 2RH4A 3DOOA 1P33A 4LGVA 1B0AA 5BQFA 4GBJA 4JBHA 4K26A 5B12A 2YV1A 3TDKA 4MPDA 3IL2A 3I9OA 5C7LO 3MZ0A 3I23A 4BNXA 2UAGA 4L4RA 3SBOA 1ZJZA 1TI7A 1N7GA 1LI4A 2EF1A 3ASVA 4RPGA 2IYPA 4RVDA 5T67A 3HZZA 1HF3A 2OOSA 1KEVA 4WLUA 5I7SA 3GEGA 4C7JA 3WNQA 1ZXBA 5A06A 1YB1A 3GFBA 2O4UX 3HFGA 2X7HA 4MVJM 3I9JA 3ZW8A 4NMHA 3R3SA 4Z0TA 5BSGA 3F5SA 3ENKA 1SB9A 1GAEO 3QW2A 4U8GA 1L1FA 1QR6A 3WQRA 5ICMA 1KYQA 4MVJP 1JVSA 1ZKMA 3C7CB 4QTZA 4RF3A 2FZWA 4XQCA 2NUAB 3KVOA 3C3XA 3PHLA 2NU6A 1E0DA 3WGQA 1D3AA 2GZ2A 3JQDA 5KNLA 3QVSA 4FGWA 2CDBA 3N58A 5GZ1A 2O2YA 4ALKA 1BXKA 1C1XA 3K31A 1JKJA 1ZNQO 9LDBA 5I8WA 2J3JA 1T1SA 2VWHA 2YV2A 2ZJ0A 3WMXA 3HB4X 3OIDA 1R12A 3GPDG 5AXDA 3K6JA 1PGQA 4RPJA 5DULA 3VZRA 3NTRA 3PWSA 1SBYA 1Z82A 4CV0A 2PTGA 1B7GO 4J0FA 1AUPA 3QWFA 2ZKLA 4MKZA 1ZJYA 4KDEA 3S2IA 3U3XA 3I4CA 3JTMA 5C37A 3GUYA 5JC8A 3RC2A 1OI7A 1LLUA 1PQPA 4HX5A 3I9MA 2Y93A 3GEDA 4RCVA 1GCOA 1GPDG 3U4HA 1IZ0A 2I76A 5CDYA 4ALIA 1P74A 1IYZA 4FQ8A 4RORA 3CXRA 4IBOA 2EKQA 2P2SA 2P9EA 1YVEI 4K6CA 3DBHA 1C1DB 1QMGA 2C2XA 4MVJE 1VJ1A 2A94A 4ILKA 2E6UX 2X23A 5FEUA 3VPFA 2ZTLA 3NT5A 4CV1A 2BF7A 4DQXA 3KM0A 4UVGA 1K3TA 1QYDA 1EMDA 1BDMA 2H5LA 4JIGA 2W4QA 4PIVA 5I9NA 4OXKA 2NQTA 3JD4A 4J16A 2VZ9A 4TRNA 3ICCA 4GSKA 3NYWA 1GV1A 1C0KA 4DQVA 1E3IA 3C85A 5BNTA 1Y1PA 4FJ1A 1DIAA 3RFXA 2AA3A 4NFHA 1K6JA 1PJQA 5EIOA 1O5IA 1RM5A 1J5PA 2OBYA 1XLTA 3E9MA 2EV9A 3D5QA 3GGGA 4BVAA 4BNIA 4O5OA 4YRBA 1EBFA 4GX5A 4DYDA 4D0SA 4Q39A 2NLOA 3MJ4A 1NVTA 1PZGA 1E7MA 2Q2QA 2BD0A 3IJPA 4L4SA 3FRJA 3ICPA 1ZK1A 2YUTA 2EWMA 3RUAA 3I1JA 1VJTA 5KVQA 2PH5A 4NJMB 1HLDA 3KZVA 3ZU3A 4PG5A 1Y9AA 4AJNA 3W8DA 5DCWA 4FW8A 3DO5A 2BKAA 4FDAA 3GDOA 1EVIA 4FJ2A 4OGWA 4Q3AA 5HA5A 4BGVA 4YA6A 5IF3A 1O0SA 1B3BA 1P1HA 2PKQO 2V6FA 5B4UA 2X8LA 4R41A 1S7CA 3B1FA 3OP4A 3ZV5A 4H15A 1XQ1A 2PFGA 4URFA 1Y8RA 4F46A 3DBLA 1UXJA 5TF4A 3KBOA 1PJBA 4CUJA 3EY4A 2VYNA 3EMKA 4PLTA 3QV1A 4B7CA 1G6KA 4IJVA 3GK3A 1HETA 4XR4A 1L7DA 2CDCA 3RC1A 1MLDA 4DBVO 4BL5A 3WFIA 3QVTA 3JQCA 4YAEA 5B1YA 2C54A 1P77A 1E3WA 4DIFA 4IQGA 3H3JA 1CQJB 2FR1A 3VTFA 3OECA 4HY3A 1LLQA 1HRDA 3VPGA 3BYZA 3R6DA 1ZSNA 1JN0A 1ISFA 1H94A 3S8MA 4O0LA 5BSHA 4NI5A 4OHUA 1YKFA 1LC3A 3K2BA 4W82A 4U0KA 4CM9D 5A05A 3OQBA 3L4BA 4NIMA 4MIYA 4NK4A 1QV6A 1UXIA 5GY7A 2I9PA 2W2LD 1RWBA 2AMFA 2VN8A 3FN4A 1R0KA 1DFIA 1E6WA 4XJTA 4R9SA 4CQMB 4YB8A 1M75A 2O3TA 5KWEA 4PZCA 2GDZA 2J5KA 1JLLA 5L4SA 4IPTA 5A9SB 4K1LA 3FWZA 3QRWA 1YGYA 4IUYA 3K5PA 1P0CA 3NTQA 3WTCA 4IZHA 4PVCA 5T57A 2X22A 4Y9DA 3TNLA 3K92A 4CLEA 4CQLA 3ZWYA 3A1NA 4NR0A 2I6TA 3QWIA 3UFXA 3DDNA 4NHEA 1XSEA 4N5NA 3PVZA 1U8XX 4Z0HO 1PQUA 3JQ6A 1KVRA 4RPLA 4YPOA 1NHGA 4OOFA 1GQ2A 5TJ9A 3JYPA 4KUGA 3SC4A 1DC6A 4LW8A 5LC1A 2UUPA 3RQSA 4NU6A 1JKJB 5A04A 3A9WA 2HK8A 3WGIA 1PZFA 4B4UA 2ZJ1A 3CMMA 2ZCUA 3WYEA 3ZWAA 4PG7A 4EUEA 3U5TA 5IAAA 5EJ2A 1Q0HA 1ZH8A 1JWAB 1BW9B 1A27A 1MUUA 3I9NA 5T64A 1K6IA 1YWGO 3FSRA 2Y67A 3JQ7B 2NVUB 4TRMA 4CMJA 1UUFA 1WAMA 1T2AA 3DQPA 3GMDA 3HQ4O 4N54A 1HDGO 2AXQA 2WDZA 1X7GA 3K96A 2O2SA 4E2XA 1WMBA 3DZJA 3AY3A 4EBFA 4YJHB 3ANMA 4KUHA 3MJCA 1HEUA 4TRRA 2FY8A 4CMKA 3IUPA 5LCXA 1PU2A 1DIGA 3JD1A 2EKLA 4GLOA 4PRLA 4UVIA 2TMDA 3SX2A 3TF5A 1V6AA 2OBNA 5HRUA 4CQMD 3VDQA 4OKIA 2GLXA 2BGMA 3EAGA 3ROQA 3JQFA 4H16A 4MVJF 5A3VA 5CG2A 4IDEA 4YAIA 1ZW1A 1B8UA 3I5MA 1MA0A 2G5CA 4LCEA 2OHXA 2Y1OA 2OO5A 4PG8A 4BQPA 1XU9A 4IMPA 5DP2A 1GEGA 4A10A 4DYVA 4RVGA 3GA0A 3HB5X 2PKRA 4BO7A 4W9NC 5F1PA 1TT5A 4OOEA 1N9GA 4DIOA 2PK3A 3PJDA 1P31A 3NUGA 1HWYA 3OJOA 1N92A 1JLLB 1U3UA 3BHMA 1RPNA 4GI2A 2D0IA 1DFHA 2Q99A 4KTTE 1DEHA 4UEOA 5TC4A 3KEOA 1ONPA 1YOVA 1M2WA 3KXDA 1ZK0A 1ZCJA 1UXHA 2AQHA 4XD2A 4UAGA 5JCJD 3I52A 4QEDA 1NFRA 2G0TA 4IXWA 1YQDA 3GZ4A 4L75A 4IY1A 1MGOA 1YH3A 4YT8A 2QW8A 4LMPA 4Y98A 4MVJH 1U9JA 2W2KB 2WJPA 4N5MA 1PL7A 1Q0LA 4OH1A 3QWBA 4A26A 3ZNNA 2GPTA 4CR7A 1DO8A 2Y1CA 3DBVO 4Q3BA 2CMDA 4NDNE 1QG6A 1WDMA 5AOVA 3ZV3A 4PGFA 3SLGA 1CYDA 1KVQA 1JVBA 5DN9A 1KETA 4XYLA 4I9NA 4JLWA 5IZ4A 4WJZA 1B14A 3OA2A 2Y99A 1NTOA 1NVGA 3KLMX 4ZICA 1HSZA 2IRWA 3MJEA 3ADPA 5A03A 3LC2O 3VHRA 3O26A 4ID9A 2Y0DA 3NT2A 4ZN6A 3KB6A 4DUPA 3X2EA 1LRLA 3FD8A 1WWKA 2Q2VA 3VKUA 4D79A 1LTHR 3KEQA 5CEFA 4YJHA 1I5RA 4RF4A 4IDCA 3DZGA 3SEFA 4TROA 5I9MA 2PA3A 3CH6A 1EZ4A 1NVMB 1XWFA 2X9GA 1LU9A 3DHNA 1GV0A 1SPXA 2B4QA 4QXMA 4OSPA 4WNIA 5G0TA 3PP8A 4E5NA 5A1TA 3WGTA 3JQFC 1ADBA 1FJHA 1NXQA 1UP7A 2WEKA 4OSOA 2GN4A 3F4BA 1IZ9A 1Q1NA 1PJCA 3E18A 3GT0A 1QRRA 2AQ8A 4C4OA 1PIWA 3NGLA 5U4QA 3INRA 3LDHA 4FC6A 2C82A 4BNUA 3PEFA 4BKOA 3E03A 4YR9A 3EYWA 2A9FA 4XCVA 1KBZA 1VRWA 2FSSA 1O6ZA 1ZK2A 3KYBA 2P4HX 3RKUA 2YQ4A 3FPLA 2BH9A 1HE5A 4QSMA 3PJFA 2VHYA 1PGJA 4II3A 1LSSA 4R1NA 3AOEA 5BR7A 1SCUB 1B8VA 5JCXA 2OUIA 5FYDA 2NSDA 3KV3O 2QHXA 2XOXA 1QYWA 2IEBA 3DBRB 2BFMA 3DEYX 5ICSA 4BO6A 1HDYA 2DKNA 4B8WA 1Q2XA 1MXFA 1Z6ZA 4NBTA 2Z5LA 1P1IA 1TA4A 3A28A 3KRTA 1IULA 2YJZA 3KO8A 1U28A 1R4MB 4GH5A 2IXAA 4ZVVA 4FFOA 3NT4A 1WP4A 1DIHA 2DLDA 4PG4A 2JCXA 2HMTA 3MJTA 2NTJA 3OMLA 1UJMA 2WE8A 2Y1EA 4QO7A 3WWZA 1I3LA 3ZWPA 4Z0PA 1G0NA 3LT1A 2W90A 3UKOA 1CQJA 4BB6A 3Q2IA 1NFQA 1BVUA 4QT0A 2HK9A 4RVHA 5IDWA 3VH4A 1DSSG 2HMUA 1QYVA 4KTVE 3G49A 3U09A 1K89A 3HDHA 4NBUA 4IJKA 4P4NA 3JQ9A 5KOIA 4JCOA 3QVWA 3BMNB 1ENZA 3LF1A 3FCOA 4RGBA 3PZBA 3UICA 3VOSA 1VM6A 3QLJA 4XIYA 4HV4A 4IMRA 2VRBA 3QA9A 3ZWBA 3L77A 1X15A 3C24A 1J0XO 4GGPA 1LA2A 2DFDA 4JJGA 4ZA2A 1K6XA 1GUYA 2B37A 4J2OA 3RUCA 1OOEA 1PQWA 3QE3A 1K0UA 2D4AA 4KMSA 4B3HA 1F0YA 4MINA 3UGKA 5K0ZA 1H0KA 1GYQA 1P1RA 3GEMA 1I0ZA 1U3VA 1K5HA 1A5ZA 1UZMA 2NADA 1GUZA 1U7TA 2GCGA 2GUGA 2H63A 2ZYAA 3QWAA 2QQ5A 2HCTA 1MC5A 4WEQA 2HK7A 4KQXA 1SB8A 1U2DA 2C7GA 3G3EA 3GLQA 5ENDA 1PWZA 3OICA 1BXZA 3PHIA 2YY7A 1H5QA 4UVHA 3D4NA 3DB2A 1XEAA 2NVWA 4D43A 1JAXA 2FPGB 1JDJA 1ZMTA 1AHIA 4CMIA 3WG9A 2O7SA 1XKQA 3DBRA 1KEWA 2C29D 2Q1WA 1VL0A 3L07A 3OFSA 4BMNA 1N7HA 4CUZA 4J4TA 1GZ4A 4EW6A 4EEXA 4B4VA 2FPIA 2DU8A 3GFGA 3L6DA 3P19A 1E1KA 1KEUA 2BGLA 1BWSA 4BKQA 1MG0A 5B4TA 3ZHXA 3I4FA 1CQIA 2AEMA 2Q46A 1DPGA 3GAFA 5F5LA 2YZ7A 3ITDA 4OO3A 3O38A 1YO6A 4TQGA 1HDZA 4MJLA 3SJUA 3DAGA 3TWOA 2DTXA 1IPFA 1NX6A 1CERA 2V6BA 2O23A 1PGPA 5JDIC 2R00C 3M2PA 1EE9A 3O8QA 1TXGA 1NPTO 1SMKA 2PLAA 3DZKA 3PTZA 3WSWA 1LDNA 2HAEA 3H5NA 1VKNA 3IDSA 4IJUA 3VH3A 3DXFA 3K8ZA 4RZHA 1I2CA 3ETGA 2NU8B 1Y8RB 4R5MA 5F1KA 3WTBA 2HRZA 3NV9A 4ZU3A 1I30A 3LVFO 4P4LA 4AJ4A 4CLDA 3H2SA 3VVBA 3ZU5A 4OQZA 4F3YA 3KOUA 4WLFA 4FGSA 3T4XA 1GD1O 1N8KA 1DB3A 2GYYA 2DPHA 3FNGA 4CLOA 1A9ZA 4WPGA 3GNQA 5JMWA 4AJHA 3E9NA 1GQYA 3DR3A 4I8XA 2IZ0A 5AXBA 5A02A 5A3JA 3WIDA 2B5VA 4WCFA 4FOOA 3V1TC 2Q1SA 2E82A 4UULA 4Z9XA 3ZI0A 4F6CA 1KERA 1E5QA 1N9GB 1Z45A 1EFKA 3GGPA 4ZHSA 5HM8A 3ROKA 3BA1A 1AXEA 4RJTA 5EQDA 3KYDA 3TSCA 1C3VA 4TKLA 4NJMA 3AY6A 2O3JA 4YJGA 1RM3A 1V35A 3AU8A 2ZTMA 2W8ZA 2HMSA 3PLNA 4CLOB 3P5SA 1NQ5A 1HXHA 3BTVA 3E5MA 4CLXA 4YT2A 1KY4A 2IXBA 4MOWA 4E5KA 4CPDA 3U4IA 1V9LA 2NUAA 1RM0A 2HU2A 1MFZA 1EEHA 3VH2A 2OL4A 1DXYA 3QJ5A 2Y0CA 2CSUA 3L9XA 4YEDA 5T8KC 2W2KA 3CZMA 2WWRA 3EK2A 5G0SA 1XHLA 1EVZA 1GDHA 1ULUA 1OFGA 4ZJUA 4KWHA 1LUAA 1CF2O 3HADA 3ZHYA 4TMFA 3EZLA 4E30A 4I08A 3CSDA 3ZWXA 4CM7A 4Z9YA 1ZEMA 5GZ3A 2Q3EA 1CQIB 4RLSA 4CM3A 2GZ1A 4ALNA 4LK3A 3MOGA 1HYHA 4W6ZA 2EEZA 1T4DA 4RLHA 3ZWMA 1JA9A 3VPXA 1YONA 1O8CA 3RC7A 4MVJD 4BO5A 2Y05A 4OQYA 4D0RA 1H6AA 3RFTA 1UZLA 2FWMX 1B26A 3L4SO 4KP7A 4MKXA 5C5IA 4R1TA 5C7IO 1EFLA 1G1AA 4JN6B 2PGJA 3B70A 2GSDA 1Q7BA 5BSEA 1RYEA 4RPKA 3AI3A 5DBFA 4J1SA 1VKOA 1R16A 1DRWA 2CF6A 3IQDB 1H2BA 4UREA 2CY0A 4XYMA 1GQQA 3MJVA 4WCFC 4XX0B 1ZMOA 1LDMA 3DWFA 3N74A 3D4PA 3TZCA 3AOGA 2EJWA 1WNTA 3HDQA 3PFWO 1Y8QB 2OORA 4J9VA 2I66A 4JK3A 1XG5A 3OIFA 4YVFA 1ZO8A 5G0VA 5L51A 2BHLA 1ARZA 4IGEA 1HDRA 4R1UA 2J3HA 2VOJA 3PYLA 1SCUA 4ND5A 1ULSA 3V1YA 2NACA 3GZNB 4Q9NA 4E5PA 3DZBA 3CPSA 5JPIA 4BOYA 3ZU2A 5IJZA 3RAJA 4FCCA 4OAQA 5EINA 3RKRA 3ZWCA 4WASA 1QSGA 3DFZA 1AN9A 5JE8A 4OYRA 1IE3A 2WYUA 2CVOA 1X13A 4B3JA 4EI2A 3JQAB 4X54A 2V65A 3RFVA 1QP8A 1PX0A 1R4MA 3E1KA 3DFUA 2ET6A 5I9LA 1XCBA 3D3EA 4FC7A 4QFDA 2X86A 4BNYA 3RBVA 5H83A 1XIVA 5JAQA 4BV8A 4BGUA 5BNIA 3F46A 3B20A 4CV3A 3E82A 3V2GA 1EDZA 4JQCA 3PDUA 5EQFA 1VC2A 4BO1A 1U7HA 4MIEA 2VRCA 2PKQP 2NNLD 1NBOA 4JBIA 4U6QA 1QORA 2QX7A 2VYVD 4XA8A 4PLFA 4RL6A 4RPHA 3ZH2A 3I9KA 3D7LA 3ENNA 1T2EA 3CINA 3EGOA 1GEEA 4IQ0A 2F1KA 3RUIA 2YDXA 1DIRA 1P0FA 2I3GA 1Y9EA 4QX6A 4P38A 4R9RA 4J0EA 2B4RO 2V6MA 2EW2A 1TEHA 4EJMA 3DHYA 1ZSYA 1UXKA 4M1QA 2GO1A 5JO9A 4BNGA 4EZBA 1E5LA 1PGNA 3AUUA 3BTOA 5DZSA 4JXKA 4B7UA 2GN8A 2BFOA 4L0QA 1MXHA 1IY8A 3AU9A 3FHLA 2Q45A 1X0XA 4EEZA 4BO0A 3U0BA 5H82A 1M67A 4OL9A 3RJ5A 2UVDA 1XYGA 3NTOA 3BMOB 3GN1A 5F5NA 1NWCA 2C2YA 1CIVA 4RDHA 2FPPA 4OXNA 5U1PA 4R5HA 4M49A 5JCJA 3STHA 5JDIA 1R15A 1SC6A 4UVEA 4Y6PA 2X58A 3GOHA 3H3FA 1ISJA 3ZHZA 2ZB3A 1O95A 3H9GA 1I3MA 4JJIA 5L53A 1V0JA 3DAFA 3UVEA 3W6ZA 1DAOA 5AQ1A 3AI1A 1ONNA 4GAEA 1YL5A 3QSGA 5COBA 3W1VA 1NP3A 2PR2A 3OJ0A 3WJ7A 5L3ZA 1PR3A 1YJQA 3E5RA 2P9CA 1GU7A 1EVJA 1EBUA 1FMCA 2CFCA 3F1KA 4JNKA 4YACA 3WXBA 4UEKA 1LDGA 2VUUA 4AFNA 2P68A 5IDQA 1HZZA 3CIFA 2X5OA 2BLLA 4CM5A 1BMDA 2VHWA 1MB4A 2NU7A 4LCJA 1EDOA 4H3VA 2OXIA 5L4NA 2NVUA 3NRCA 4WLNA 3WS7A 4GX1A 4LSWA 4AJEA 3RVDA 1EUCB 1BHSA 4FN4A 4YQZA 2EERA 2YFQA 1VSUA 3AUAA 4FSHA 3KSZO 3NEPX 1C14A 4XEHA 4CM1A 4ZRNA 1C0IA 5KKAA 2D8AA 3NDRA 1GYRA 1PJ4A 3D64A 3DC2A 2FR0A 2JD1A 4NBRA 5G4LA 1CEQA 3Q6IA 2ZK7A 4HP8A 3ZZNA 5MDHA 3JQ8A 1J49A 3DMTC 1BRMA 2Y1GA 4K6FA 9LDTA 2DC1A 3DHEA 4YT5A 1UP4A 1IHXA 4BKRA 2H1SA 1H2HA 3EW7A 2CNBA 1NYTA 4XB1A 1PR9A 2ZIZA 1DFGA 4BNZA 4L76A 5IDXA 4XB2A 1KVSA 1LRKA 2Q4BA 4WCFB 5T5QA 5JYEA 1U1IA 3IOYA 4HFRA 3IKVA 4MP8A 1SOWA 5JAZA 3KYDB 2HJSA 3UCXA 3GPIA 3F9IA 4PG6A 2SCUA 3MWDA 1N2SA 2X5KO 2X5JO 5T8KA 1WXDA 1E1LA 2RH8A 1M66A 2R6JA 1LSUA 4R1SA 4BNNA 2YV3A 1DBVO 4B4WA 1LLDA 3UOGA 2GRAA 1BG6A 3ZWWA 2P5UA 2J5RA 2WD8A 1WLYA 1BXGA 5ER6A 3PJEA 3VZSA 3WFJA 1I01A 2GD1O 4J90A 4HBGA 4XR9A 4AVYA 4II2A 5C7OO 3LF2A 4CV2A 1XDWA 3QIVA 4DA9A 4CR6A 3T7EA 4MKRA 1E3JA 3AUSA 4M89A 1NM5A 1I2BA 3OQ1A 2I3AA 4O1MA 1PZHA 3UCEA 3ZWNA 4WUVA 1TT7A 3LT0A 1I24A 1E7RA 1HYEA 1OMOA 1YOVB 1TB4A 2QZZA 1DIBA 3L0DA 5TX7A 4E3ZA 1LQUA 1EQUA 4D3SA 3BTUA 4PLGA 3HN2A 2VHVA 3ORFA 5HS6A 1UDAA 1I10A 2QRLA 2X0RA 3JQGB 4IINA 4WLVA 4FIZA 3JYOA 2HUNA 3FNEA 4UUOA 1O89A 1ADFA 3GN2A 1OBFO 2EHDA 3HFSA 1ID1A 4S3MA 3TZHA 1P1FA 4QUKA 4ZQBA 1GCUA 4LVCA 1JW9B 2PZLA 1RKXA 1WDLA 1U4OA 3OETA 3L6EA 2J5QA 4UUPA 4CMEC 3RU7A 3F3SA 1LEHA 2DAPA 4XX0A 4ZQGA 3U9LA 2ZB7A 4WOJA 2J3KA 3ABIA 2WYVA 1IPEA 4RQTA 3I9LA 3I3OA 2ZTUA 1PJ3A 3PQFA 1PL8A 2FR8A 3TQHA 2E4AA 2VZ8A 5CFZA 3IAHA 1DOHA 5DBIA 4DMMA 3BZUA 4YJFB 1GY8A 2WMDA 3ULKA 2JD0A 3LQFA 4ND1A 3LLVA 2HDHA 1PS8A 1ZVMA 3H9JA 2X0IA 3DZHA 1QKIA 3K9QO 4I5EA 4CLRB 3MWDB 1X1EA 2WD7A 2AEFA 4I5FA 4K9DA 3TN7A 1PWXA 3B1JA 3JYLA 3RJ9A 4M87A 5DNAA 4D7AA 1HDXA 1LX6A 3JQAA 3F5QA 1YQXA 2PGDA 3UUWA 2RHCA 1P1KA 2XF8A 4L8VA 3QQPA 3NAQA 2Y1FA 4Z3DA 5TRTA 3BMQB 4PLYA 3A4VA 2P5YA 3PLRA 5JFOA 2VQ3A 4GQAA 1EUZA 3WGHA 3DONA 4CM4A 3DMYA 1JWBB 1ZBQA 3UHAA 2B0JA 3WYBA 3FR8A 4DC0A 1MG5A 4PLVA 1X1TA 2GNAA 3IC5A 1JAYA 5JDCC 3PWKA 3ZHBA 2P91A 3VPSA 1O94A 4GVXA 4WK6A 1X7DA 4AG3A 3GGOA 1E3LA 4L73A 1HE3A 1PJ2A 2Q2WA 4XGIA 3FBTA 2HLPA 5I8ZA 3GVXA 1B15A 3HSKA 4O6VA 1ZK4A 2RHRA 1KVUA 2C0CA 2HSDA 2HKIA 2C5AA 4XYEA 3OEWA 3PQEA 3IKTA 4J43A 5B37A 5A9RA 2A4KA 4HFMA 4E5YA 2E48A 5IDYA 2B69A 4GMFA 5TT1A 3F6YA 4R68A 2VT2A 4YXFA 4RF5A 1E7YA 3GVIA 1U2GA 1RJWA 3INTA 3MWEA 4QO8A 8ADHA 1DLIA 3BMOA 3DOCA 1LXCA 3LSYA 1C1XB 2EGHA 1ZSVA 3BXXA 1KEPA 1XA0A 3CEAA 4CM8B 3HUDA 2J3IA 1I3KA 4ITUA 4Z6KA 3LT2A 5CDTA 1LDEA 1UDBA 1ENOA 1SEPA 1VE9A 1P9LA 5TSDA 5LDGA 5I7EA 3WBFA 1X14A 3VZQA 2W98A 1EE2A 4UEJA 3MWEB 4XZ3A 3GUCA 5L7TA 1E1MA 3UH1A 3L6OO 5K6AC 3JSAA 3VH1A 2RBEA 2D5AA 2DUUA 1GR0A 1H9AA 4IIUA 4I9UA 4Z3KA 5FI3A 3MJSA 2JD2A 4Y8VA 3EC7A 4BQRA 3OH8A 1LJ8A 3WJAA 1IOLA 4L74A 4ROSA 3E9QA 1VLLA 3GRKA 1I8TA 1YJ8A 3SC6A 1Z75A 3GR6A 4J91A 2FPGA 4NNJA 5KJFA 3DBLB 4HUJA 4CQMA 5JY6A 2Z1MA 2X4GA 3OA0A 3GH3A 4IS2A 4R16A 5EN4A 3IJRA 4Y6SA 2I67A 1SEVA 5ITWA 3KYCA 2P4QA 5K6AA 2NV6A 4DC1A 4I5GA 5A9SA 3H9QA 4FFPA 4W9NA 1W8DA 2NVBA 3DTTA 4ZQFA 4XGKA 4CL8A 1ML3A 4FJ0A 1HL3A 4NH4A 4ESOA 4FFNA 2ZQYA 4HKTA 2GGSA 5TT0A 3S2GA 8LDHA 2PY6A 3WQSB 5MGBA 1XQ6A 1F8FA 4W7IA 5CEEA 2G82A 4YAGA 1DC4A 4J1QA 3TZKA 3V2UA 1PEDA 4DBZA 3W4KA 3KTDA 3NJ8A 4MP3A 3SXPA 3OM9A 5IN4A 1GADO 2G76A 1Z7EA 4Q3DA 2YDYA 4ZD6A 1I32A 1E7SA 2NWQA 3HDYA 1GL3A 5BSFA 4J1NA 2BFPA 1LRJA 1E6EA 4E33A 1ISGA 4BUCA 4KUEA 3GF4A 5HBRA 3PDJA 2BELA 2BGKA 4Z9FA 5JLAA 2FOIA 3WLEA 2AQIA 3JQ7A 1QLJA 3KLPX 4CMBA 4TZKA 5CDUA 3GHHA 3JD3A 3NX4A 4KDFA 3WWYA 3BMCB 4BO8A 4BMSA 1ZXLA 1A7AA 5KKCA 3C1OA 1EK5A 4BNLA 4RDIA 4DQUA 2VOEA 4E13A 5G2OA 5THKA 1HTBA 4EUHA 3TFOA 2EW8A 4YJDA 4A2CA 5HTOA 1AGNA 3PHJA 1G0OA 5DBGA 2PNFA 1LQTA 1U8FO 1K2WA 4J7CA 3UW3A 1QLHA 1W6UA 4PN3A 5U9CA 7ADHA 4J1TA 1QYXA 4AICA 4DLAA 4BNFA 4WEOA 1PS0A 3CE6A 1ORRA 1X7HA 3RUDA 3KUXA 3ZWVA 2ZYDA 1H93A 5DCUA 4HFNA 4NBVA 4ZQHA 4A27A 3VVCA 3Q3CA 4EITA 4R01A 4IS3A 1OC2A 4KZPA 1KY5A 4AJJA 3WBBA 3ANLA 1F14A 4HADA 3QP9A 3GDFA 3EHEA 2OMEA 4E2WA 1NQAO 3RWBA 1Q0QA 5ENVA 4NPCA 1PSDA 3IS3A 3QVXA 4YAJA 3O03A 2FRDA 2YFHA 4U0JA 4D46A 2QRKA 1DAPA 1T24A 2VNSA 4CM4B 2YW9A 4EJ6A 5I7VA 4BHTA 3RU9A 1FDTA 1LDYA 3S1LA 2CVZA 2ZYGA 2DBRA 3CKYA 4NQZA 5FFFA 3ZGYA 4BGEA 4IQ8A 4O59O 4RZIA 5AYVA 2RIRA 2DM6A 4M8SA 5EMHA 4B8ZA 4HFJA 1KC1A 4IJWA 2VWGA 3EUWA 2FMUA 3ZNQA 4E2YA 4IDGA 3N7UA 4NFYA 5KVSA 4JP3A 2EIHA 3DBHB 3GC6A 4BIIA 2Q50A 3T7CA 4ND2A 1NR1A 5DP1A 1XR3A 3R1IA 3R3JA 2JFHA 1SOVA 2JCVA 5JS6A 3H6KA 2B4TO 3IUSA 4RVSA 1PJLA 1R37A 3RCBA 3H5RA 4YCAA 4CMEA 4DWVA 5LDHA 2POQX 5JY1A 1FDWA 5G4KB 3TL3A 1IL0A 3ETEA 3L9WA 2GN6A 3C1TA 3H9UA 4LRSB 3V8BA 2FHSA 1PL6A 3P2OA 2UUOA 2BRUA 4RV9A 1YB4A 2EP5A 4YJFA 3AM3A 5DOVA 4A0SA 2JHFA 1XU7A 1H6DA 4BNHA 3D3WB 1B8PA 5EESA 1P1JA 3LK7A 2D2IA 2C20A 2O3UA 2O50A 2H9IA 3RUEA 2FP4B 1HLPA 3QHAA 3I6QA 3RC9A 1ENYA 4PLWA 3BAZA 4CMGA 1W4ZA 1GUFA 3LZ6A 1ZK3A 4N18A 4B3IA 1HYGA 2BFAA 1I36A 1S6YA 2NU9B 4IGFA 5COAA 5J23A 1MC4A 2HQ1A 4M86A 3BTSA 4P4GA 4M54A 4YBZA 5FI5A 3MTGA 1DJNA 3WMWA 2Z1NA 4BNVA 5CAEB 1F12A 1VPDA 1V3UA 4BB5A 3AM5A 5T6BA 2HMVA 1EQ2A 3PHGA 2B35A 3DZIA 1KC3A 2O4CA 5A5FA 1X0VA 6ADHA 2C07A 2FPIB 1I2ZA 2AHRA 3L4BC 5F21A 3H7AA 4NJOA 1ISIA 5CP8A 2EJVA 5IG2A 5BT9A 4WLOA 5JXWA 1BXGB 1CETA 3CUKA 4QFCA 1D1TA 3ASUA 5CDSA 4TVOA 1QV7A 4J49A 2DVMA 2O3QA 2OGUA 2PV7A 3ON5A 4WCDA 2YHIB 3WYCA 4B7XA 1NPYA 3WB9A 3M2TA 4DLBA 3TZ6A 4GVLA 2GASA 3AWDA 4B4OA 4BGIA 2XXBA 5GMOA 1NHWA 4RO0A 1N1EA 1LBEA 1NAHA 5I7FA 2C7VA 3TJRA 2YHUA 3ROMA 2O48X 5EPOA 5IN5A 1LDBA 4F6LA 2NTNA 2G1UA 2JJYA 1P3DA 5KVCA 3IP1A 1ADCA 5EL0A 4I9HA 3G1UA 2NQ8A 2PH3A 1D7OA 1AXGA 2A92A 3PJGA 4PRKA 2IZ1A 4EJ0A 2VUSA 1DC3A 4ZQEA 3T4EA 2Z95A 4YTEA 3P2YA 2DBZA 2Q4EA 4JROA 2VYVA 1R66A 1OAAA 4DVJA 4FOSA 5F1OA 5IZCA 1MX3A 3K73O 4CMCA 1MFPA 2CD9A 3BHIA 3E48A 4UUMA 4W99A 4FFRA 5CPBA 4AJPA 1BSVA 4BO9A 3INGA 3U4DA 4PFJA 1FXSA 3HDJA 3AJRA 3U49A 3JD2A 3C7AA 1IUKA 3GAZA 5CDGA 4RVFA 1Y7TA 2P9GA 2D3TA 3GRPA 4BO3A 2PWZA 2Q49A 3KSUA 3V5NA 5JYDA 1OC4A 3Q0EA 4INAA 4G5HA 3V1UA 2VNAA 2IDZA 2Q1TA 4CQLB 5IXSA 3KYCB 3UFXB 1YL6A 5CPFA 5KJEA 3WSVA 3F47A 1D8AA 3G0OA 3PYMA 1D1SA 4QECA 5FF9A 3AK4A 3PYXA 4FS3A 3EZYA 4G2NA 4RF2A 4BNTA 4C7KA 1U5AA 1UP6A 3WGZA 1OZAA 3M1LA 3WLFA 2E37A 2WD7B 1C1DA 1UXGA 3RROA 3PFFA 3HWRA 2PD6A 1XELA 1T25A 1A7KA 3IP3A 1BTOA 1XGKA 2VUTA 2DTEA 1ZFNA 3E6AA 4XYBA 5L95A 5G0UA 1RM4A 3VC7A 1H6BA 3OBBA 4WKGA 3RASA 1WDKA 4MP6A 2RCYA 4DPLA 4BKPA 4XRGA 3ZCXA 3P7MA 4P22A 3TOXA 1LC0A 1PZEA 3Q2KA 1R6DA 4ONEA 3WIEA 4D42A 2PZJA 4OXYA 4I5DA 5H81A 4UVDA 4D44A 3ZN2A 3SJ7A 1YQGA 1T2DA 4IIVA 4TSKA 4E2ZA 4ZGWA 4GWGA 3S55A 1JKFA 2FN7A 2QYSA 3GG9A 4FFMA 5COQA 5TGDA 4FR5A 2CVQA 2V6GA 5A9TA 3W4IA 1FK8A 1TVEA 3Q1LA 4S1VA 5CHEA 3OF2A 1HE2A 5CEJA 3CMCO 1Z7BA 3PWZA 3ONDA 3GHYA 2JHGA 3TRIA 4KOAA 3GY0A 3H5AA 3LU1A 4B79A 3AY7A 3PIDA 1T2CA
chains in the Genus database with same CATH superfamily
4MKGA 1SAYA 4WN9A 4L6AA 4UFPA 1XTZA 3JQBC 3G7UA 2PS9A 3ZV6A 3COVA 1CIJA 1KSHA 4PX5A 4F4CA 3VHLB 3IDAA 1UOQA 4LXYA 1OFUA 2EX0A 1XCGB 2BEUB 4Y2GA 2QUKA 1QXSA 4ALLA 1AO0A 3UJNA 4PX2A 4G1FA 1W94A 3CVUA 1HDOA 1DTSA 1YK1A 3SZGA 5KWJA 1SY7A 3HKEA 4MWCA 3W8EA 5B1IA 1GNSA 2PXXA 2XT9A 3V8RA 2Y66A 3CVWA 1Z13A 1DRVA 4U5QA 2JAPA 1F17A 2A8YA 1FY2A 1TUBB 2ZYRA 1QVAA 2Z2KA 5CM2Z 2B4YA 3JPWA 4QELA 3FDZA 4WH0A 3UXYA 1O77A 1FRQA 1H8EA 4WZAE 4PZDA 3MMPA 4WE3A 1KRWA 2X15A 2QXYA 1H9BA 1Z6TA 3NATA 1TUIA 2N0SA 3CR3C 3LXMA 2OAQ1 4QHTA 2OYRA 5C37A 1MB9A 3D4BA 2BBSA 3WGYA 2OP1A 1T9KA 3TTWA 1G7SA 3VR5D 1XZHA 3DP9A 2I71A 4GPD1 5JCOA 3UGQA 3WX0A 4KPGA 1T91A 4TL8A 4WXHA 1JAHA 3HXOA 3IUYA 3QEJA 4RJJA 1Z5PA 1L5GB 2RHMA 1TUBA 1C3JA 3C16C 3U7QB 2WU8A 4LVOA 3PA8A 4WNCA 4Q4JB 2OZPA 1Y8ZA 3EWSA 2PS0A 2XOKA 1NOJA 2VK8A 4RY9A 4GR5A 1ZPDA 4O02B 2ENUA 4ENRA 3R5TA 5K3DA 1YE5A 3NANA 5DTEA 1DRJA 1DHRA 1XHFA 3CO5A 3UMBA 5BUCA 3PNBA 3NEYA 1GL7A 2WC1A 1ICEA 3C5VA 3TTUA 5LWHA 2J9XB 1T0UA 1EUDB 4PGAA 4XDZA 3R0ZA 3TPCA 4FN5A 5AVUA 5H9WA 3U16A 1N0VC 3IMEA 3QPCA 1GLNA 2R47A 5ICFA 2NG1A 2VT3A 4OQPA 4MQUA 4PYJA 4US2R 4K8OA 2NV0A 4DUZB 3Q8KA 5DRYA 3AUFA 2WWXA 1A9XB 3FNHA 1JFLA 1YNSA 3O8QB 1TLTA 3IPCA 2WMOB 2D00A 3EWNA 2PD4A 2V7QA 4MMZB 5AXCA 3OPQA 1Q5PA 4W1QA 2AUMA 1J07A 1WXIA 1PYDA 2ZUVA 3DEZA 2VT6A 4AUNA 2QY9A 1D6JA 1U9IA 3N0TA 7MDHA 3ECAA 5FTNA 1V2GA 2PSDA 3WLOA 4BVFA 5BOSA 4FS8A 5K0JA 2XCLA 3QVGB 4MV7A 1V47A 2FP4A 5C3UA 3NHBA 4QQRA 3ETCA 5HIIA 1QP7A 2H52A 4D9GA 4JWKA 1WV1A 3JWIA 3PK0A 4LJ8A 1W85A 2JJ1D 4B44A 1N77A 3LLMA 5THQA 2JGAA 3LMKA 3RBXA 5C8YF 3JQAD 4R7ZA 2VQ6A 2ZCVA 1DWOA 1UADA 1YQWA 3LYLA 5E3IA 3QEBZ 5AKLA 3PB3A 1FUYB 5D6OA 4OLBA 4XEUA 2EGGA 3MEQA 4D4KA 2J8ZA 3JD0A 4UPDA 5BUSA 1TC1A 4KGVA 5DASA 1U90A 1W75A 2CD7A 3IOBA 4OIMA 3TKAA 4PW0A 5DJ5A 3KKMA 3BXGA 4K28A 4J7XA 4LXXA 3PCRB 4RVNA 1I2AA 1R6BX 2OV2A 1SCJA 2H4XA 3ZWOA 3EJWA 3QVMA 3ITKA 4CJXA 2F55A 1SOMA 2D3WA 4PZLA 5LLSA 4AJKA 4U8HA 1TM7E 3FWNA 4C01A 1RIFA 2D1SA 3IMCA 4FOLA 4KWCA 2BW0A 2GZSA 2BKLA 3OHSX 5JUWA 4QUJA 4J94A 3EPLA 3PX2A 1QH1B 1U9CA 2FSFA 4ZVQA 3BCRA 2FFRA 2DJIA 3QXHA 4AJIA 5DSXA 1TYEB 3BFJA 2Z3WA 4IICA 2B92A 3FF4A 3IAUA 1A2QA 1QIEA 1R4NA 3F6SA 3MC1A 1VL1A 3OJLA 2OB2A 4L3VA 4ASUD 1W9HA 4FFVA 3VJKA 4KWIA 5CNMA 3ONFA 3ROPA 1IXKA 1C0PA 1XJQA 5HZGA 2NU7B 3DOIA 2YVLA 3ENWA 4Q15A 5EHQA 4DLKA 2O2JA 4CTMA 3S7ZA 2OQRA 4UBMA 3LOQA 1JWLA 3WNVA 1BDBA 1L3IA 1M2NA 2B83A 3VV3A 5HHTA 1ZLXA 1AJEA 2HLDA 2BUBA 2HIHA 1IHYA 3IESA 3M9LA 1GQFA 2VRNA 2WB2A 3A1EA 3DBIA 4BV2A 3EGEA 4DZRA 1SO8A 4M36A 4KRFA 2XADA 2YOGA 3WGGA 1C9EA 4F8JA 2XTAA 2EGUA 4ZVPA 4ARZA 1G5PA 1JKIA 3O8BA 3T99A 4J16C 4L8GA 3EN0A 1J99A 1WSBA 2LDXA 3D81A 3EOZA 3LS2A 4RANA 4EQ6B 1F2TA 3X3HA 4X94A 4YQYA 1MH9A 4N5LA 5LMNB 2FSVA 3QUBA 4YMUA 3OEYA 4INOA 1VIMA 2W2TA 3DT9A 3TPZA 4BP9A 1RABA 1SVUA 2MTBA 2YN4A 1JXMA 2H2IA 3KHSA 3ENZA 4LNAA 1OTXA 3IB3A 3L8DA 4Q47A 4OMFG 2SCUB 4MYSA 4ZYLA 1R10A 1W1IA 3TX6A 1L7EA 1OXSC 4QATA 4ESHA 5AVKA 5AM2A 4XIFA 2PQMA 2BR5A 4F8YA 1BJTA 1Q74A 3PDCA 1V96A 3LV8A 4PICA 3A1VA 1NQOA 4O63O 2JFNA 2CE2X 3FSGD 4J6FA 4F3TA 4NS4A 1D0IA 1BGWA 4ABTA 2WM3A 4I5IA 2JGDB 3DD1A 3PRHA 1W2GA 3WWEA 1PTJA 4MS1A 4EQZA 5AJXA 4V1CB 1C3XA 4S1WA 4REMA 1L9XA 1JTVA 3SJAA 1YS6A 2R4QA 3ZI4A 1G41A 2NU6B 3LX8A 2ZQZA 3L02A 3QITA 4GWKA 3I5UA 5FR1A 3WIUA 3EULA 1AS2A 2EBFX 4JYPA 3N2KB 4KGXA 4LHSA 3CX4A 1SUWA 4KWEA 5GVSA 1T6XA 5B7QA 5IM4A 1EFPB 3HJTA 3G6WA 2D5LA 3GNSA 3U62A 3ZLBA 5GZ6A 5GV8A 4KNYA 2IL1A 4L2IA 2AE2A 2FW0A 2IOFA 3GLHB 1WZUA 2CHEA 2KQUA 2C8LA 3P2MA 1JPNA 1V5FA 3RSHA 5A4KA 3HCAA 4AQYB 1MAVA 2B2XA 2O05A 2J0VA 4G5QA 4YYEA 2AF3C 3AGQA 3QVUA 1Q77A 4MS1B 1LV7A 1ZUIA 3G7SA 1X7YA 2J3DA 3O84A 3CUSA 5CG1A 2W2VA 1W5AA 4MQBA 3X1ZA 5BUQA 5DNCA 1XNQB 3DWEX 2WWWA 3DTVA 3H1TA 3KFLA 1TA9A 3KG2A 2XTZA 2WF7A 3NJ4A 2XT0A 4N40A 1KH2A 4JLUA 2CFOA 2R5WA 2P3SA 1C7FA 2ZS9A 4HNSA 3HLTA 4IZOA 4L9RA 1YI1A 3GLUA 4PZ9A 5KNBA 3KKNA 1U7UA 2CLHB 3JQ8B 4RZ2A 3RSQA 2XNJA 1QGED 1U2EA 3UJ3X 5C4MA 2GEKA 1LFAA 2GNPA 3ISTA 1E1RD 1QHHB 1FFXB 2H2FA 3ETNA 3VKVA 4DANA 1E5VA 1GPH1 1YB5A 2GTPA 2PMDA 4PPFA 4R2IA 4KN9S 4C4RA 3CV3A 2I65A 4MEBA 1K7CA 2Q21A 4IF6A 3ZY6A 3PIIA 1N2CA 1V41E 4DR4B 3OQOA 2V7PA 1CF9A 3K0AB 5EJEA 2BEJA 1R3DA 3MMSA 2QRJA 1NY6A 5GQSA 4EI9A 1HSOA 1QB8A 3H99A 1N6PA 4NWIA 4BKUA 1TCUA 3D6MA 4L72A 1NAIA 4Q9AA 3VPHA 4EMSA 4BMXA 1AE1A 4ARAA 1HOXA 1QQ5A 1XTPA 2V4UA 2AFIE 2XPCA 1B8NA 3PPYA 4FZ5A 5AI4A 1G8YA 5FORA 3P9PA 4IFEA 3CZ9A 2W2LA 1LSJA 4K5QA 4AMVA 4Y2HA 1CVLA 5IMBA 1FLNA 4P8RA 1NFFA 1THGA 1WW8A 3PZRA 4FEYA 2DFVA 3F7OA 3QELA 3RUFA 3HCWA 1BA3A 4M98A 4N0DA 5A6VA 3QX7A 2PLNA 1R6AA 2YZNA 3R3ZA 4FLMA 4RFSB 4YWHA 5B3JA 4WNAA 2J46A 1EZZA 3NIWA 2VTDA 4GOND 4W7HA 4E31A 2XUIA 2RB5A 1RU3A 1RQXA 4F84A 1GTSA 4AJ1A 5IW8A 1Z8NA 1YA8A 4R8VA 3NTVA 4V3CA 1W59A 1KEEA 4UATA 3DMFA 2DEUA 4PIMA 5DT9A 3VX3A 3TVTA 1TZBA 4CEJB 5LNK1 3VR2A 1EX7A 1PF7E 3OT4A 4AO7A 4BBPA 1VPWA 1KQGA 4PNZA 2HHAA 2DQ4A 3RAFC 2CL7X 1G8SA 3Q2OA 3F7MA 4IIHA 4XJSA 1JQKA 1VL6A 3FTPA 1RACA 3K0HA 3B78A 1ZD9A 5BN5B 1GARA 4H08A 4ROTA 5IKOA 1UEJA 4ASUA 3FTNA 1KQ3A 4UM7A 3W9SA 4BBJA 1SQGA 1ZD2P 4J4HA 1EX9A 1Y4AE 5JAMA 5AHXA 3LZDA 3TM5A 2ONCA 1I2DA 2TMGA 2XIQA 1L6IA 1RAGA 3VI3B 4GFDA 2JGNA 3AYXB 5F2KA 5AXAA 4JJ4A 4CMHA 4XGNA 2Y0EA 2YXBA 1L3BA 4J0DA 3IJEB 2PZGA 1UC5B 4BYMA 4KR7A 1NXXA 2HK6A 2J3EA 2MSEB 2W6IA 3KUDA 3R40A 4BO4A 1DLJA 3D5TA 1Q17A 4F2HA 5FOWA 3FBGA 2ZIUB 3THYB 4ZOLF 2VTEA 2YFKA 4U7JA 3BWMA 3KXIA 4FKMA 4O0MA 2AK2A 2C4NA 1RWMA 4G4SP 5DOZA 3RJZA 4EFKA 5IK2D 2ZUFA 1NJ5A 2OHGA 3ZV4A 4W5OA 4E21A 3H75A 3M6IA 4YP5A 2AN3A 3WFZA 3Q9UA 4OGFA 3OCJA 4G1MB 3GG2A 1ECGA 1YUNA 2RHLA 1CWUA 1NZJA 4GBED 5DDIP 5JISA 3PT9A 3U4QA 5CFOA 1QYCA 3HZRA 3JCZA 3MLEA 1KMIY 2AB0A 2HU7A 3NKLA 1KORA 3E35A 3G59A 2GYUA 2P8SA 3HB1A 4M8KA 4HDSA 3R76A 1JEYA 5DHPA 3WNCA 2XSZA 5IAOA 5K3EA 2O3SA 4TYQA 1KVTA 1XCOA 4PAMA 4R3NA 1QKKA 3AKEA 5J1TB 4ETNA 3HSSA 4EVQA 2F62A 1RXIA 2DKFA 2GM3A 2XQGA 4I19A 3LCCA 4RA9B 3RUPA 4ZMSA 1H8ED 2SHKA 3K6RA 5BSKA 4BLWA 5EJ8A 3U1BA 3ZNOA 3RAEC 3LQYA 3T1OA 4UNIA 3L7CA 2A78A 4HB2A 2ZXFA 3HG7A 2I34A 4M55A 4Q1VA 3T9AA 1ZIPA 4HATA 2A7XA 3R8CA 5BUZA 2A2ZA 1E92A 4M2LA 3X1JA 2UKDA 2GVDC 4OHPA 2QTTA 4P5DA 1Y1TA 2I2FA 1BRTA 3K1AB 4KQWA 5KQLA 1XXHA 5CA1B 4BEVA 5M2QA 1BMTA 5E8RA 1IJBA 3KDAA 2VH2A 3GZTB 4JOSA 3LRXA 4X7BA 3IUJA 1T0BA 1JHDA 5LSAA 2CDAA 4JGBA 2EF0A 2PGLA 4WJKB 3RODA 1U81A 4E7OA 3HDVA 2C3UA 4MVJI 3IAS1 5DF1A 3Q5EA 2EXXA 2X0NA 4Y6QA 3DR5A 4WUTA 2PSSA 2I6GA 3O4RA 1WVMA 2H1WA 2X0EA 3R9IA 3TXAA 5DN6D 3PRJA 2YOHA 4IOLA 1ZJ4A 4ZEMA 3M8KA 3TOVA 1GTL1 1KJ9A 5A5EA 4O4HA 1GPAA 5FWYB 4D6XA 2UVQA 2WTBA 1S02A 2NXNA 2VHQA 4GKVA 3KKZA 3CTPA 5JECA 1YFKA 2R65A 3OBIA 2IEAA 3GDGA 4KAAA 3KT8A 4P7JA 1VG1A 1LPSA 3KB2A 4IILA 3AHGA 5JCOC 1U3WA 3MSCA 4YJ2B 5K8UA 4DREA 3TBFA 1XCPA 3B2NA 1UMKA 2BMAA 3NBUA 4PLPA 3LG2A 4DUGA 3PGMA 5FUQA 5KINB 4BB0A 3K9NA 1W49A 1IJKA 1L5VA 3L92A 3LWZA 4BO2A 1DINA 4G01B 3GGCA 2VAWA 4IZIA 4QOHA 5AVOA 5C3MA 3LRTA 5IYZA 2C8VA 1Z8HA 5HS4A 1MC8A 4MVJA 5B1SA 2QP4A 4DLVA 1R6UA 3I30X 1IOVA 5K0NA 1G7CA 4I6JA 4ND4A 2LCQA 1OYOA 4Q3EA 5CR9A 1M6WA 1VTKA 4LYJA 2HYIC 4EGSA 1J6UA 1XAGA 1DMSA 2XQJA 2ZIAA 2E4UA 3HO6A 3CZRA 5EHGA 4RKEA 2XWSA 5ECWA 2BN4A 2QIPA 2WQ7A 4QSHA 1JT2A 1Y5MA 4LBWA 1AMOA 3VC1A 3AV0B 2CUNA 5KQPA 3DOOA 3DV0B 2C31A 2J09A 1WW3A 3ECSA 3EG9B 3DPIA 1WHSB 2QUJA 4K26A 1TCBA 2YV1A 3ZQ6A 2EZ8A 3IQEA 4R1LA 3D2CA 3I23A 4BNXA 1L5FA 4JGIA 4F3NA 1L7BA 1ZJZA 3ASVA 2WUVA 4RPGA 2IYPA 5I7SA 3LQQA 3SC4A 3WNQA 3PV0A 3AFOA 1F4VA 3HFGA 4G5YA 1BH6A 3VR3A 1J0CA 4ZK2A 1NI4B 2H1RA 3MQFA 3I2KA 4JL6A 2EATA 1J8QA 1W5FA 2Y9MB 1YVDA 2FSHA 2XWJI 3H13A 3I9JA 1C50A 3M6FA 4NMHA 3UT5A 4IXDA 3AKZA 4M6WB 1E2HA 3SJZA 2WHPA 4CG0A 3QW2A 1ICIA 4WY8A 5A6SB 2JI9A 1JRLA 3UJ7A 2CXNA 2IJGX 3BRQA 2Y92A 3K3PA 3UT0A 1DGQA 2C5GA 1YZNA 4I1VA 5IC6A 2WWVD 3C7CB 2Z5FA 3C7KA 4ARBA 2FZWA 3PHLA 1M8KA 3C3XA 1C9YA 2RGBA 1J42A 1D5CA 3DL4A 2FA9A 3QVSA 2CDBA 4UTXA 2ABWA 3LQ1A 3NBFA 4RSGA 1BXKA 5GZ1A 1MHPA 4BXOA 3VR4A 1JKJA 3ODPA 1XL0A 4UW9A 4UTVA 1IXRC 1SUEA 1VKRA 3DKIA 3OMWA 1T1SA 2VWHA 3WMXA 3KUUA 3OIDA 3GPDG 4FMBB 5CFRA 2CL6X 5DULA 3VZRA 2NUBA 3AL0C 2ZT7A 4QWWA 1Z82A 1RQ2A 1SBYA 2B21A 2I1LA 3PNPA 4JP1A 4TWAA 1B7GO 4ZZ3A 3ZE7A 4Q82A 1M6VB 4E1AA 3VOAA 3FDFA 3KPVA 2W0MA 1CY1A 3KR2A 3EC2A 2Z5GA 3S2IA 2I87A 4D4IA 5L3SB 1A4RA 1CZOA 3I4CA 3JTMA 1UMBB 3AEQB 1G8PA 3E5HA 5EA2A 1LLUA 2JW5A 5FJIA 1PQPA 3IERA 4HX5A 2OCBA 4PYKA 3HJCA 4B80A 3T1HB 3GEDA 1FFXA 4DG8A 3MUOA 1O5OA 1YE8A 1WZNA 4YK7A 4QOIA 2HTFA 1C3OB 3TLYA 1P74A 4DR6B 4DUGD 4RORA 4JYCA 3GLGE 3CXRA 3CLRD 2P2SA 5G41A 2A4MA 4ETIA 2YBEA 1NL3A 1T29A 4FHEA 1QMGA 1NI5A 3PR2B 5TDHA 1VJ1A 2A94A 1NRWA 1TCAA 2X23A 4PY2A 4CT0A 3SNKA 3IQIX 5KVAA 5TQ2A 2BF7A 2WR8A 3KYIB 4UVGA 5BSVA 1OT5A 1EMDA 3LPLA 2J0UB 1AK1A 1G6OA 4RSHA 4TMYA 2C5FA 5KHOC 2NQTA 4P32A 4I0WB 5PGMA 1V5IA 1T2NA 1JSZA 2P1ZA 1GV1A 1C0KA 4DQVA 3B52X 4M37A 4FJ1A 1QK4A 2II6A 5AI6A 2ORIA 1MDFA 5ALSA 1VGVA 4DVGA 4NFHA 2W83A 3T95A 3K53A 3BULA 4WJLA 3LHSA 2P4UA 2G06A 2VLIA 5I45A 3LUJA 1F0KA 2AJDA 2B1RA 2H1VA 3D5QA 4EUKA 5HDBB 4BVAA 3GQBB 3R9KA 1JGTA 2IFTA 1R00A 3CLUD 2H4FA 2KX7A 1GSAA 3IDZA 4K3VA 5JNVA 1PNQA 3WL5A 2GD2A 2OBMA 1JLHA 2OOKA 2QVCA 5ESWA 5H9VA 2Q41A 4QT4A 1NVTA 3I39X 4HG2A 1UBJS 4ILEA 1Z18A 5E1MA 5KNDH 3IJPA 2BD0A 3G2KA 4QL3A 3ICPA 3AHJA 4TV8A 1H0RA 3TNDA 2BMDA 3DM9B 4EJSC 1FBTA 4WINA 1J9EA 8OHMA 1WM1A 4NJMB 4DGQA 1AY0A 1XQXA 3RSFA 2C00A 1HLDA 3AF6A 1VKJA 2YYAA 4IDNA 3EGXA 4NHOA 3ZU3A 4B3BA 4C3OB 5JWHA 3MQ2A 3MIZA 1TU0A 3DBOB 2XNCA 5LP6A 1TK2A 3VMFA 2BKAA 1KARA 1SZDA 5CJPA 5I7WA 4TT3A 1ESZA 5J4KA 3K71B 3QNWA 1R0BA 1CQZA 2JFWA 4YA6A 4LF9B 1SHJA 3EG5A 5CVVA 1XDSA 3O82A 2B30A 4D6YA 5HE8A 4R41A 1JB9A 1S7CA 3AB8A 3F98A 1XQ1A 2PFGA 1FW6A 2YNMA 1V1RB 2JFPA 3DBLA 3G82C 3OZIA 3F78A 1J21A 3KBOA 3BXEA 3AIKA 5FULA 5A7HA 1WZ2A 4KXYA 3UO8B 2B1JA 5BQ3A 5CD9A 2WP8J 2J5XA 2IE8A 2QTMA 1NUPA 3FMOB 3GK3A 1HETA 1ZXXA 2XA9A 4XR4A 2OYCA 4XM2A 1L7DA 2HJHA 3ZE1B 4CCSA 1O97D 3EA5A 1KH1A 2PUDA 1U0GA 5HZMA 1TZKA 4JT2A 2IXTA 5J40A 4BL5A 4ZCRA 2E3JA 1WD5A 2CBXA 2JDIA 2RKBA 2KWIA 1A9RA 5HFJA 4EUNA 2IHUA 2R6HA 2NXCA 2XUJA 3N75A 2MOKA 2C54A 3OZFA 4R2HA 5B1YA 3K09A 2JCGA 1XKXA 3H3JA 4G0XA 5DGHA 4HY3A 1LLQA 1HRDA 2H2GA 3MPOA 3UK2A 4EOGA 1E1CB 3V7NA 1G8AA 2CUZA 1ISFA 2VPIA 5JSHA 4HDMA 2YRXA 3LGAA 3HO8A 1KRHA 1AA6A 4ZZIA 4YHHB 3ILSA 1ZG3A 2Q07A 3ZTYA 1L9KA 1UQUA 4U0KA 2PQ0A 3O8OB 3VTKA 1W4RA 621PA 3L0YA 2LBPA 1J2TA 3BE5A 4Y2JA 3WOVA 2W2LD 4MPRA 3DL7A 5YASA 5A0VA 3LBFA 1DFIA 1V43A 5F77A 4LWQA 4XJTA 5AIBA 2BTQB 3CLSC 2FXVA 1X86B 2O9JA 5KWEA 1VIDA 4PZCA 3H9BA 4K6MA 2ZKIA 5IARA 4P34A 1QNLA 1QWOA 2VP2A 2QD1A 5L4SA 1PNOA 4PNEA 1BAPA 4IPTA 5LD2B 3SI7A 4BU0A 2WVJA 1DG3A 3FWZA 5DNUA 3N1UA 4JVMA 1YDGA 2Q6VA 3N2YA 5FWYA 2Z8ZA 3NTQA 4IZHA 4YUZA 4DR5B 2IYTA 5SY9A 1HNZB 1WU7A 3X44A 4CLEA 4NENA 1ZOLA 1SA0A 4ZI5A 1KAGA 3ZWYA 4MULA 4ZMRA 1V1MA 5KPJA 2R6DA 4MUMA 4JOQA 3UFXA 3HY3A 2QW0X 2FXIA 2RB4A 1A69A 4AZSA 3K7EA 3KFXA 1UBSB 1MAAA 3CEHA 5AW5A 4FZ3A 4RPLA 1KVRA 5HF5A 1CW2B 1GQ2A 1CRPA 3I2JA 4KUGA 3JWEA 3CWQA 4FEAA 2FEWB 3P2JA 1BHJA 1AGRA 1DC6A 1RHMA 4P83A 5DT2A 4WBNF 5LC1A 2XZPA 5ALFA 4BMCA 3IBCA 3CX3A 2HK8A 4L6CA 5BQOA 5B3KA 2ZJ1A 3V7UA 1JIJA 2ZCUA 3WYEA 4B0OA 4EUEA 2P2DA 4MQ4A 3E81A 4FNOA 5EJ2A 2GBLA 2BDUA 4F72A 1IJEA 2FJPA 3W2GA 3SYKA 1JWAB 1R8SA 2GMWA 2JIZD 4GI7A 4KIJA 4NKRA 3T52A 1NR5A 3LQRA 3NYRA 1K6IA 3M6XA 1ECFA 3ZJUA 4TRMA 3EQ2A 3WMRA 1T2AA 5SYNA 5CBKA 5JAPA 1M7HA 3KS9A 2NV2B 2GNOA 2WDZA 2X4IA 1E8MA 3N3BC 4MX8A 4PZYA 1NJ2A 1O9HA 4PFQA 5EQJB 5F76A 2G1PA 3A70A 3DZJA 3TGPA 3BXZA 1QH1A 1SUDA 5HQJA 1RXWA 1CY0A 2JFXA 4KUHA 5HG0A 2FEOA 4HD8A 5KYKA 2XWQA 1TL7C 3TMYA 1PU2A 4PRLA 3JD1A 4F21A 4UVIA 4URWR 3FROA 4PGGA 1NX9A 2EDCA 2VK1A 3VDQA 2FZVA 3NXSA 3AUKA 3WB1A 3FTDA 2RHJA 3PE6A 3QXXA 4LTMA 5I9SA 1JJVA 1DJPA 5TVGA 3LUKA 4L9SA 2AI1A 3ZZ1A 4G25A 4G0PA 4N65A 5AOBA 4C87A 1OZ0A 1WCIA 2PBFA 5TF0A 3I5MA 1Z5WA 3WHPA 5LU9A 4LCEA 1VRCA 4EFDA 1B4DA 1W2HA 4PBTA 3M3HA 2OCKA 4AN1A 2Z08A 4IMPA 4WACA 4BUJA 4A10A 3ND9A 4DYVA 3GA0A 2PKRA 1THTA 4LNHA 4BO7A 3ICWA 2R7AA 3A1CA 4OOEA 4C07A 3U31A 4F60A 2PK3A 2QV7A 3PJDA 3NUGA 3CE9A 2EZ4A 2X1MA 1M1YA 2B3DA 2IX3A 3MT9A 2ACEA 3ELYA 3IMGA 3KALA 3K1ZA 2XCTB 1NURA 1U3UA 4MR8A 4DTCA 6GPBA 4YAWA 1KNXA 1WUYA 1WCIB 1DFHA 2F3UA 4KTTE 2J9ZB 1MT0A 3FNBA 4TXNA 4PNHA 3ME5A 4KH0A 4AKHA 2FSPA 3LNTA 5JZVA 3FYSA 1Y37A 3PSAA 2VPZA 1M2WA 2ZULA 4XD7D 2O57A 5DWQA 4DIDA 2O2HA 4G0UA 2YNMD 4LY3A 2BEWA 4X63A 1ZK0A 2WYOA 1Q83A 1T4CB 1UXHA 2AQHA 4XD2A 5ALTA 1EJ0A 3NG1A 2J4CA 3P0FA 3I52A 6Q21A 2G0TA 2Z2ZA 4IXWA 1YQDA 1L7AA 3V1KA 1YQ9A 4E11A 4I4CA 2V1XA 1QQ7A 1U9JA 3WBJA 2AXEA 2WJPA 4N5MA 4OH1A 3QWBA 5EMJA 3EYAA 1P6XA 4A26A 2X6RA 5EJ6A 4FLEA 4NYJR 1SHTX 4WXRA 4CR7A 4RQAA 5HP4A 2Y1CA 3DBVO 1VLMA 2LUOA 2AX4A 1II9A 4YUAA 4PGFA 2IDKA 2P6RA 2W7TA 1KZ7B 1B1CA 3VTAA 2A9RA 1V39A 1T5SA 3UEOA 3AQIA 3I37X 3LCUA 4MICA 2ZJBA 5DN9A 4XYLA 3DFIA 4R2WA 3RK0A 1B14A 2B34A 3RGWS 2Y99A 1WDTA 3G8BA 4GVPA 4KPUB 3MJEA 3SKYA 4QOJA 3ADPA 4RGYA 5A03A 4AY5A 3LC2O 3HGTA 2ZRDA 4MGEA 1I80A 4A0GA 2KI5A 5M5BA 4BFSA 2J33A 1UT5A 1C7IA 3FGNA 4LCBA 3UV3A 1SUAA 2AF4C 3Q7PA 4FX5A 2XGOA 3KEQA 1S8OA 2ZEJA 1EGMB 1FU7A 1NC1A 3FZYA 4RD1A 4YJHA 2NZWA 3DZGA 4EPXA 7ABPA 4QTYA 4TROA 2GXAA 2JFYA 4GECA 3GLSA 4ZKDA 1FTWA 1EZ4A 1QH0A 3FCSB 3GOQA 1ZM7A 2PU7A 1LU9A 3AFHA 2AR7A 2ZS8A 3UJPA 2V8BA 2B4QA 3N76A 2V7BA 5KJ1A 3WLTA 3SDSA 4E2FA 3PX7A 3OZSA 4EL5A 5A1TA 3IOEA 4WQMA 5MN4A 4RH0A 2DETA 4KPUA 1KYTA 4OSOA 4Y2QA 4JYMA 3OQIB 3VVLA 4C0SA 3F4BA 3M5DA 6YASA 4BPBA 1HOTA 3O0DA 1SVIA 1ECLA 1PJCA 2QMYA 2TSYB 3G5LA 1Y89A 1EPUA 4C4PA 1NGSA 1QYRA 1Z6AA 2X0KA 3GT0A 3OEHA 4QFMA 1O94C 1QRRA 3I58A 4QWMA 3SYNA 3GJRA 3NGLA 4DCUA 3INRA 4LXIA 4HGRA 3KQWA 3IEPA 3LDHA 4ZWNA 2C82A 4LBYA 4XJXA 3TDMA 3ZJYA 1NV8A 2RGNC 1SOUA 2FZ4A 2A9FA 3EYWA 1KBZA 3K0EA 2P4SA 4IX9A 4YJ3B 5CNJA 5M29A 2DECA 3SQWA 1UAAA 1ZK2A 4AP9A 1Z26A 2J48A 3KYBA 1FZTA 4DHWA 1WKCA 3FPLA 4RLFA 4ZDIA 4YO8A 3CX7A 4BFZA 1PGJA 3T15A 1NBWB 4FYXA 1POWA 2B7LA 2GN2A 4U00A 4LFCB 2CMFA 2GBLC 3DLPX 4S0ZA 2OUIA 4N12A 1DCKA 5FYDA 4B47A 5KB3A 2K5UA 2QHXA 1HPLA 5BW6B 1QYWA 1CUXA 2G63A 3DEYX 4NAUA 4Q4JA 2ORYA 4BO6A 1HDYA 4C7MA 4EG3A 5ICSA 4F2DA 1GZDA 3K0KA 1EUQA 1Q2XA 3PE4A 1KJZA 1EHCA 2YZ2A 5SZHB 1VFNA 3H42B 5K01A 1GVHA 1QDUA 2OV1A 3OJXA 2ONZA 5ALNA 2O5CA 1PLJA 4Q9HA 5E0OA 4RS3A 2KBFA 1QDEA 1NKVA 1V26A 5IXJA 1R7RA 1PEYA 1J97A 1SUCA 4FFOA 1D2EA 1ES9A 5DM70 1RWPA 3K70C 4BLVA 1NVVR 1JDUA 3IPAA 5ALQA 5FTMA 5K4AA 1M8GA 1UJMA 2Y1EA 4QO7A 2QAGB 3WGNA 5JXIA 3VO8A 5IT4A 1CK4A 1E4OA 1XJ0A 2I6QA 3C97A 4OK5A 1Y4ZA 3LT1A 1AF4A 2QSUA 3UKOA 2WJAA 4HPXB 1JXQA 5DYTA 2OTCA 5FOUA 1DAMA 4KOEC 3UPUA 1R8YA 5BRJA 2XRYA 4BB6A 3Q2IA 1NFQA 3IODA 4REOA 4NOKA 4PZZA 2QTWB 1VPLA 4QT0A 5CGZA 1U9ZA 1OAOA 4OLAA 4DRXA 5IDWA 2PX2A 2DLNA 1GPUA 1K89A 1HURA 4DCMA 5J58A 3Q3HA 4IJKA 5K3BA 3KNZA 1XRNA 1A77A 4H0NA 3QVWA 3FOWA 4JCOA 1ENZA 5AT1A 3LF1A 2WTMA 4NQRA 4IF4A 4YRCA 4ZANA 4ABYA 2ZBDA 2JLZA 2AGVA 2GHTA 5FJJA 3EIOA 2K4MA 3HYNA 2AEEA 3OTQA 1UPAA 2X9QA 5ALJA 2Z3ZA 1CQXA 3ZWBA 4E15A 3U4QB 2CHFA 1PTKA 1LA2A 4JJGA 4EF6A 3JXEA 3TLGA 2G40A 3SSMA 2C4VA 4Y9TA 4B75A 3KKOA 5K0ZA 3MAGA 4COOA 5LYYA 3TB6A 4P93A 2IIQA 2ZZNA 3FZNA 2WNSA 4YP6A 1P1RA 1DAHA 4NZMA 2LKCA 1MRNA 1U3VA 2H31A 1KI8A 2QRNA 1U7TA 2DY1A 2GUGA 2SKEA 2GBPA 2ZYAA 4WL0A 3K6SA 4FYVA 4HQ6A 1GRNA 1ETUA 1L1QA 1MC5A 2PWBA 2VTKA 3HPQA 4IRUB 4AO8A 3BD6A 4JUDX 3EA0A 3D43A 4G5OA 4L28A 1RBQA 3OICA 4MB6A 3ESAA 4QUIA 1N0UA 3DB2A 1R9JA 1QBGA 1V1MB 2NVWA 5CDHA 5CJ2A 4NTZA 2O8BA 4F96A 1CVRA 3BEOA 4NECA 1M74A 3DBRA 3OFSA 2QB5A 1VL0A 3GLFE 1FP1D 3F3KA 3RJTA 1BDHA 5ALVA 3LXUX 2G36A 1GZ4A 1T2UA 4B4VA 3GA7A 1D9ZA 2DU8A 2Q5LA 3FIUA 2XRMA 1E1KA 3HI6A 2YXLA 4RL4A 5TGTA 4JFAA 2QI9F 1X94A 4NYMR 3L41A 2QZPA 1BE1A 3I4FA 1CQIA 2YQZA 3CLTD 3I09A 4KFCA 2YZ7A 1MZVA 4PXAA 4IX1A 1NP6A 3QG5A 1V6SA 6CHYA 1O95C 1QR2A 2G6BA 4GC9A 13PKA 4W6QA 4FE7A 3VU9A 1GZ7A 2DTXA 2YZKA 3HJGA 3LA6A 2C95A 1XEXA 2FPMA 5EJ9A 3GLTA 3ZDAA 4YIKA 1PGPA 2GCOA 5D85A 2IZ7A 1OA1A 3JYHA 4FFSA 4YAFA 2JRLA 1V4BA 1ZA1A 3M2PA 5G3YA 3O8QA 1RJDA 3GB9A 3ZD7A 2AZDA 3HJHA 2GFIA 3PTZA 4PTLA 1LDNA 3H5NA 4IJUA 3VH3A 8ATCA 1GGVA 3K8ZA 1NJGA 5DGTA 4BQOA 4RZHA 5ES4B 5JJBA 4KYIB 1QH9A 4R5MA 3PEEA 2HRZA 4ZU3A 1TJNA 4TWJA 1DAFA 2OPHA 1EDEA 5KDLA 3FMVA 4CLDA 2IWRA 4P0QB 4OQZA 2H7XA 3T4XA 4H7DA 2YWEA 1DX9A 4N9WA 1YR3A 3EG9A 1A9ZA 1JDSA 3SFZA 3TLMA 3ERCA 3GNQA 5JMWA 1ISPA 3E9NA 1T5LA 4UDNA 2IZ0A 5AXBA 3TG2A 3MHTA 4GOMD 2VR1A 1VCNA 2Q1SA 4UULA 5HKAA 1QHFA 3G8CA 2AOTB 4NDAA 5CNIA 3TKYA 1ZOOA 5DVZA 1GLVA 4KR6A 1N9GB 1Z45A 3GGPA 1FMLA 4PPGA 3T5AA 4PO1A 4BVGA 5J4HA 5EQDA 5JEEA 3ND7A 5TGZA 4F4DA 4TKLA 3AY6A 5FOSA 4YQFA 1RM3A 1V35A 2ZTMA 4XWTA 3BSSA 2W8ZA 1NMYA 3GLHE 3OOEA 4CLOB 1ZUWA 5LJIA 3EDCA 3P5SA 4WK0B 4ZALA 1RHRA 4UOZA 4OQDA 2WUGA 3U4IA 5G1PA 2SKCA 1RM0A 4TMVA 4BX8A 2H48A 3Q15C 3S2UA 2XWPA 1MFZA 3CRZA 3EGCA 3VDXA 2OL4A 1WL8A 3IURA 3NO4A 3QJ5A 5ALWA 2YJTD 1KZ9A 3IXLA 3AIOA 1QONA 3NHRA 4LX8A 4YEDA 2PKEA 2KMLA 4ZOCA 3ZZTA 2W2KA 4WFJA 4DEXA 3EK2A 3L0PA 2YWFA 6NULA 1GDHA 5AW3A 1P4RA 1UWCA 4DY4A 4ZJUA 3ZE6A 2ZREA 2UXCB 3G8DA 5B1HA 1U7PA 3HR8A 1LUAA 2XJ9A 3HADA 4TMFA 4A2QA 3JRNA 4J75A 4I08A 4CM7A 3V4SA 4WKCA 1WR8A 5EYPA 2Q3EA 4FIDA 4TXLA 4CM3A 2GZ1A 2OG2A 2PMCA 3QXJA 4LK3A 2JC3A 4ZYWA 5BVGB 5L3QA 5K3OA 3IFSA 3OX3A 2BFFB 3QEMB 2R1ZA 4RJIA 3TQSA 2PM8A 3T9DA 5EI5A 3P9RA 1O8CA 4X20B 2AN5A 1J39A 3U60B 2L42A 4BO5A 1RVDA 2NPIA 3CC8A 4D0RA 2X1LA 1TEXA 3FDXA 4HDAA 4I4TB 3V4VB 4ARZB 1H6AA 3HYSA 3OHMA 5SZIA 3RFTA 1IEQA 3A2NA 1F6BA 1L5WA 3LKDA 3T34A 3IX7A 1S1MA 3F6RA 1B26A 4LECA 4M0DA 5CDFA 4X24A 5KTOA 4R1TA 4RNDB 5KO2A 5D5QA 3TLEA 2IP1A 4MUNA 2ORED 1RIIA 4JN6B 4Z9AA 3RVLA 3UC9A 2CJYA 3AKYA 4GZ6A 3QXGA 2PMBA 5BY2A 2PGJA 2PA0A 3WL6A 2GSDA 4BUZA 1KJ8A 3AR8A 4TTTS 2JFOA 4ZVSA 4RPKA 3PC8A 1WUIS 2V1UA 4NOMA 1DRWA 2QMHA 1NBMD 2OXCA 3CF0A 4OUDA 4XYMA 1ZAYA 3I5AA 1K98A 4R9VA 2O52A 2R84A 1OROA 1D9XA 4Q21A 1LDMA 3C8HA 3KFVA 4WN9B 4XX0B 1WD7A 2R4TA 5AJHA 3VA7A 2IKQA 4XM0A 3OX4A 3MW8A 1DDIA 2AKAB 3L0SA 3IA7A 3PFWO 3PVSA 4DA4A 4YRPA 2P77A 2P0YA 4YVFA 1DZIA 1ZO8A 1RLIA 2NO9A 1C29B 4M7OA 5G0VA 5A04A 2XMBA 4ZV7A 5MF6A 4MEJA 1U3GA 3C6YA 3HXMA 1YZHA 4GHWA 1ID8A 1U6KA 3KLNA 5AVJA 4ARVA 3FPBA 3H5WA 4X1OA 1ULSA 1EFPA 1KY3A 4ZT3A 5CT9A 1TPYA 3B1XA 1NTRA 4NNPA 3N2EA 3QUTA 4E5PA 3CPSA 4W5TA 2JVJA 3L8ZA 5JPIA 2ADMA 2OA0A 5AW1A 4UD6A 4OAQA 3ZWCA 4YMLA 3CNOA 4WASA 1SC1A 4OHMA 3JQQA 5MFZA 5JE8A 4OYRA 1PJ8A 2R6R1 4F38A 5JNWA 2IV7A 3LSTA 4B6RA 5CT6A 3NAGA 3NHZA 4G89A 4B3JA 4X54A 2WNIA 3S8EA 5JNSA 4G0VA 1TGVA 2COEA 5KMGB 2QPTA 3B8HA 1JHOA 1RC0A 5FWXA 1XD9A 4L5BA 3E1KA 3DFUA 3KTAB 4KMMA 1EVLA 2C0QA 3H2KA 1QLWA 1Y80A 2R62A 1Y1QA 2KHZA 2VYCA 4IQ4A 1ZCAA 2X86A 1TJ4A 5JAQA 3GRRA 1A82A 4BGUA 5HPYB 3F46A 3NHUA 4ANFA 3B20A 3C6ZA 1QOQB 4LKOA 4DLTA 3H86A 3V2GA 4JENA 4C9BA 4AAYA 3FVWA 1VC2A 1TIKA 5FI1B 1C7QA 3A36A 2FGKA 4M9QA 2HZ7A 4B9EA 5KWSA 3F7TA 3FRHA 4AMBA 2HA7A 2QX7A 2HRQA 2VYVD 2WDPA 3DOHA 4HYYA 5FWXB 1SU8A 3A27A 3KDPA 3E8SA 3I05A 1ZN2A 2C2MA 4H7EA 3GD5A 3PC4A 3PE3A 3ENNA 5JZMA 2KLBA 2TS1A 1UBTS 4BJHB 1GEEA 4B2PA