2FZ4A

Crystal structure of the n-terminal half of archaeoglobus fulgidus xpb
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
206
structure length
206
Chain Sequence
IAEIYYERGTIVVKGDAHVPHAKFDSRSGTYRALAFRYRDIIEYFESNGIEFVDNAADPIPTPYFDAEISLRDYQEKALERWLVDKRGCIVLPTGSGKTHVAMAAINELSTPTLIVVPTLALAEQWKERLGIFGEEYVGEFSGRIKELKPLTVSTYDSAYVNAEKLGNRFMLLIFDEVHHLPAESYVQIAQMSIAPFRLGLTATFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein RAD25
publication title Conserved XPB Core Structure and Motifs for DNA Unwinding: Implications for Pathway Selection of Transcription or Excision Repair.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Dna binding protein
total genus 63
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2006-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF18458 XPB_DRD Xeroderma pigmentosum group B helicase damage recognition domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2fz4A02
3.40.1170.30 Alpha Beta 3-Layer(aba) Sandwich MutS, DNA mismatch repair protein, domain I MutS, DNA mismatch repair protein, domain I 2fz4A01
2O52A 1R4AA 2AHOA 4BLRA 4OI4A 4LV5B 3DKPA 2RGAA 2QPTA 1OHHD 2P6NA 4TMVA 2ZRMA 3EPKA 3L0OA 4XVQA 2QE7D 3CBQA 4AD8A 4M9XA 4EQ6B 3ZVRA 3U7FB 2YNMA 2IS6A 4YMWA 1ZCBA 2DB3A 3Q9LA 2EVWX 4WZ6A 3EZ6A 3W3ZB 3SQXA 1FUUA 1E2PA 2D74A 4BFXA 1LV7A 1KYIA 1E2LA 1OXSC 4C0AC 1G4AE 1AQYA 2DWQA 3M1IA 5D3MA 3TUIC 1JNYA 1GNQA 1R7RA 1U94A 3PR1A 1EESA 2J1LA 1T4GA 4M53A 3K70D 4TMXA 1VG9B 1YR8A 2NO9A 2F43A 3GJ7A 4BGDA 1MOZA 5C18A 1Z0DA 1Z07A 2DFLA 3O8CA 4QFMA 4OHYA 4GMXA 4W7SA 2ZJ5A 5TDHA 3CKLA 2QGZA 3BK7A 3K9HA 4RKFA 3OEHA 1E79D 1ZMXA 4B3DA 3RVBA 3U44A 4DWJA 5JJKA 1N0UA 2YYZA 2ZSAA 4B35A 4P32A 4D0NA 4ILEA 2O8BB 3T34A 2YOHA 1CJMA 1TQ4A 2IYUA 4RZ2A 2J9RA 5L3QA 3AB3A 3ZIAA 3T61A 4GP6A 4PAMA 4XWOA 1W36D 1BMFD 4BFTA 4FWIB 2A2ZA 3NBYC 3KFXA 3DOEA 2ZSFA 4L15A 2XZPA 2PLRA 1A4RA 1G21E 2G3YA 1VCIA 2OFXA 2Q3FA 3MGCA 3N70A 1IY0A 4PHFA 2ORVA 1WBBA 4TLBA 1Z06A 3NHBA 3OFND 2QI9C 1SHZA 4P4UA 5J4YA 5LBIA 4LOAA 3DHWC 2GXQA 2GAOA 2QG6A 3Q7PA 4OJKA 4OHWA 1ZM3A 5AR1A 2JLVA 3E1SA 2PZGA 1TAGA 2DHRA 2ZR9A 2AFIE 5KSPA 2FGKA 3H1TA 4AIIA 2P5SA 3MRSA 4MH0R 3BERA 4D0LB 1AGRA 5FOTA 1OKKD 2V55B 5KU1A 1FX0A 3U6BA 4LY6A 3W3AA 1HT1E 2XXAB 1RRGA 4BEBA 3WBKA 2H17A 3B1VA 1Q3TA 2W6ID 1IN8A 3SDZA 3VX3A 3L0IB 2GJ8A 3DMNA 2JLZA 3HP1A 4FMCF 3EPHA 4OK6A 1KNXA 4RVCA 2GBLA 3JVUA 5EP1A 3TKLA 1OH6A 3K09A 4A8JA 2D4HA 1VTKA 4KLNA 4S2EA 3QI2A 3TAUA 2AX4A 1U9IC 2XSZD 1DTSA 2H18A 2G1JA 1R6BX 2PCLA 3SHWA 2FDCA 4IDQA 4HYYA 2VHJA 3GJ4A 1RIFA 4TSFA 2ERXA 3C4JA 3S1AA 3ZZUA 3DKVA 2JLUA 3PEWA 5FTMA 1BS1A 2BM1A 2CCKA 5HCNA 2WTUA 3RRMA 1XEXA 4NH0A 5J4LA 3RC8A 3KJGA 3SHFA 3P4XA 1JAIA 4NP6A 521PA 4MKHA 2J7KA 2LCFA 2X2FA 1L8QA 1IM2A 2F3TA 2FSGA 3AVTA 4KBGA 3R7WB 4Q4AA 1Z2CA 2NO0A 1P72A 3FGNA 3RRZA 1NY6A 1QHSA 5E4FA 2AK3A 1G7TA 3PUXA 5H8WA 3IPYA 1BYIA 3X1WA 4RD4A 5BN3A 1W2HA 1A5TA 1NVUQ 5TY0A 3EAQA 4LBWA 1UFQA 2ZSEA 1G8HA 3VQTA 4NCNA 4ESHA 2A5GA 2AL7A 2QTHA 4JJKA 4E5UA 4I1OA 2I3BA 3A37A 2FFQA 1U0HC 1Z6TA 4BUJA 1ZP6A 2WV9A 3RS5A 1VCOA 3RSOA 1XTJA 3IIKA 1RJ9A 2H1LA 3A6PC 3UANA 3EIHA 3WYFA 2NO7A 2Q6TA 2V9PA 2XNDD 2N42A 3U4QA 2AR7A 3SFVA 1FOEB 4OYHA 3K0AA 3RLFA 3L0SA 4S35A 3CZQA 3H84A 1SULA 4A6PA 1DADA 3GLFE 2LKDA 1T3HA 2BCGY 5FR1A 4TQUS 3R9IA 4V02A 4PPGA 4MGIR 4PTLA 2A5JA 1G7SA 3N2IA 1SVLA 1MR3F 4XIGS 4YLGA 2PEZA 2NGRA 3QXHA 2RGCA 2WJVA 2BVNA 3ICQB 3SYNA 3GLIB 3QBVA 4X8MA 3UK6A 2X19A 4Q5IA 1IBRA 1IAQA 4WXRA 5IK2D 1HA3A 3QKTA 3D3QA 4OI1A 1BMFA 1PUJA 3CWZA 2GKSA 5CJ2A 3AKCA 1HH4A 1QBKC 2VSXA 4YMTA 2VP5A 5JBQA 3ZVMA 1E2QA 1VYVA 2ZE5A 5DSZA 1GKUB 3DMDA 2VF7A 1OYWA 2WIAA 1Z2AA 3T1OA 2CL7X 2XAUA 1G41A 4KFUA 2I4IA 3CONA 2W6IA 4KODA 3THXB 4D2IA 2H16A 4KHZA 3VTKA 2ZI3A 1UBCA 1F48A 2Q0HA 4EKDA 4EDHA 4KFRA 4XD7A 3AF4A 3E70C 1FQKA 1N6LA 2YOFA 2PBRA 3B1XA 3CRQA 4LC0A 1AS0A 4NDZA 2O8DA 3HU2A 1GRQA 1Q20A 3I8XA 5CYPA 2WMOB 3KFVA 1II8A 3EXAA 3B78A 3MWYW 4TYPA 2FFHA 4UNNA 4EFMA 4LJ8A 1M7GA 4Q4JA 3WHKA 1SXJD 2ZRIA 3SJBA 3FKSA 4NMMA 5CB8A 2ZJ8A 1G8FA 3QXCA 1E9AA 1PLLA 1E2HA 4F4IA 5FTLA 2O0KA 1KNQA 4NHOA 3UMRA 3X1XA 3QXXA 4TT3D 5JHGB 1G5PA 3C5CA 3L8ZA 1KHTA 4FCVA 3T5GA 1XCGB 2G6BA 3ZVNA 1L4UA 5CITA 3LFUA 3ND8A 1R0WA 4GDFA 2ANCA 4CT4B 2HLDA 4LJ6A 4GOXA 4UNPA 4ZI2A 5AWFC 3C14C 5G3ZA 1ZYUA 2FF7A 2VHTA 2ZE7A 4FMDF 1P9WA 5DHAA 4TL7A 4C9BA 1W4BA 1DAKA 4Q9IA 3R8CA 1W46A 4DLUA 2R6GA 5KDDA 2GHIA 4E09A 3BE4A 5F98A 4R9UC 2IF2A 3TVDA 5JLJA 1X3SA 1YQTA 1NVVQ 4LZZA 2XOKA 3GJ5A 3HWSA 1S8FA 2IUSA 1QHHA 4TQAA 2V6IA 1BOFA 3W6NA 2GXSA 1M74A 2QM8A 3JVVA 2V1UA 4WXPA 4V0LA 2F3RA 3I92A 5UKDA 3TK1A 4O3MA 3KDSE 5JFGA 3KQUA 1E4YA 1FX0B 3TLXA 2XXAA 1ELOA 3PEUA 4QM7A 3K0SA 4FXPA 2WSSA 1X8KA 2ORWA 4GFDA 3EZ2A 1CXZA 3WP1B 4DUGA 5FBQB 2PX3A 3A1VA 3KXIA 3ASYA 2J7PD 1JJ7A 1ZC4A 4ON9A 4BFZA 5AJZA 4DLWA 3GP8A 2J3EA 3LNCA 2GCPA 4A8JB 3FHTA 2GRJA 2OEPA 2B7BA 1X8LA 2QT1A 2DBYA 2FX3A 2OBMA 3B5JA 1BYUA 5EXTA 2IYXA 1EFHA 2YVUA 2QGNA 2GDJA 2OESA 4PXAA 1UBGA 1NLYA 1OFIA 1SKYE 4ERNA 1TNDA 1J8YF 1W0KD 3VKHA 4QRHA 1ANKA 1XMIA 3QENA 3VX4A 2VHUA 4LBVA 2OV2A 5EE9A 1HEIA 1W48A 4M2LA 1JR3D 4PQYA 5EUMA 1VHLA 5B57C 1A82A 1Z6YA 1KY2A 4EPTA 4GBMA 1OH8A 4B48A 4UQOA 4Q4LA 1S9HA 2FSIA 2MMGA 1KMHB 3U61B 2F1RA 3EC2A 1Q1QA 3WRXC 2GNOA 3K8YA 4YMSA 2ODNA 4BECA 5TVKA 1YE8A 2GF9A 2DWOA 3P27A 4FMDB 4JLKA 3RS4A 5A5GA 3AGQA 3W5IA 2FWRA 1IJEA 3B9PA 5DI3A 5G3YA 2IYZA 5BN4A 2ASEA 1KMQA 2ZYVX 2FV8A 3QXJA 4I4LA 1X1RA 2R65A 3SZRA 4Q1AA 2QAGA 4LHVA 2R6FA 3PCRB 1NMZA 1T0JB 1KKMA 3PUYA 1T6NA 2RGGA 5J4VA 1T5LA 1CF4A 4PHTA 2CXXA 2VYFA 4BZPA 2FG5A 3DM5A 4IFEA 3CH4B 1MH1A 4FMBB 2FSFA 3B13B 4FI3C 4IOLA 4WBSA 5EP3A 3T5DA 2ZUDA 4LV8B 2QNRA 2OT3B 3RS2A 3IBGA 4U5XA 2XZOA 4B34A 4LBYA 4B33A 3WHLA 4C7OA 1MABA 3AQ4A 3KZ1E 4PZZA 1XB2A 5J40A 4B44A 1OXUA 4DT1B 1SQ5A 2P0EA 3QPVA 3KB1A 2GVZC 2Z4SA 4CEJB 2JJ8A 2IBMA 4URXR 3B7GA 4AG5A 1JXMA 4QM6A 3BB4A 3LAWA 2G1KA 2ZS8A 3LV8A 4QHYA 4B71A 4URUR 3AF1A 1JEDA 2O8CB 4JBWA 4TMKA 2IEZA 2J7PA 2BEJA 2RCNA 3GJ0A 3EA0A 3GEEA 5G53C 2F43B 3BFXA 4DCVA 3SEAA 1N6IA 2OHFA 4LX0A 3I62A 3CH5A 3BJIC 3LX8A 3PENA 1E0SA 4Q48A 2J41A 3ZD7A 5JCZA 1Q0UA 2Q9CA 2CLCX 5B30A 4B75A 1OT3A 2WSSD 2Z4RA 3VHXA 4TL8A 2PMKA 3CR8A 2CVFA 3PITA 2J0UB 1XWIA 2QQ0A 1FP6A 4YDHB 3MWLA 1CU1A 3SQWA 4TMTA 1GSIA 4Q47A 5AK0A 2RHMA 4GP7A 1NN5A 2WMNB 3BOSA 2GA8A 4MUAA 2JATA 3AP1A 1PZNA 2AK2A 1G3MA 2A9KA 2NQ2C 2WAYA 2LKCA 3FFAA 1DAFA 3PFIA 4AKIA 4M21A 1N5LA 4PHGA 2ONJA 1KDPA 3LX5A 4Q7MB 4B3GA 3R20A 1R0ZA 2JLQA 4BZQA 5FH9A 4I1VA 2ZRDA 4TT3A 2CHQA 1U9IA 3THOA 4Q7KA 2EW1A 2WVJA 3WP0A 3GLFA 4L4UA 2IXFA 2WM9B 2IXEA 2JLXA 3VR3A 2OLKA 3QSYA 1XTQA 3R9XA 3MFYA 2AWNA 4MDEA 1S0UA 2JLSA 1GWNA 2Q3HA 2CL0X 2O8EA 4PSVA 1XRJA 3WYAA 1E9RA 1L4YA 1V5WA 2KSQA 4DLYA 3OEED 3PQCA 1G5TA 1QHXA 4P31A 4YQFA 1D2EA 4IDNA 3MD0A 2D7CA 1LY1A 5JRJA 2UZIR 1IXRC 1IN7A 4AYWA 1P9RA 2VHCA 1RZ3A 4JLJA 1N2CE 1KDOA 2VF8A 3A1UA 4LJ7A 1JPNA 3QQ5A 1JR3A 4XH9B 4A0HA 5AJXA 4CEHA 3AF2A 2VP6A 1KK2A 4DLRA 3RANA 1GKYA 1H8HD 3WNDA 4B2LA 4RKEA 3ETLA 1S2MA 4DDWA 4Q9HA 1ZRHA 1TF2A 2ZJ2A 4ITRC 4B74A 1SVOA 4JBYA 2O8FA 2XZLA 2ZI9A 4CZ2A 3DPUA 4NTZA 5CDFA 3IEVA 3Q8XB 4DSTA 1IN4A 2FEOA 2FH5B 3GFOA 3ZGXA 4AYTA 2PL3A 4Q21A 4Y0AA 5DYIA 1PJRA 1S9DA 2XSZA 2GVDC 4LC1A 4Q4HA 5GJWC 4EJSB 2QBYA 5BWMA 2BBSA 1N3BA 2FFAA 2NMVA 4AI6A 5BYKA 3EIQA 5GVSA 3K70B 1E1RD 2WZQA 5EE0A 5A0FA 1HQYE 3WMEA 2J46A 4CVNA 4FN5A 2R62A 2ZQ5A 4LWZA 1DO2A 4H9GA 2AN9A 5K8TA 1I2MA 2F1IA 4U00A 1Q1ZA 4TWZA 1RW4A 4WVFA 4WIAA 1P62B 4GRAA 4ZKEA 3WXMA 4UKDA 3QKSA 2WKRA 1U8AA 2DPXA 1NKTA 1PUIA 2ODWA 5FOSA 3L2OB 3ZQ6A 2VEDA 4QNMA 1DBSA 3PUWA 2RGEA 5E95A 3TSOA 1OF1A 1VG1A 2ZS7A 2J0VA 2X1VA 4MRRA 2WWFA 1G6HA 1N0WA 1Z6GA 3U4QB 3RWOA 2HDNB 4HZUB 5C46F 3K70C 1E6CA 5FR2A 4A0FA 3SBDA 1GNPA 4KO8A 2BJWA 1G19A 5C4GB 2YOGA 4MRVA 1P6XA 2WJJA 5FOXA 3WNCA 4BPBA 821PA 2CMKA 5J47A 1DS6A 2PX0A 3CPEA 2GCOA 3W6OA 2QTVB 4C0BA 3AVYA 1WBDA 4AKEA 4NYIQ 2IWHA 2V3CC 4BFWA 2ZANA 2ZRCA 2BBWA 3I3SR 5P21A 4XVUA 2I1QA 4OQLA 2P2LA 4OBEA 5H68A 5FUWA 3CNLA 3CWQA 4GT1A 3TMKA 3AVVA 3OAAA 3G82C 3HPQA 4D0GA 4C2TA 2B21A 2JGNA 5F9FA 5DNYB 1Z5ZA 1KI3A 3O47A 1RFLA 1MABB 4UNRA 5TARA 1NP6A 1KO7A 3F0TA 1NJGA 4QBGB 3HU1A 2OXCA 4CRWB 2C03A 4A6XA 1OXVA 1VECA 2V54A 1X8JA 2WPDA 3IUYA 2A3RA 1Q1EA 2FOLA 2B8WA 2KBEA 4HB0A 2XNDA 3IDQA 1E1QA 1GL6A 5GJCA 3ZVLA 3EZ9A 4QGAA 1KTVA 4IOMA 4V0KA 2HEIA 1CKEA 3QE0A 1E94E 4KAXA 4X8OA 3VNVA 4Q9JA 1F6BA 4WZAE 1EWQA 3IEUA 2HT1A 1W2GA 4W5WA 4ZKDA 2W0MA 2PZFA 4Q18A 3P4YA 5JCPA 1IY1A 1II0A 5L3RA 1R0YA 3NWJA 4HDOB 3L82B 1RYHA 3D7MA 3GFPA 3MJRA 1NSTA 1VCNA 2HF9A 1G8GA 2ZE6A 1QG2A 2PH1A 2WWIA 4KI0A 3QNUA 2WKPA 1E0KA 2JEOA 1Z3IX 1B23P 3L0PA 3KQNA 1HY3A 4D80A 4A36A 1XPRA 3QVVA 4YONB 4J0QA 2WWYA 2GCNA 4LPSA 4HUQA 2IK8A 2NO1A 3IILA 1ZM4A 3KXKA 5JHHB 1A7JA 1JEEA 3AP3A 2YWFA 3LD9A 4BLOA 4G0NA 4OKSA 2L0XA 2ZPTX 1CS4C 2HJVA 3ONWA 1LF0A 4FW9A 4HLCA 3IPXA 4UNSA 1E3MA 4U02A 1E69A 1FNMA 4HZIA 1SXJA 1VMAA 3RS7A 4M1YA 4JKYA 4M1KA 2ODEA 2WJIA 4HAZA 1E9CA 3P32A 1E0AA 2FU5C 4KYUA 2GEVA 4ZIRA 2XTZA 3NEJA 3ZS8A 2VL7A 1KI4A 1TQ6A 1AZTA 1W4RA 2NO6A 2JJ2A 2OAQ1 3DO6A 3LWNA 3REFA 1E9BA 1N0VC 1CULC 1S3SA 1FPMA 3BAFA 2QQEA 1OXXK 2QRNA 1YU9A 1UADA 3K0FB 5FOUA 3A36A 4JLBA 2O8EB 2WKQA 3SN6A 4HSEA 3AF3A 1S96A 4PX9A 1AN0A 4Q7JB 4A1FA 2GZAA 1DARA 3EWSA 4BFSA 3B1ZA 1SGWA 3V4FA 5FL7A 4EPRA 4A15A 1ZINA 1GKIA 3FB4A 1LS1A 1S1MA 1TU3A 4G5RA 1V43A 3TH5A 4E22A 2HXSA 4HB3A 4DXAA 1ZW6A 4QKQA 4Q7LA 3LBHA 2IS4A 4MKFA 4HUTA 4YXWD 1Q22A 1Z0IA 2HUPA 3MG9A 4QBHA 4TTRA 4B76A 2PEYA 2XTMA 3DOFA 4BWYA 5TMPA 1CP2A 6Q21A 2QRZA 1ESNA 1KJWA 1D2NA 5L3VA 2O8FB 3U7HB 2YKGA 2WAXA 1JALA 3U5ZB 421PA 2NIPA 5CIQA 2DCUA 2FPMA 2C96A 1N6HA 4YC7A 3NBZC 4DLSA 1EX7A 1R8SA 1TF7A 3VHLB 2C9YA 4TTQA 1SKYB 3FYHA 1AS2A 3OEHD 4KVGA 5JMTA 1O3YA 2QBYB 4ZPXA 1J90A 4KSBA 2CJWB 2KI5A 4OL0A 3PXGA 2ATVA 5JI3E 4HAVA 1E1QD 3DZDA 1ZNWA 3QY0A 1M8PA 2WPDD 4HLUA 5KNBA 1U8ZA 2GJKA 1UBFA 1N5JA 4IEEA 4TYYA 1Q3HA 1IXZA 3WY9A 2QSZA 3B85A 2QTFA 2RGNA 1R0XA 2WJGA 4G5QA 3HYTA 4EFLA 1DAEA 1Z08A 3LY5A 1EK0A 3LW7A 2FGJA 3IHLA 4F4CA 4V0NA 3EIEA 5HCIA 4KU4A 3LRPA 3QJYA 5CYOA 1E9DA 2ZRNA 3H86A 2GBLC 1JBKA 2AWOA 2GAAA 3OHMA 3S1AB 2YJTD 2W00A 5HE9A 3K09C 2C95A 1W36B 5KOYA 2REOA 5JJIA 3DEFA 1U0JA 4M4SA 4E07A 1TTTA 3NBXX 3BS4A 3GFTA 4TL9A 2CNWD 1UKYA 4AKHA 4LDJA 1SKQA 3AUYA 1RC8A 1OH7A 1U8YA 2BMEA 2IYWA 4RD2A 5JI2E 2IW3A 3BH0A 4M9ZA 3QG1A 4JYBA 1G18A 3JZAA 5JSZB 3B9QA 1DVRA 4MRPA 1KI6A 1TUEA 1NNEA 4O25A 3NKVA 1WP9A 2EWVA 3MJHA 2OFOA 3V9PA 2BBOA 4DIDA 2ERYA 4F93B 4CF7A 3NXSA 2JIZD 1T91A 4JBXA 4RY2A 1ODFA 4D4LA 3GLGE 4C0QC 3ICEA 4P4SA 4DHEA 2O8CA 4C0KA 1E0JA 4D4MA 1P7CA 2W2TA 4D6PA 1RPZA 2VRWA 1Z29A 2KB0A 2C04A 3KQKA 4Z8XA 3V00A 2C77A 4URYR 3TIFA 1E99A 1RJ9B 3FTQA 2JJ1A 2IF0A 1XEWX 2F1JA 2XEXA 1OFTA 4JL6A 4NZYA 1K6MA 2XTNA 2GESA 5FL7D 2O5VA 5DN6A 4PR0A 2KE5A 2IUTA 5HR5A 1EFCA 2OSBA 5JRZA 3MWKA 5DH9A 4WAUA 4EQ6A 2IEYA 1C4OA 2D3WA 2ZITA 4Z54A 1YHNA 4ZV4A 4YXWA 1GL7A 1G9XA 3OE7A 3CRRA 2IYQA 1KZGB 4TLEA 4BLQA 1GITA 4BQSA 1IY2A 3CF0A 3QKRB 3W34A 3ADKA 4QNRA 3BIFA 2WWXA 4MRNA 4GPTA 2GJ9A 4URVR 1GVNB 4BFYA 3NDPA 1NI3A 2H57A 2JLWA 3O8DA 2NPFA 3M0EA 4ZDJA 4TLCA 1UPTA 1P2UA 1TUIA 1NG9A 3W9YA 1GDDA 2FPKA 2G77B 2OCYC 4LYAA 4LHXA 4EPXA 4NYJQ 4IVQA 1ZCAA 3K0EA 4BZXA 1B0UA 4DEXA 2OXRA 4QJ5A 2ZR7A 4KFTA 2ZJYA 5J4HA 5L3QB 4Q9KA 3TQFA 2PZEA 5EXPA 5JEEA 1IXSB 3NC1C 4JLDA 3E2IA 3THXA 4R7ZA 5JWRA 1E2DA 1N6RA 4B6FA 4D82A 3EG5A 3RABA 3W8NA 5IK2A 4O2RA 1Z0FA 1W5TA 3JZMA 1SXJB 1UBEA 3C16C 4HLDA 3FVQA 4A9AA 3K9NA 5BW8A 3R9WA 4IFBA 3UPUA 2VSOA 4FCTA 1KI8A 4IOKA 2ATXA 1ETUA 1II8B 1KO5A 3TSZA 3C8UA 1PV4A 1G5RA 3P20A 2B8TA 2ZETA 4LHZA 4IW3B 4URZR 5CDFE 4IXMA 1D9ZA 1N6PA 4V0MA 1VCMA 4QG7A 3K0FA 1ZM7A 3QF7A 1E9SA 3CF2A 1ZBDA 4A0GA 1J8MF 3CX7A 3TVTA 4Q1CA 1WB9A 1OPXA 3BXZA 1ZUNB 1HE8B 1S1CA 2FA9A 3K53A 5CIWA 4A8JC 3DZ8A 2R6CA 2P67A 2QAJA 2KWIA 3I5YA 1QDEA 3O8BA 1E98A 1W5SA 5DIFA 2YV5A 4KYIB 4N3NA 2O0JA 4Y0VA 4KV9A 1XJCA 1ZVQA 5D3QA 1KK3A 5FUXA 3ZLJA 1EX6A 2WICA 5F2EA 4DRZA 3T06B 5DN6D 4KLZA 2ZVQX 2HLDD 3RC3A 1JQJC 2QPOA 1KOFA 3FKSD 4B3FX 3CNNA 1NLFA 1AJEA 1PLKA 5HTKA 2DFKB 2JIZA 3AF0A 1G1MA 3LLMA 1ZM9A 2VLIA 1XTIA 2CEAA 2ORIA 3Q3JB 1QHHB 4PSAA 1NRJB 2F55A 3QKSB 5AUQA 2QSYA 1XTSA 1TMKA 3OF5A 4MKIA 4LSGA 3GLHA 1TQDA 3CPHA 4B3XA 3ADCA 3PVSA 1G3IA 4K81B 1NMYA 5B58C 1Z63A 2GK7A 3FE2A 3ZZTA 1CTQA 1KJYA 1LNZA 1TEVA 2HCBA 2UKDA 3GJ6A 3IO3A 3LXXA 4RD0A 4F38A 1OW3B 2FZLA 5AUNB 2GZHA 2ZROA 4KSCA 2QENA 1G7CA 4C0HA 4RCYA 1XCMA 5L3SA 5H70A 2FMXA 5C1BA 1XZQA 3K0CC 2IC5A 4IVRA 4PHHA 4JLOA 1HE1C 4LYFA 3TNFA 3K9GA 4CIDA 3UWKA 4DCSA 4UJ5A 2BIFA 2P3SA 1E79A 1RRPA 3UG7A 1XD9A 3LLUA 2ZIAA 1KKLA 3TUJC 1IJFA 4MGKR 4US2R 2X2EA 1XXHA 3U2QA 3TQCA 2RGDA 3GJ8A 2IYSA 1N5IA 1P61B 1XNJA 2B7CA 4QL3A 2IT1A 2QP4A 4E03A 4Z1MA 4V0ME 4B73A 5KSYA 1E2KA 1AM4D 2CL6X 5EQTA 3I5XA 2ZJOA 2QN6A 5KSOA 1XU4A 3SI7A 2LWIA 1XBTA 2JA1A 2PMDA 3VR6A 3G0HA 5DISB 1G20E 1CRPA 1AIPA 4M1SA 3P26A 2XJ9A 3PUZA 3AKDA 3KXLA 4L16A 1W0KA 5JWHA 4B6EA 2OCBA 2BEKA 4G01B 4DBLC 5DI3B 3VKWA 1KO8A 2GXUA 2OZEA 3I32A 1QHYA 4XTRA 3I72A 2DFTA 3E5HA 2OBLA 4N0DA 1KY3A 1J2JA 2ZRHA 1AKYA 1F2TB 1KSFX 3CO5A 2XJ4A 1YJ5A 2WJYA 4OK5A 5SZIA 4TZ0A 5EP4A 1OE0A 4PO9A 2K5UA 4WW0A 4LRWA 2V6JA 3IQXA 1GG2A 1Q1BA 3CW2A 4IOJA 4LHYA 4UJ3A 2BMFA 5E3HA 2ZYUX 2W58A 4US0R 3ZYCA 1US8A 4NKRA 1KSGA 5F9HA 3SYKA 3K0CA 1Y63A 3TBKA 2AKYA 3N5CA 1G64A 1FNNA 2RKOA 1LTQA 5JEDA 1U99A 4OHZA 1G6OA 2JJ2D 4DLTA 1KGDA 1VDZA 4YMUA 2WOOA 3NH9A 4TYNA 3IIJA 2FN4A 2QA5A 2ZRLA 3WNBA 3ADBA 8OHMA 3BORA 4PQRA 2ZE8A 3CX6A 4PPFA 5GADl 1T3SA 2W6JA 3B8HA 3NH6A 2NOAA 3TW8B 2ZI5A 2GEUA 1EFTA 1WE2A 2MSCB 3EW9A 2BDTA 5CK4A 4MDFA 3CF6R 5FBWB 3RS3A 3FDIA 5HKKD 1FMLA 3QKRA 5G40A 3UMSA 3DVLA 1SHKA 1UKVY 3MLEA 2O8DB 3AP2A 1XZPA 1YR6A 1JR6A 1QHIA 1P9NA 3MSXA 3ZQJA 5HZHA 1UJ2A 2VP2A 1ZNYA 4NYMQ 3EA5A 1M1YE 4ZIRB 4XWAA 1KI7A 4C4PA 3U3KA 3X2SA 1R5OA 1T8TA 1QVRA 2WJHA 2X77A 4NCIA 4CGZA 4AG6A 1NN1A 1QG4A 2V4ZA 2J0UA 5FOVA 2QPAA 2CCJA 1VYUA 3AVPA 4ZDIA 1X6VA 1COWD 2ZREA 4V0OA 5CM8B 5J4KA 4TL6A 4M1WA 3EZFA 3VU9B 1ONBA 2ZSDA 1A2KC 4Q1DA 4BE7B 1OJLA 2WWGA 1KJZA 1IN5A 4RSGA 4RZXA 3RSLA 5EXSA 2GETA 1UEJA 4ABYA 1G3UA 2VSFA 4A2PA 4US1R 1LFDB 4I81A 1OSNA 1JXOA 2XB2A 4P33A 4AKGA 2UVQA 1KI9A 3VFDA 5HE8A 3QPUA 1VIYA 2XNSA 3QF4B 3X1ZA 3HDTA 3QXSA 4EFNA 4Z1MD 1NF3A 2Q3MA 4HDQB 4NE2A 4GL2A 2CBZA 4XSGA 2Q9AA 4LJAA 1ZC3A 1YVDA 5GJVC 3LQRA 3UKDA 5EJEA 2O8BA 1NMXA 2BKEA 3SFZA 1OIWA 1PVOA 2J87A 3H2YA 3KJEA 1N6OA 3Q85A 2F9MA 2BWJA 3H4MA 3NHAA 3B6EA 1GNRA 4IDOA 4DSOA 4M9SA 1BH2A 2D06A 1E32A 4RD1A 3PV0A 3A8TA 2GJAA 3OIWA 4JZKA 4JVLA 2MSDB 4QXAA 3LBNA 2BKUA 1XX6A 2HXYA 2YC2C 4K46A 1OH5A 2C99A 4HB4A 1N25A 1IOZA 1P4SA 1VPLA 3KJHA 1Z22A 2DY1A 2RH5A 4R2HA 4DCNA 2BC9A 1P5ZB 1R5BA 2NZ8A 3BRWD 4XTCS 1KDRA 2HYDA 5B64A 2ZRKA 3SJZA 1I2DA 2ODBA 2VTKA 4P4TA 1P2VA 3BC1A 2R6AA 5FBRB 1CJVC 1Z47A 1OIXA 1YZTA 3RRYA 1R2QA 1R10A 1VYTA 1G17A 2W2XA 2WIBA 4XOIA 1FZQA 1CR2A 2CVHA 5E7IA 4XWKA 2Y8EA 2NPIA 1NVXQ 1KMHA 5KPDA 3NBFA 4G1UC 4L8GA 3SC3A 3NDBB 4JIMA 1Z6AA 3OIYA 1F3OA 3B1YA 4LJ4A 2GILA 3OIUA 2FFBA 4JKIA 4W5HA 2KBFA 1TL7C 5FFMA 4LV6A 2QT0A 4RFVA 3T35A 3RDPA 1UAAA 4DC9A 2VP9A 1KI6B 4Q19A 3AM1A 4JL8A 3VAAA 3F8TA 1XTKA 1LF5A 3B60A 1T3LA 3BGWA 1KK0A 4UXIA 2BMJA 4IDHA 2PJZA 4NL4H 4TTPA 1L7VC 4QBFA 4FWTA 4P4SB 4M1MA 3B82A 4HDCA 3W90A 4LJYA 5CK5A 1ZD8A 2JCSA 3ZDQA 3THYA 4D26A 2D2FA 3KJIA 4PSKA 2Q21A 4C0LA 4UXHA 5TXGA 1LS6A 1MRSA 4F92B 3EX7C 4ESVA 3SJAA 3IBYA 4PFSA 4MYUA 4EPYA 1U81A 2C9CA 4A0RA 2IWRA 1XEWY 1FQJA 2X8AA 1TU4A 3GJXC 1FUKA 1VHTA 1SXJE 3CR7A 2VIIA 3OEEA 1UDWA 4NCKA 1JECA 1T5IA 2D2EA 4QHTA 1M7BA 3W6PA 3V4RA 4ZCMA 1DAHA 1QRAA 4PANA 4CEIB 4M1TA 2N46A 1Q44A 2EU8A 5CLLA 5ELXA 3FFBA 1FL9A 1UKZA 3I1FA 4F7WA 2RGNC 1J7KA 2R6DA 4KJZA 5CLQA 1JAHA 1KSHA 3SOPA 3CIOA 1VKJA 2VO1A 4NU0A 5ANRB 3AVWA 2QY9A 5LDDC 2WWHA 4WZBE 3SS8A 3L8YA 1Q21A 5IT5A 1OFHA 2VQSA 4JSYA 4GSYA 4GZLA 3RAPR 3MWJA 3EPJA 3TJZA 2WWWA 1ZUHA 1OHHA 1FTSA 3HPRA 3OFNA 5LB2A 3M6AA 5HZKA 5FI1B 4A2QA 2ZI4A 4X8HA 4B2IA 4L9SA 4DCUA 3AGPA 3EC1A 3KKQA 5LB4A 2OAP1 2QP9X 4FMCB 4LBZA 1KO1A 2P6RA 5FOWA 1DAIA 2IXGA 1XPOA 5BQ5A 1XMJA 1I4DD 1AQUA 2IYVA 5GJBA 1F2UA 3GLGB 4LK2A 3AVXA 3AV0B 4MYCA 3GPLA 3LQQA 5IRCD 4EJSC 1JPJA 3VNUA 2KJQA 1FMJA 3I8SA 2G83A 1EFRD 5DYGA 3ZS9A 4ARZB 1D2MA 4BEJA 3I4LA 4KCGA 1OIVA 4FINA 2G88A 4GI7A 1CEEA 2J59A 3FMPB 1G291 3SU8A 2ECKA 5DO9A 3K9LA 1DELA 2C98A 4FIDA 4OK3A 2DR3A 2BOVA 3KKNA 2MMCA 5KO2A 4QJ4A 3VU9A 4JLVA 3AVQA 4KXFB 2RMKA 4N0EA 2OO7A 2ZI6A 4LJ5A 3HR7A 3KUCA 2EYQA 4HAXA 4PPNA 3CRW1 4BRUA 1E96A 1XMSA 4ZDKA 2BCJQ 3QEOA 5G41A 4TLDA 1H8ED 2IYLD 4Q1BA 1S3GA 4QHSA 2HT6A 2BJVA 4H1UA 4DB2A 3D6TB 2GJSA 3GLIE 4OJQA 5AUPB 1JJVA 1SVKA 1NL3A 3FPAA 3KB2A 4QGFA 1XPUA 2QU8A 4PO1A 1G4UR 4BFVA 2WHXA 3QF4A 4URWR 1Z0JA 2R2AA 1KZ7B 4PC3A 2H8KA 4C0JA 1G3QA 2ZRPA 4OI2A 4DLZA 3PEYA 1MO4A 3T1VA 3LXRA 4DSUA 3QOFA 1RVDA 3EZ7A 4MYTA 4MRSA 5SZJA 2ZJZA 4TYWA 5DHFA 1K5DA 5L8VA 3KKPA 1C9KA 4JLNA 5GVRA 4DJTA 2YWGA 2G9NA 1L2TA 2V1XA 3GJ3A 3THWB 1ZU4A 2FJUA 2RGBA 1W0JA 4CT5A 4KVAA 1FW6A 3GMTA 5CJPA 3GCGA 1MRNA 1P73A 1AGPA 3WBJA 1XCPA 1NBMD 2PCJA 3HR8A 1Y3AA 4Q9LA 2EFHB 4A2WA 3W8RA 4U7DA 2IS1A 5FBLB 4OHXA 1GRRA 2F9LA 1XP8A 1N5KA 2C8VA 2IHBA 2DWPA 3U60B 2OILA 2Z5FA 2OFWA 2OCAA 5KPJA 1YZGA 4W9MC 2ZUBA 1LW7A 4RD3A 1XEXB 4BFUA 1K5GA 3QIAA 4KBFA 4KITB 1D8TA 3DL0A 3QBTA 3SJCA 1ZD1A 4B47A 4AYXA 1M7HA 4ZO4A 2CJWA 4I1SA 2VPPA 2IHYA 3C5HA 4OQXA 3FKQA 1DO0A 4M1OA 4MGYR 3EPLA 2NG1A 3OZXA 5FUVA 3RYTC 4AC9A 4ASUD 1YRAA 4BASA 3BH6A 2AD1A 2GK6A 1XD8A 1RRFA 1E2FA 4TYQA 4EIWA 1H65A 1EXMA 1XJQA 2W2VA 1EFRA 4AURA 4JVNA 4ZCIA 3CLVA 3BFKA 3CB4A 4JJZA 5TV2A 1Z0AA 1P2TA 5EE3A 3QUSA 4N1AA 3FHOA 1XD2B 3FMIA 4DDVA 5EZ6B 5HKKA 3WMFA 4EUNA 2A30A 5EZ5A 4JS0A 2IX3A 3CRMA 5IHPA 1OB5A 5SZKB 2ZU6A 2IUUA 3IKJA 3UG6A 1N6KA 1UEIA 4YMVA 4JMPA 3CPJB 3AVUA 2N1BA 3EARA 1T8UA 2ZSBA 4DZZA 2ZVPX 1WMSA 1OXTA 2P65A 3IO5A 1H8EA 4IKEA 4D4JA 4M8NE 2QAGB 1Z28A 2CCGA 4I1UA 5EE5B 3H0KA 2D62A 4HLQB 2I1VB 4ACAA 1E2JA 1TEXA 2R9VA 1BKDR 3T1TA 3N2EA 2EFDB 4IEIA 3TR0A 4RJLA 3HU3A 2REBA 4XD7D 3AUXA 3U3MA 2OG2A 1C1YA 2QMHA 1UDXA 1XXHE 4A92A 4BRWA 1GTVA 2VBCA 2R8RA 1VIAA 2ZTSA 1MO6A 3CM0A 5LD2C 2ZRAA 4IXNA 4QOSA 1HV8A 4ZDWA 2Q9BA 2ZRGA 1G16A 1JR3E 4A4DA 3IHWA 4KFSA 3A1WA 3F5FA 2FPLA 4HAUA 1A2BA 1COWA 4IVPA 2YC4C 2ZJAA 4CEJA 3IGFA 4Q03A 1SXJC 4HB2A 1XMVA 4CW7A 2QMUA 3LA6A 2EFGA 2AD5A 2F7SA 1DE0A 4RFSA 2W83A 2QAGC 5KDLA 2EWWA 4HUQB 1E2EA 2C2HA 1NJFA 1ZJ6A 3UXMA 2JDIA 4HEJA 2JAQA 2ZRFA 4DKXA 3NC0C 2Z83A 2XOKD 4PC2A 3CZPA 1W7AA 2QMOA 2ZRJA 4H1VA 3LH5A 1YR9A 1MO5A 2MSEB 2Z6VA 1HT2E 3SBEA 1F60A 2CHVA 2BBTA 4ARZA 4L5BA 2SHKA 5K8UA 3U3OA 3KKMA 4LHWA 2P5TB 3NG1A 4DUGD 3BH7A 4IRUB 1G8PA 1S4QA 3OIVA 4DSNA 4JLPA 1G8YA 5FI0B 4Q4JB 3MMPA 2FNAA 1CJKC 2QZ4A 4B2PA 2ZEJA 1X86B 1E4VA 2EFEB 3QVUA 4LCBA 5A4JA 1GIAA 1JI0A 3AKEA 4LGMA 5E7JA 5EP2A 3KQLA 4DLVA 3NTUA 5KYKA 1WQ1R 4DLXA 4JT4A 1WXQA 3UIEA 1NN0A 4M0LA 3BB3A 1GOTA 3BFVA 4POAA 5FUYA 1KK1A 1YKSA 2PLFA 4Q1FA 4O0MA 1I4LD 2A5FA 2XX3A 3DDCA 2OBNA 2UZ3A 3FWYA 3T12A 2CHGA 3GLFB 3KX2A 1MT0A 1W0JD 4QC2A 4ZI3A 2H92A 2HV8A 3RWMB 3KUDA 3LVQE 1NBME 2E9SA 3Q5EA 1JQLB 4MQBA 3KL4A 621PA 3RS0A 2HYIC 1P2SA 1M34E 4V03A 4LUCA 5C4MA 4G5GA 1T0HB 4ASUA 4OI0A 1ZD9A 1D5CA 4DCTA 1MV5A 2GZDA 4NONA 4OHVA 2CDNA 5JS8A 4R71A 3AVOA 1N6NA 1VG8A 1CBUA 2HF8A 2E1RA 4OQFA 2PT5A 4PC1A 4XSHA 5J5CA 5B2ZA 5BYJA 5FTKA 4EPVA 4M22A 1CIPA 3WMGA 5JS7A 2ZAMA 2CK3A 3A1SA 4TMZA 3TW4A 2VP0A 5KNCA 2G0TA 5AJYA 1AK2A 3PUVA 2IYYA 3ZH9B 4UNQA 1Z6XA 2QROA 4CEHB 2QMEA 1E2MA 1XJ0A 1QZXA 1OKKA 2QL6A 1WCV1 4JYCA 3EASA 1CJTC 1IN6A 2EQBA 3AEZA 3NEYA 4WA7A 4PZYA 1YZLA 4JT2A 3RRNA 2O0HA 4PC6A 1HQCA 3A4MA 1ZNZA 1YZKA 1CLUA 3IQWA 2B6HA 2AFHE 4PZLA 5LD2B 3GLHE 5K8LA 721PA 1ZIOA 4BLTA 3QKUA 4CDGA 1EGAA 1KO4A 4LYHA 4MUBA 3BB1A 5L3SB 1ZIPA 2XITA 2BM0A 1CR4A 2JLYA 3SNHA 1O87A 2ZAOA 1ESMA 5AJWA 4NYMR 4D81A 4G5SA 4JVMA 3U7EB 4CEIA 5JECA 1KSJA 1XXHB 1IONA 3X1YA 1XTRA 5KTYA 1UF9A 1XD2A 5JZVA 2XB4A 3FHCB 5AJVB 1YZQA 1ZAKA 1ZU5A 5FPTA 1W4AA 2EYUA 2XGJA 1U90A 1HURA 3G5UA 3VKGA 2D7DA 2WOJA 4K8OA 4RCZA 1UM8A 1M6NA 2ZRBA 1NVWQ 1W1WA 2ZYWX 1FP7A 1GILA 2H5EA 3KKOA 4TZ6A 2YWHA 3AH8A 5FTJA 4C7OB 2C9OA 1HTWA 3QPWA 1P60A 3RHFA 3R7WA 2Z0MA 4GZMA 1Z8FA 2FEMA 4DT1A 2ONKA 1MO3A 3PG5A 3CNOA 3QEJA 5BN5A 4JLMA 5FPSA 2B92A 1RKBA 5FPHA 3KTAA 1HYQA 2YWEA 5LPNA 1KIMA 1QHGA 2GCOB 4NCJA 5IF9A 1F2TA 2BHRA 4NYIR 2J5XA 1TQ2A 4P0TA 3F3YA 2ZXUA 1RE0A 2G0NA 3SYLA 3TR5A 1NVVR 3P1JA 1SVIA 2QORA 3RNLA 1K8RA 1F2UB 3GLGA 1D9XA 4HAWA 2C5LA 4D25A 3Q72A 3BD9A 1QVAA 3UWOA 4TLAA 3FMFA 2NTYC 4Q00A 4PPQA 1RRCA 3UATA 1CJUC 2IL1A 2WSMA 4Z8YA 2AKAB 4MYHA 5KHOC 3GD7A 3VR2A 2AXNA 3K0AB 4Z51A 3W5JA 1VG0B 4NYJR 3NVAA 1E2GA 4RZUA 4EPWA 2IS2A 5EE1A 4FD2A 3SE0A 3MAAC 4FCWA 1U98A 3O8RA 2P6UA 1GRNA 2Z43A 4GMDA 3X1DA 2A5YB 3ND9A 4HAYA 3L43A 1TADA 4GOKA 3C7KA 4DIEA 2V7QA 3VMFA 1J99A 1YR7A 3HJNA 4TMWA 2J0SA 5D3MB 1OB2A 1U2RA 3QG5A 4LI0A 3GLIA 2FSHA 5H1YA 5JJLA 3LDAA 2W0SA 1Z0KA 5BXQC 1OFUX 2FZ4A 3NIBA 3A4NA 2QE7A 2JLRA 1NY5A 2CNWA 2A78A 2F1HA 2ZS9A 4QBIA 3U7GA 1GM5A 2W6JD 4HLUC 4JL5A 2V8OA 4B43A 3U44B 1KI2A 3LO5A 1GAJA 4XJXA 1KAOA 4TN1A 3LVRE 1EG7A 1NIPA 4CYMA 2QEQA 3MCAA 1DAMA 2F6RA 2VHQA 5KUTA 3A4LA 1H8HA 3C41J 2CE7A 4DDTA 5FPKA 3PEVA 1W47A 1LVGA 3WRYC 3U6KA 1HUQA 3THWA 3MUFA 4PO8A 3U3RA 4LYJA 2DYKA 1D6JA 2ZYTX 4C2UA 3Q5DA 4MA4A 121PA 1E1RA 1FFHA 1T9HA 1W49A 2ZJBA 3ZZ0A 1MKYA 2JJ1D 1KDTA 3PIRA 2E87A 2WBLC 2EFCB 5DLQC 5AUOB 3REGA 4C3ZA 1IQPA 3T1QA 1NLZA 2CK3D 1NN3A 3CX8A 3VR5A 3C15C 2OE2A 4IDPA 5E7MA 2OCPA 3TRFA 3LBIA 4Q1EA 1CRQA 1DAGA 1SVWA 4B3BA 3D31A 1EFUA 5KNDA 2IA5A 4O2LA 4ACBA 2GXAA 4MITA 1BIFA 4A82A 5FBVB 5FTNA 3EWAA 1NBMA 2QP3A 1ZUIA 3GLHB 4PC7A 1AA9A 4AY2A 1R8QA 2BV3A 2C78A 1DPFA 3FMOB 3J81k 1GFIA 1YRBA 1IHUA 2DFNA 4OQMA 1Q57A 4Q4HB 4EJSA 3IIMA 4II7A 4X8LA 5SZHB 2J45A 4TQ9A 4UXJA 1XFAA 4QJ3A 4RD6A 4PQFA 1KAGA 2REXB 4Q66C 1TPZA 2VP4A 1F5NA 3TAHA 1EWRA 2BMDA 3OAAD 1XF9A 2ZUCA 3TUZC 1DG1G 4DB4A 3PJRA 4PAQA 4QGGA 2ZI7A 3CUEF 3OE7D 4F4JA 4JSTA 2J0QA 3TGPA 1AS3A 3HYRA 4PAOA 5JWOA 1M2OB 4W5JA 2JASA 1Q12A 3ADDA 1PLJA 221PA 2OM2A 1LB1B 4NBSA 4Q01A 2ANBA 1CR0A 3D8BA 2YHSA 1SVSA 3B2EA 5TB5A 3ZIAD 5KDOA 1ZNXA 1J70A 4G3XA 1NG1A 3A58B 1DOAA 4G5OA 1W4CA 3I61A 2QM7A 2ZU0C 2RHDA 4L9WA 4QGHA 1P75A 4GOJA 1NKSA 1NIJA 1G7RA 2V7QD 3VR4A 1OYYA 5M04A 3ECCA 4AK9A 3R8FA 2R44A 4I99A 1GUAA 1AKEA 4AWXA 4EAQA 5HPYB 2GEDA 4HZUA 2GWHA 1QF9A 4Q4AB 5DI9A 3B1WA 3UMFA 1TF5A 4MKGA 4OQNA 1SVMA 4F91B 4B3CA 2OLJA 2RB4A 4HI0E 4B32A 3T15A 5DE3A 2GTPA 3A1TA 1U0LA 3OESA 5C2JB 2VH5R 1WDTA 5FL3A 5KSZA 1E9EA 3LW8A 4JVSB 3TSWA 3ZD6A 1FTNA 1RYFA 2HCJB 4GNKA 1GL9B 3U3JA 3ZJYA 3BBPA 4DDUA 2IYTA 3Q7QA 3M4YA 3GEIA 3THYB 5K8IA 4R2IA 4RZ3A 1Z83A 2RAPA 2VA8A 3GQBA 4ZCLA 2RGXA 3WYGA 5EUQB 5FPYA 1R5NA 2H7VA 1G3RA 1GZSA 2FE4A 3FOZA 1YZNA 1JB1A 1A1VA 2A7QA 1US8B 2PJRA 3BWDD 3DM9B 2NZJA 4JLAA 4YDSA 1X1SA 1WRBA 5CM9C 2PT7A 4HATA 2HJGA 4IHQA 2TMKA 2YZ2A 4TSFD 2ZR0A 1DG3A 4IJMA 5JSZA 1XDBA 5F3WB 3GEHA 2YINC 4DEYA 1DEKA 4M9QA 2AXPA 1E2IA 3K1JA 5DGXA 4C0SA 1XEFA 3VR1A 4NPHA 3KTAB 1P3JA 1WA5A 3I73A 4Q02A 4P3YA 5EXXA 4BLSA 4DVGA 1CR1A 3ASZA 1KI1A 4RFSB 4R98A 2A5DA 1ZM2A 2ZM5A 1NSFA 1AZSC 3KQHA 2QUZA 2JDID 4LPKA 4MGZR 5IDVA 3SR0A 1II9A 4BLPA 3AKYA 4WOPA 1QHNA 1GP2A 3TE6A 5CB6A 1I4TD 1SZPA 1OV4A 1W44A 3CRVA 1TX4B 4NCHA 1E9FA 1BO6A 1UKEA 4LJ9A 2OUKA 1W36C 4C30A 1OLOA 2CLSA 1E2NA 4XVRA 1WF3A 2CE2X 4D4KA 2CLDX 2GF0A 1YZUA 2IYRA
chains in the Genus database with same CATH superfamily
1R88A 2ZB7A 1X2BA 1R4AA 2CMGA 4M60A 3TQSA 2AHOA 2QSJA 4WN9A 1RPJA 5HQ3A 1RJEA 1XNHA 2RGAA 5JSUA 3OE5A 4R83A 1VB5A 3RGGA 4Z4FA 3SX2A 3BKWA 3L93A 3CBQA 4ZQFA 3ZVRA 1RWVA 3LUHA 1PZMA 1ZCBA 4M49A 4YGXB 3QHQA 1BWPA 2VJAA 2VK1A 3SQXA 4NDAA 3FHJA 3ZYZA 2D74A 4HX2A 1OXSC 1G4AE 3TUIC 4JBGA 5I8ZA 2GN8A 3PR1A 4BNJA 4OGKA 5JE8A 1JDPA 1YDGA 2J1LA 1EESA 2VCEA 4P34A 1KZ1A 2LUOA 3VOBA 1IOVA 1LQTA 2W8ZA 1T26A 2X6TA 3FR8A 4QYXA 5COQA 3WLAA 5A0VA 2PZAA 1J21A 5ITVA 4PYLA 1Z0DA 4OHYA 2R0QC 4W7SA 3KV1A 5TDHA 1L6IA 2QGZA 3BK7A 4B3MB 3G6WA 1E7RA 4R1PA 1DKRA 1T2VA 5JJKA 2DTDA 5HF6A 2YYZA 1YCHA 2B30A 2ZSAA 3IHTA 4A73A 4B35A 1WXXA 4OM7A 3ZZMA 2H3HA 4IUCS 4ZGWA 3ZJ4A 5DASA 2O8BB 3MBKA 2QHXA 2YOHA 1ORVA 2J9RA 5IS2A 2UXBB 3AB3A 3H8VA 3ZIAA 3QE2A 2JIBA 4GP6A 1IZ7A 1QF7A 4XARA 4XWOA 4CCWA 4EJ2A 3UHOA 4QATA 3V8QA 3K35A 1IZ0A 1NXSA 4O5OA 5JXJA 1E2UA 3DLCA 3HLYA 1KU0A 4DG5A 1A4RA 2OFXA 3N70A 1VCIA 4Q37A 1NJ6A 2XQVA 1IY0A 1YJAA 3O4FA 3O84A 4PLGA 3ZE8A 3ZHTA 1MORA 3R1IA 4KWTA 2FQQA 2VJQA 4MR9A 1CYEA 1IJBA 3H11A 3LPNA 4XAQA 4P4UA 1JKJB 4UM5A 3FTFA 4Y8VA 3RUHA 1E63A 2GAOA 4OJKA 2JLBA 3A4TA 2BEUB 1ZM3A 2HH9A 3OZTA 5AR1A 2JLVA 1TYCA 2PZGA 1L5WA 3DMYA 4TKMA 5LQRA 1NQ5A 2QQ5A 2ZR9A 4A2CA 2QTNA 5KSPA 3DEIA 2FGKA 3DYVA 5BN1A 3NYWA 1VL2A 2PFSA 1TMGE 3D1JA 1WY7A 1R64A 3AYXB 4OHMA 4B2YA 4C5BA 5DYWA 4DR4B 5FWDA 5BW5A 1Y1RA 4D0LB 4CTKA 1AGRA 1Q95A 5KU1A 3DVQX 3ESDA 4PIPA 1JVSA 1JZTA 3W3AA 4NMXB 3VR6D 4EK9A 3Q88A 1JKMA 3IUJA 4GMGA 4QAJA 3WBKA 1Q3TA 1PW5A 2J07A 3PK0A 3UJHA 1L8LA 2C2BA 1M8JA 3L0IB 1V16B 3MM4A 1SM4A 4HJXA 2OK7A 1V6SA 5THXA 5JNTA 4DWWA 3JQAB 1JWLA 2P1DA 1DRVA 1CUUA 3JVUA 5EP1A 2ETXA 1LW6E 4BO1A 2DUJA 3K09A 4A8JA 4I55A 4NFSA 3SM3A 4DJ5X 4KLNA 2GTIA 4TS3A 3NZEA 1DKUA 3FUCA 3O5AA 2AX4A 4IIYA 3TAUA 1O6CA 4RVHA 4A27A 2H18A 1R6BX 3CRZA 4UDXX 5KTOA 1K75A 5CFLA 2BP7B 1PJZA 1KFKB 2VHJA 1Q0QA 4TLLB 4F97A 4MR8A 2EZTA 4MEBA 3G1UA 3ZZUA 1EFVA 3S1AA 4D5EA 4QWWA 3CEHA 2JJQA 2B61A 3H18A 1AQIA 2NSLA 3WQQA 1Y8RB 4E5MA 2R1VA 5HZMA 3LQ2A 4KXMA 4YCCA 1VRVA 4EHKA 3SHFA 2L2QA 1SWWA 4N6GA 5GIOE 1U4SA 3DFFA 4BAGA 2CXUA 3SPXA 3N7AA 3A3NA 1ZDMA 3UJDA 5CGZA 2MYTA 2C2XA 2BRUA 3I1JA 2EBWA 4I9NA 4JC5A 5DVZA 2ACKA 2CF6A 4X84A 1NP3A 2FSGA 3V7FA 4M0FA 1QLHA 5K0ZA 4IJVA 2WLSA 1E3SA 5AT1A 3SK0A 2NM0A 3BGSA 2DUNA 1ACJA 1Y7LA 5DEOA 1M5TA 1FMTA 2O0MA 4Y2XA 3PB3A 3N05A 2AK3A 4EW1A 5H8WA 4RTPA 1RBZA 4OQEA 5JNUA 1W2HA 1QCYA 2R1TA 3C1UA 3F8SA 4R4JA 3EAQA 4R5MA 5ALHA 1M6HA 1R9GA 2WF9A 5JPCA 1DNPA 1GQSA 2ZSEA 1HDCA 1DTEA 4R68A 2A0WA 4WVLA 2QTHA 4EKYA 4JJKA 5JD6A 4ROTA 3TIVA 1R3DA 4P5EA 1IDOA 4IGIA 2OV4A 4S1WA 2GEKA 1WCIA 3AFOA 1VCOA 2B34A 2JAWA 3KXDA 5JPIA 3DJYA 5AW3A 1KEWA 1XTJA 2WP8J 1I33A 2OPBA 3BGIA 1NKVA 3JY6A 3G2LA 4GECA 4P93A 4X20B 3SLGA 3EIHA 1QGOA 2NO7A 4QXPA 1PS9A 4KPYA 1C7QA 3WO1A 3SFVA 1FOEB 1CZRA 5MFZA 5FPQA 1JAZA 1VKNA 3QMWA 1UOQA 5I7EA 4UHKA 1F0YA 2VF4X 3H84A 2Y99A 5B1EA 1H9CA 3WWDA 1LWNA 1XLVA 2GPWA 4YREA 4FR0A 5AJTA 4TN5A 4WASA 3WGKA 2HI0A 5LP6A 5F12A 3ADPA 1EX9A 4F45A 1SVLA 1IUPA 2Q3CA 9ATCA 3NGLA 2V6GA 3QXHA 2OGWA 5F4ZA 1WP4A 4ZYYA 3SYNA 4PRLA 1OZFA 4X1IA 4X8MA 1Q0TA 4ENQA 2X19A 2VF5X 1P80A 5TT0A 2APJA 2NU9B 3QX7A 3ZWAA 1HA3A 5CDTA 5K4HA 2HQRA 1NW5A 1Z39A 1QV6A 4OI1A 2J67A 5ER9A 1HE5A 3CWZA 3I39X 2QRPA 1SCDA 4MWDA 4HUJA 5H9VA 5AVUA 2JGMA 2C1EA 3AUAA 5AVSA 1O9BA 3JVIA 4D79A 2NUPB 5FJIA 3ZGNA 3DR5A 1GKLA 5D1HA 2O7NA 3I4CA 2Q28A 2PGXA 4CLRA 3DMDA 4JP5A 2VF7A 1DXHA 3B6KA 1USGA 4L50A 2BONA 2V7BA 3WKAA 4EX6A 3T1OA 2PBZA 2YX1A 1RLVA 1CRLA 1X7DA 1JHOA 1G41A 1TEHA 2CNBA 1GQOA 3H2JA 2I4IA 5CFMA 3K0KA 2W6IA 3DV0A 3E15A 2H16A 1VJTA 4KHZA 4U2EA 3VTKA 4A1OA 1AZLA 2JFXA 2ZI3A 3QVWA 3T5CA 5ITZA 5JQGB 2Q0HA 4TWRA 7GPBA 4KFRA 4MIKA 1WQ3A 3AF4A 3IQEA 3E27A 1WXGA 3DDZX 3BGDA 2PBRA 4LC0A 1AS0A 3HU2A 4Y7DA 2PUEA 3I8XA 4OQ4A 3MQ2A 2MYPA 2WMOB 3UV7A 1G55A 3T38A 4K1XA 3HYLA 3K5IA 1BMDA 2FWIA 4YXFA 4H60A 4UNNA 3A4YA 1G2IA 2VDVE 1M3SA 2FRVA 4WCFC 2QNIA 3FCCA 4Q3AA 3DEYX 2X6RA 2ZJ8A 3OPYA 4C3VA 2P9HA 4IHJB 3DL2A 4K9RA 1M2KA 2GNPA 3MSCA 2O0KA 1EPUA 4IF6A 4DLAA 5LJIA 3IMGA 3IAS1 5LZ8A 4XIYA 1YZYA 2FUEA 5HUJA 2PA3A 1G5PA 3GVIA 5JALA 1PWEA 2A92A 1P6QA 4ZC8A 1ISMA 2FEAA 3V1NA 4FCVA 4HP8A 1XCGB 4V39A 1Y8ZA 1Z6PA 2JD2A 3UJ9A 2O59A 3NQ41 3CVOA 1QF6A 4LDAA 3AT1A 1SUSA 5AWFC 1YQGA 2FF7A 3R3SA 2ZT5A 5KMGB 4BLVA 1K6XA 1P9WA 2GN9A 2JJMA 2CXNA 3WWYA 2XCIA 2DR0A 4XIIA 4X63A 3TZQA 4FB5A 2R6GA 1UMDA 3D02A 5JARA 3I2FA 4R9UC 2OL4A 2P3LA 5J63A 4WFKA 1VXRA 2XKBA 3HWSA 2IUSA 4TQAA 5BQOA 3W6NA 2DJIA 1GEEA 1Q7BA 2DU8A 5BNFA 3SXPA 3UT0A 4WXPA 4V0LA 1W59A 3T3MB 5CT9A 3UXHA 2CVZA 3B12A 3RSHA 4MB0A 1J23A 1E4YA 2XXAA 4LNHA 3O6VA 2XA9A 1CCWA 3PEUA 4TVOA 2H7CA 5JXHA 4D4GA 1X8KA 1QDLB 5DHSA 3QXGA 4XWWA 3EZ2A 4QEKA 4DUGA 1I10A 2Q4BA 4KQXA 1JJ7A 4X6XA 4RDHA 3D6JA 3PHBE 4B4OA 1RRVA 1E8MA 3MAGA 5HZGA 1E64A 1H2HA 5HQTA 4A8JB 4D9FA 4YV2A 1X8LA 2E89A 2DBYA 2FX3A 2OBMA 4HRXA 4HH1A 5LQJA 1LV8A 1U8EA 3FUUA 3JASB 2OESA 2YYAA 4XX1A 1UBGA 2F00A 1AF4A 1TNDA 1W0KD 2C0PA 2YWCA 4HVTA 1C1XB 1EBBA 4O0LA 4W1QA 5DM4A 3QENA 1E1MA 1ZA2A 1W94A 4IM7A 1SUDA 3JRXA 3T7SA 3NNSA 4EGAA 4YRPA 4M2LA 1X1TA 2B5VA 1M34A 2UVPB 2EP8A 3E23A 1VHLA 4GLFA 4IRXA 1UM9B 4WK4B 1RKQA 4RGBA 1A82A 4EPTA 3DLAA 1M1YA 3ISJA 1JPVA 3GQBB 3G1WA 4OH7A 4X85A 3RBVA 3A6LA 4TKUB 1NYQA 4GOMD 4MRMB 3U1VA 2GNOA 1Z7GA 4NSNA 3WFIA 1ZH8A 1JTEA 5L40A 1H2EA 1IWPB 1J8QA 2HQOA 5BQPA 3ZCUA 4FMDB 4OAPA 3T8YA 1RAEA 1Y6RA 1Z68A 2Q7XA 1IJEA 3NALA 3R3WA 1AUOA 5IKEA 5K0CA 3N8KA 1J00A 2XEDA 1F3LA 1W96A 1X1RA 4I4LA 3SZRA 1XDGA 2D8MA 2QAGA 1X7HA 2EP7A 1DXQA 3DZHA 4PE5B 5ECYA 2VAVA 4BQEA 1SB9A 2RGGA 3UMGA 2RI6A 5AM1A 4HX9A 3V5NA 3JR3A 2AN1A 4YRTA 4BZPA 2XMRA 3GT3A 3EFOA 3DOJA 5K3SA 2CD9A 2FSFA 3FAKA 4FI3C 3TCKA 5G0TA 4XGNA 3DAHA 2ZUDA 4KDCA 1EBFA 4LOLA 2QNRA 5E9AA 2GT1A 3JQ6A 1Q0PA 1KH3A 1K8QA 5JCXA 3DW1X 4X20A 2DBVO 4B34A 3IR7A 4ZAVA 2NUTA 4NBWA 4BNYA 2PN1A 2POCA 4IR7A 4PZ9A 5A71A 1YS9A 1GZ3A 2AG6A 5CM2Z 4PYNA 3H2IA 3ZI4A 1RMYA 1OXUA 2HA2A 4DT1B 3M9XA 4QU5A 2YWDA 2ZKIA 2YDXA 5FAKA 4P84A 3B7GA 3UAVA 5LP6B 5IJ0A 2AXQA 5B7QA 3HDVA 6CHYA 1IPEA 3KAQA 4QM6A 1Q92A 3A6DA 5ALZA 2XY4A 2ZS8A 3HBAA 3LV8A 3TTVA 5JLAA 3F2IA 3QJ5A 2O8CB 5C5IA 1D07A 1NLMA 3CPSA 4WE3A 2RCNA 2BEJA 4FLFA 2YBEA 3EA0A 3T41A 3T7DA 4DCVA 1X7XA 4R51A 2RH9B 2O06A 3BJIC 3LX8A 3PENA 1E0SA 1EK6A 1Z4OA 1L5HA 3DLHA 5H81A 1NF2A 4YJDA 4K2AA 1KP3A 2JFVA 4HMQA 1GPNA 5KVAA 5JYEA 3GWGA 5B1HA 2HSDA 1M2VB 2R4QA 3LZDA 4CIVA 4PYKA 3WLQA 1OT3A 3EFEA 1XRMA 2WSSD 2Z4RA 1XLTC 4LFCB 1NV9A 3IKMB 1WTCA 2PMKA 4HWTA 1AHHA 3C3CA 4NABA 4YCBA 2YL2A 1DIAA 2FEPA 5FHQA 4JB3A 1TO2E 2GJ4A 4PPYA 4TMTA 3OTIA 3PWZA 4JR2A 4N47A 3CUKA 4G0WA 2ZGVA 3ZHCA 3NGXA 1PZFA 2YZNA 4Q3OA 2ZPAA 1YOVB 1A1SA 2GA8A 3AJRA 2QUHA 3KT6A 2RHHA 2YWXA 5HXAA 3C6QA 3AP1A 3OU2A 2AK2A 4UD6A 2M6LA 3ZW7A 3PFIA 4AKIA 3FFAA 4E15A 1FFDA 1C7EA 3FCSB 3DTNA 4M21A 2QLLA 3FNGA 4MNTA 4PTZA 4PYRA 3KSZO 1M6VB 3GJTA 5EHNA 2ONJA 1ZXXA 1FJXA 3LX5A 1O4VA 3DYBA 4WDRA 1RQNA 2JLQA 3V4LA 1R0VA 1VGVA 1MX9A 2UZ1A 2BAGA 4TT3A 1OBFO 2CHQA 1EFLA 1LRJA 4JI1B 1XK6A 4AJNA 2WVJA 2LE0A 1KL7A 2GBPA 4L4UA 4NMLA 1E3QA 4MICA 3UWSA 2TMYA 3GLFA 5L51A 2IXEA 2XUJA 4GLBA 3UBTA 1Z0UA 4LISA 4HRAA 2I6UA 3BQNB 3MFYA 2AWNA 4MDEA 2VUTA 3QM1A 4D4IA 2EP5A 1QYWA 1SOUA 2DHDA 4FZJA 2CDBA 3ZJUA 1E9RA 3RAJA 1V5WA 2ISSD 5DHUA 3WMXA 1USUA 1P7WA 2E4ZA 4R6WA 4GU5A 1QHXA 4P31A 4YQFA 2C4TA 1WSWA 4OSOA 2D7CA 3RTAA 1YS4A 3E5RA 3WK9A 1C0KA 4KAAA 1ODSA 4TV9B 1IXRC 3DE3X 1P9RA 1GT6A 4FFPA 5C8DA 3G5TA 1FDUA 2QM0A 4HFJA 4CKWA 1FS4A 1GV0A 2O7VA 2VHCA 2VF8A 4UDYX 3E2PA 3MJEA 1WZ2A 5EJ4A 3T3DA 1JR3A 1O6GA 3JWHA 3TFWA 2IEIA 2JGDA 1W93A 2NV6A 3DBRA 2PYDA 3NI2A 1IVYA 1SBTA 5HSGA 4HDAA 3QX3A 3INRA 4HS4A 3RANA 4RIHA 1TZ2A 4IIFA 2Y9MB 1OAKA 4L22A 2XRYA 1ILEA 2PFKA 1U0BB 4IINA 4B74A 3OLZA 1MB9A 3SOZA 4JBYA 1QNLA 1ZIYA 3O93A 3W06A 2YN2A 3B51X 4G56A 2IY7A 4PX3A 5EJFA 4NTZA 1CEYA 2QYOA 3JZFA 1ZUNA 4GOLD 1IN4A 2X0JA 3C3EA 3CLHA 3K7EA 1I80A 3H1PA 2ISQA 1WEKA 4Y0AA 3ORSA 2BTOA 3OTWA 2X2PA 2QY6A 2GVDC 4Q4HA 5GJWC 2QBYA 1UBOS 3QMMA 4G9BA 5BV8A 4XQ0A 4JKOA 5BYKA 1F6WA 3EIQA 3C97A 4ARAA 4MQFB 3AY3A 3K70B 1X9IA 2WQZA 2WZQA 2HHHB 4FLEA 5A0FA 1HQYE 2ZTLA 3DKKA 4D46A 4FN5A 1AK1A 2R62A 2W2OA 3P71T 3T5TA 3GIWA 4HG2A 3DOCA 3ONEA 4H9GA 5ALKA 2XUQA 5K8TA 1I2MA 1ODIA 2XADA 3KJQA 3NBAA 4U00A 4YO8A 4TWZA 3ZQ4A 1RW4A 2IOFK 1ZH0A 1PZGA 2WA2A 3L3BA 3VBEA 4BLUA 1P62B 4ZKEA 3WXMA 5KVSA 3ERCA 1E1NA 1NW4A 1ILWA 4CUJA 3RUCA 3QUBA 1NKTA 3I6QA 5FOSA 1NULA 3ZE7A 3VPBA 2M6SA 4MPRA 4I3HA 5KWJA 1TCCA 4MP3A 1O94D 2Q3JA 3B1JA 3B3QA 1EWKA 1G98A 4IWXA 1U3WA 2RGEA 4QTUB 5KYVA 1OF1A 1VG1A 2DSNA 2Y9PB 3TSOA 1I2BA 2YN0A 4Q3LA 3OT5A 4JX9A 3FOCA 2X1VA 2YMLA 3EC7A 2WWFA 3I9V6 2W2PA 3FPCA 2KQUA 4M46A 3K94A 3M1YA 1J1IA 4HKTA 4J0EA 2XUIA 2F1OA 1FMCA 3U40A 4HZUB 2I03A 3S29A 3K70C 4A7PA 1OTYA 1VP9A 3SBDA 2CXQA 4KQHA 1PK8A 3U7FB 2P0YA 3D3NA 1OGYA 3V1UA 2YOGA 1W5BA 2LW7A 4CIYA 1QAQA 5D5QA 5FOXA 3JQFA 3WNCA 5C8XA 3F96A 1V0JA 1BXKA 3HN2A 1FS6A 5CBPB 3AR9A 3M6MD 1XDWA 3LGXA 1ZLYA 2QTVB 3AVYA 3WL8A 3RFXA 1FXSA 1ULBA 4BFWA 2ZRCA 5EWJB 5P21A 4KUHA 4XVUA 5LQAA 4QUEA 5H68A 2AZDA 4PCUA 5FUWA 4B0PA 3CWQA 3T0GA 2P9CA 2V03A 4REMA 1MJGA 3AVVA 3G82C 2I2CA 2XUZA 4D0GA 1MQSA 5CXUA 4GPEA 4C2TA 1UT8A 1XFDA 3VUFA 2JGNA 2BR4A 1LQ2A 3VR3D 3T94A 1PNRA 5TARA 1NP6A 2JIPA 1K9VF 2EARA 3CUSA 5EA2A 3RJ9A 5IABA 5AKIA 2ENUA 3F6CA 5A7HA 5KEIA 3VO9A 4A6XA 2Q1UA 1VE9A 1VECA 2V54A 4CR7A 1QRTA 1VJRA 3ZX4A 2W48A 3UPTA 1VSBA 2B4TO 4MROA 3L1KA 4ESEA 2VDUE 4UBOA 4M86A 1JA0A 1UIMA 1X7WB 3WRYA 1XE3A 4EJ0A 4F71A 4YV7A 5BSEA 4R1LA 1OLXA 3WQBA 1UJBA 3LCJA 5GJCA 1UZMA 3EZ9A 1KTVA 1Z5WA 2AX3A 3HDQA 4V0KA 4KAXA 3UJNA 1TK3A 4KOEC 3Q9NA 3ISTA 3NBQA 3PNLA 4OLBA 2Q3BA 3V2GA 4BPRA 2IZZA 4OB8A 4UMDA 4Z9AA 2HT1A 1W2GA 4YJKA 1NBAA 4W5WA 5DN9A 1XHFA 1EUDB 2H7YA 2W0MA 3MZ0A 3T9BA 5JCPA 2GFQA 3CCFA 1BQ3A 1WOYA 2YCBA 1II0A 2IEBA 1AX9A 5DGHA 5F1OA 1ZN2A 2X1LA 5HGJA 4D1YA 3VR5H 1IBLB 5EQJB 4E51A 4ZANA 5I5EA 4KMRA 5AI6A 4JC4A 2P4QA 2PZJA 2Z5GA 4KI0A 1MHTA 4JEIA 4FW8A 1E0KA 3LKBA 1Z3IX 1ZO8A 2BHLA 3TQRA 5TIIA 5BSHA 2O3SA 2OXEA 1QFSA 2C2YA 4FOSA 2ZWAA 4D80A 3KQNA 3KXPA 1PEKE 1XPRA 3H3XA 1E7WA 1RWPA 3GJQA 1G8MA 3FCXA 1X38A 3IILA 4HCJA 3U7JA 3WX0A 1A7JA 5AVOA 2AUNA 2VQ3A 1C2YA 4DHWA 4G0NA 4XR4A 3U39A 3SDBA 3VC7A 4BBJA 1CS4C 1J24A 2HJVA 3PXUA 4HLCA 4RMNA 3DA8A 3UFBA 3NWPA 2ZM6B 4QD3A 2JHCA 1CQWA 2VPYA 4JAVC 4QYIA 1U8XX 3Q10A 4PR3A 4ZVKA 2C94A 1FNMA 1IM5A 1SXJA 4PNHA 2EW8A 1DC4A 5H3HA 3S5UA 2I5PO 4KNYA 3JTMA 1V1JA 1U8CB 3K2BA 4PF1A 1ONOA 4YB8A 4F5WA 3DAPA 2H4HA 5E1MA 3CLTC 4HAZA 1JE0A 1UZUA 3JAWB 2C59A 3E7FA 1TGVA 3P32A 4I4TF 4RENA 1PJ8A 1VRCA 3NEJA 3WLPA 3GUCA 3ZOKA 3SZLA 4LK3A 3V3KA 1W4RA 1H2ZA 4KACA 1LLCA 2R86A 3LWNA 1M72A 2XQJA 2P5UA 3KQVA 1FPMA 5KQRA 2PZKA 3S6JA 4ZICA 3AIIA 5LLDA 4MS1B 5FOUA 2IXTA 1U5BA 2H6EA 2O8EB 2JCBA 1KIAA 2J3IA 2WKQA 2WV7A 2C0QA 2ZSIA 1RD4A 3AF3A 2OBXA 3COVA 4JVOA 1S96A 4PX9A 5IW8A 5TQ2B 2OECA 3SQLA 1JMVA 4DA0A 2GZAA 5HMMA 5BNIA 1DARA 3KYDA 3IVXA 4UZFA 3FHLA 4CODB 2VS1A 3SJ7A 1ZUWA 3A7EA 2J48A 3QKIA 2I67A 5FL7A 4EPRA 3EXHA 1ZJWA 1LS1A 5MN6A 1V43A 5KTTA 2HXSA 4DXAA 1QORA 1SC1A 5A6SA 3CT6A 2ICAA 3E0XA 1HPLA 3A31A 2H0QA 3IXQA 4AWAA 1BN6A 1F06A 4KB5A 2PKRA 5T8KC 2NUAB 4F2PA 3DUWA 1HF3A 1QH8A 2AT1A 2IOYA 4G9EA 5IAJA 4HUTA 1NI4B 1USWA 1Q22A 1SUCA 2QYSA 2O8NA 3O3MB 1XKQA 3FKJA 2OBYA 1FDSA 4TTRA 4D02A 2PEYA 2XTMA 3IB6A 5HDBB 3KV3O 1BAPA 4MCIA 5DULA 2VK4A 3AI2A 1CP2A 2ZVDA 2FZKA 1KJWA 1FS5A 2BFPA 3O73A 1TC1A 4C76A 2O8FB 1ZQ9A 2WAXA 4U7HA 1D5WA 2J9FA 2QGFA 3L0DA 2E18A 4HGNA 1OFGA 2C96A 4BC0A 2RK4A 4DLSA 2WTMA 3EDYA 1EX7A 2I99A 1N2SA 1TF7A 4UM9D 4UHDA 3PYLA 4TTQA 1X77A 1KZHA 5EYPA 2GLUA 2Q7OE 3BHJA 5F3DA 5JMTA 1O3YA 1J90A 4KSBA 4YRIA 4YMHA 4U2GA 4D74A 3H4VA 3O2JA 4HAVA 4K9QA 4LIPD 5LQSA 3WIEA 4AS1A 2AS0A 2AW5A 1B0AA 2P2NA 2CLLB 4RK7A 3DZDA 4Q7QA 1YVEI 4YCJA 4BO6A 1ZNWA 3B6IA 1M8PA 4HLUA 4G26A 3DLPX 2GJKA 1ISSA 1CHDA 1N5JA 3Q3HA 4GWKA 3NANA 4IEEA 5I5GA 2X9VA 5BVGA 1IXZA 1MEJA 4OHKA 1ENPA 3H9QA 1J8VA 4PFJA 3HYTA 5H02A 1IBCA 2Q4DA 1W6RA 1Z08A 4LJKA 4UE2A 4G67A 4OG2A 6ABPA 3DE4X 3A6GA 1KRWA 4U7JA 3TF5A 4KRYA 1NOIA 3H86A 3MELA 1JBKA 4HN9A 4M1ZA 2H06A 2QUKA 2X3FA 4N3CA 1YJ8A 1YL7A 3AF5A 4BQRA 2C95A 2ZIXA 3ETCA 1RSZA 3LCUA 4EG1A 3LC7O 3DEFA 1U0JA 1AKRA 3ONVA 4M4SA 4LGYA 5AK6A 3TM5A 4JEMA 4Z2YA 1TTTA 3C48A 4YUVA 4QRIA 1UKYA 1JLLA 3K8ZA 4FEAA 3G0BA 3F7NA 3PUJA 4X1OA 2A9VA 3BMNA 4RD2A 3DHNA 1K68A 4O08A 3R7AA 3E35A 5LYYA 1N8SA 5AIAA 3VNSA 5E3JA 3MGKA 4PEVA 5AXBA 3M6UA 4Y2RA 1HTBA 1VSQA 2FN7A 3W5SA 2G40A 3JVDA 1MIHA 4P3KA 7MDHA 3HB4X 1KI6A 2XNHA 1QV9A 1X80A 2WSBA 3AY0A 5JO9A 1V7QA 5IJ0B 4O25A 1NNEA 4Z9BA 2Y0PA 3MEQA 5CBPA 2EWVA 3DMHA 4Y6SA 4E7PA 2J6BA 4ZOAA 3G85A 4XLLA 4F93B 1G8AA 4CF7A 3UAYA 2JIZD 3PC8A 1ODFA 4C6TB 1TKCA 4C0QC 4L0QA 3DZJA 5BR1A 3VH3A 2CFRA 4C0KA 4D9HA 3E0QA 4BNDB 3R0XA 1WHTB 2B98A 2FWMX 1UEXC 2HF7A 3E53A 3ER6A 3Q8LA 2C04A 3IAFA 3X0DA 3TIFA 1FP1D 2HPVA 2XWJI 1E99A 1RJ9B 1R8YA 5LKRA 8LDHA 1GQRA 4ECEA 1XEWX 1FFSA 1T10A 1K7CA 1JSXA 1PYGA 4F0JA 1HQKA 1P0CA 4RQTA 1MW8X 1OFTA 1BMTA 1K6MA 1BWQA 4G0PA 1WXDA 4L8FA 4LNAA 2FMFA 1RTKA 4YAOA 1EFCA 4NAUA 4O5AA 1ZW1A 1ECFA 4LWPA 4M0CA 5DH9A 1L5NA 2BHSA 4WAUA 4C89A 2IEYA 3SFTA 3WYDA 2F8TA 1V9SA 3O8OA 4I9HA 4CDRA 3N1UA 1RYMA 4IV8A 3KEGA 1GPH1 3WS7A 3OE7A 4X44A 1UFOA 5I7AA 4BP3A 1FFGA 3ANNA 3CRRA 3KVYA 1KZGB 3L01A 4BQSA 1H9BA 3CF0A 3LGSA 4Y1RB 5FI3A 5IHXA 4RH1A 4QNRA 1U7HA 1VHQA 1VFPA 3TQHA 1E3JA 1U0RA 4CM6A 5T3YA 3C3BA 4GPTA 1GVNB 2P9ZA 2QRKA 3NDPA 2O3UA 4ENWA 5DEIA 1S2IA 2KHZA 1NI5A 3QOWA 2P2SA 4OREX 4ZDJA 1A71A 3PTZA 4ZJPA 1KJQA 4P5DA 5GONA 4GIBA 2FPKA 2G77B 2OCYC 5A02A 5DWDA 4XB2A 2VPTA 5I7WA 4NNPA 1GTJ1 3CEPB 4BZXA 4CMIB 4PG7A 1J97A 1RXYA 2IGTA 2VH2A 2ST1A 4DEXA 5IF3A 2IDKA 3ZLBA 5J4HA 3HR4A 1J25A 5SY6A 3BBLA 4CL0A 2WB4A 3EVZA 4HQ0A 1JE1A 2C20A 5JEEA 5ALFA 1IXSB 3NC1C 4LG1A 1Q84A 2NVOA 5AOBA 3B38A 4YI3A 4QEZA 1OFUA 5BVHB 1M67A 4OTZA 4ZAWA 3PEEA 1U8FO 2JGIA 4POOA 3BDVA 1AXEA 4HLDA 1TO6A 3SP1A 1T5TA 4O2AA 3R9WA 1JUDA 1ULSA 4E5KA 2J4DA 4FCTA 4KO1S 3I6IA 1ETUA 3NWBA 1V35A 3C8UA 1PV4A 4RVDA 3P20A 1GGKA 2EEZA 2QQFA 4H7JA 4LHZA 4URZR 3ZDXB 4DAEA 5CDFE 5KBYA 5L4NA 2HF2A 5KIAA 1NVFA 4V0MA 5FCDA 3V4OA 1QO0A 3VU3A 3K0FA 3CF2A 3K1ZA 2A5LA 4JUBA 2RJOA 4MV7A 4Q1CA 2IIQA 4X1YB 1ZUNB 2P67A 5BOSB 2IU0A 1NPTO 4QLAA 2WYUA 2G4LA 1H5QA 1QOPB 1QDEA 3JQ9C 2P4UA 3C98A 2Q6VA 2CBXA 4M1QA 4N3NA 3GHHA 1VSUA 3UT5A 2WHYA 1XJCA 5D3QA 1RI4A 4PSUA 3ZLJA 4TV9F 5FI5A 4LFBB 1THMA 3T06B 1V8DA 1KP9A 4EHHA 4IHJF 1D1QA 1SB8A 3ZLVA 2ZB8A 1Y6FA 3ZWOA 2C1XA 1I4WA 1DV2A 1WZNA 2GNAA 2Y1WA 3E9YA 3FLEA 3OZRA 4B7CA 1LEHA 5F1KA 1UMKA 2G5TA 1ZRMA 2H07A 3FKSD 3L49A 4YO7A 1GR0A 3UOAB 4BWVA 2B9VA 5BMVA 3C3PA 2QZPA 2W6PA 4P7BA 2ECPA 3HSSA 5HTKA 1JEQA 2YXDA 1TTHA 3AIMA 4Z4GA 4BMDA 4MOWA 5BSRA 4NECA 4MJLA 1N7GA 3M4NA 1TM1E 2WM8A 3I09A 1NRJB 3JQBA 2QSYA 1TMKA 1ECGA 1GU7A 3ICPA 1GUDA 4KQMA 5C7IO 5CB4F 5BSWA 3CPHA 2FPRA 1V3QE 3LMKA 2I4OA 3ETHA 4I5IA 3ZZTA 4CF4A 5B58C 5IUNC 1XZHA 1TEVA 5ADHA 5CFPA 3G0HA 4NESA 4D8UA 1ZISA 5CVEA 3OZUA 5B1DA 3K9BA 2P8SA 1XROA 2ZROA 4YIKA 1EJBA 1XCMA 3NIWA 4GI2A 4K3UA 4CEHB 2YQZA 3A6KA 2BEVB 3O0DA 1EP9A 3DE6X 2Y3IA 1B16A 1Z45A 1HE1C 2YXBA 4TS9A 1SIBE 1XZLA 3TNFA 4CIDA 2P78A 2Y6VA 2RIRA 1U3UA 4I6GA 1DWOA 5CHEA 5LCXA 3RC9A 1E79A 5LM3A 2SECE 3LLUA 2WK1A 4ARSA 4H7PA 1KKLA 4CMAA 2FX5A 2JH9A 2N3ZA 2GARA 2WE7A 2VT3A 2OUIA 1MXFA 1VA5A 1YB5A 1SZDA 2X5NA 4FE7A 4BRWA 4ZEMA 1TZMA 4TMYA 4B73A 2AC7A 2CL6X 3I5XA 1DUSA 1SZJG 1XNGA 4JLUA 4D9JA 2BGWA 3SI7A 1XBTA 3PVZA 3C6YA 3ZUPA 1NBHA 1G20E 4FKMA 1MX1A 2BFNA 4D3SA 1T4DA 3SDSA 2GD2A 3KXLA 1GPLA 5M29A 1ZZEA 1QS0B 1XRQA 4HK4A 4ZO8A 4QXMA 2BEKA 4XW2A 2GD0A 4KPUB 4J49A 2QN9A 3HKCB 4KWHA 3QFSA 4X7PA 5JVDA 1U2EA 3ZOZA 5JBNA 3W3AH 4RQBA 5CGQB 4XTRA 3I72A 4IDDA 1KYQA 4WCFB 4K6MA 1R11A 4L08A 1IPFA 1SIWA 1A9XB 1P2BA 1SU8A 1JG4A 3DOIA 5HILA 2NV2B 5DRTA 5JFTA 1AKYA 1HE4A 1MAUA 3FLMA 4CKBA 2XJ4A 2P1ZA 4R8RA 4FE4A 4I8DA 5EOVA 3UUWA 1IG3A 3HEAA 1EE9A 2E37A 4GE3A 4OK5A 3JQ8B 3WBBA 5EP4A 4Z99A 1W9HA 4WW0A 4FGJA 1OAOC 3LPDA 5EMKA 5EZYB 3WL3A 5CA0B 1BRTA 4HT3B 1CF9A 2H63A 3IIIA 5BR4A 1TQ8A 3IQXA 1PTJC 3MC1A 3QTBA 3M33A 3HGQA 4IOJA 3EZNA 4NPAA 4RGYA 1SUAA 5LZ5A 4CWAA 4LXUA 1EFDN 1L4BA 5CCEA 2Z2IA 4FYVA 2P91A 2HA7A 1I2CA 1T8SA 2AKYA 2P2GA 1H0KA 2XCLA 2RKOA 2HLHA 1U99A 2IPLA 1G6OA 2R6HA 3D9QX 1KGDA 4FYJA 4I4CA 5F52A 1XI2A 1X1EA 2WOOA 2A35A 3WI7A 3IIJA 4TYNA 3L7BA 2E5WA 2D8AA 1M0TA 2ZRLA 4XCVA 3EGWA 4PQRA 3CX6A 3BRWA 3R3ZA 3L46A 1F14A 2QTLA 4ER3A 3FTEA 3B8HA 2EFYA 1U9JA 2ZI5A 1T5DX 1D1TA 3OOYA 2MSCB 2X4IA 3EW9A 5JPDA 2BDTA 5CK4A 3LC0A 4HEA1 1GARA 3FDIA 2A58A 3RJZA 3NRCA 5JADA 2JFWA 1OYVA 2LDXA 3MLEA 3MQ4A 4D96A 1QPZA 2O4CA 2X7XA 3NO4A 3AP2A 3WNVA 4WECA 2F59A 3V4SA 1JR6A 1QHIA 3FBTA 5HZHA 3B6MA 3NW9A 1UJ2A 2VP2A 1ZNYA 3PQFA 4O4LA 1EVJA 3GFRA 5ALRA 3EA5A 3WGNA 1NFQA 3OURA 4HADA 2RKBA 4RTQA 3IV7A 4XIJA 2YMMA 3DJFA 2DCMA 1R5OA 1QVRA 4NCIA 1LI5A 3IYLW 4AG6A 4IICA 1QG4A 2V5UA 2FEXA 5I3CA 1RHUA 1OZHA 2XV1A 3H2SA 2NTVA 2P40A 1EUCA 3AVPA 1HI9A 1X6VA 3MBIA 3PZBA 3TRHA 2YFKA 1Y9ZA 2ZREA 2MR6A 1MVLA 4HWSA 4V0OA 5IPFA 4DV7B 4M1WA 5JNWA 3CX4A 3HWRA 2OD9A 1O97C 2H5LA 4V0RA 2FMKA 1R0CA 4MUYA 1A2KC 2HA6A 4Q1DA 4QOHA 4D3ZA 1BXZA 1YOVA 4I2VA 2H1IA 2WWGA 5KYWB 5LOVB 5MN5A 4ZEOA 4IIXA 4C87A 5F73A 3L7NA 2WIGA 1MTOA 3D1LA 1K2WA 4ODIA 1FUYB 1TIKA 5DGCA 1H1LA 4WOBA 4A2PA 5ICMA 4JGBA 3Q7IA 4FT2A 2EFJA 4P33A 2QX8A 1R50A 2UVQA 4AKGA 5JS1A 3KDPA 2GPSA 2VNSA 1AO0A 2PO7A 3N2NA 3QF4B 3SIWA 3X1ZA 1Y1LA 3HDTA 4EFNA 1IY9A 3ZD9A 4NE2A 5ADWA 4FOOA 4GL2A 4H1TA 3NS7A 4KXVA 4MHSA 1DEHA 1PUXA 1QO7A 2Q9AA 1ZC3A 2ZYHA 5EJEA 4DUYB 1PT7A 2HK7A 5TJHA 1OOEA 2C4WA 3RU3A 2BKEA 4M83A 1EVEA 1OIWA 3H6GA 2J87A 2WVHA 4J6FA 4HFRA 2FMHA 4CR6A 3TKYA 1IEWA 2F9MA 4F7DA 3D8UA 4JJ4A 2BWJA 4YJFB 3OZBA 1MXHA 3NHAA 3D