2GEFA

Crystal structure of a novel viral protease with a serine/lysine catalytic dyad mechanism
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
211
structure length
198
Chain Sequence
DLPISLLQTLAYKQPLGRNSRIVHFTDGALFPVVAFGDNHSTSELYIAVRGDHRDLMSPDVRDSYALTGDDHKVWGATHKFNVKTRTDLTILPVADVFWRADGSADVDVVWNDMPAVAGQSSSIALALASSLPFVPKAAYTGCLSGTNVQPVQFGNLKARAAHKIGLPLVGMTQDGGEDTRICTLDDAADHAFDSMES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protease VP4
publication title Crystal structure of a novel viral protease with a serine/lysine catalytic dyad mechanism
pubmed doi rcsb
source organism Blotched snakehead virus
molecule tags Hydrolase
total genus 53
structure length 198
sequence length 211
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2006-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.30 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2gefA01
3.40.50.11300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gefA02
2GEFA
chains in the Genus database with same CATH superfamily
1IE3A 1ZP6A 2WJHA 3ZVLA 1TA9A 3NBXX 2BM1A 4U7HA 3ZV5A 4XQ9A 3FTQA 3R69A 3JATA 1QCCA 3GJSA 4LVCA 2KBEA 2FW6A 3GJ7A 4TSFA 4I6GA 5E4JA 5AOBA 2KL1A 1T2CA 1KOLA 1E0JA 3WDMA 4FBGA 4TYNA 1GLVA 4MUNA 4YREA 2X3UA 3K32A 1B0PA 4BLQA 3ADBA 2BZ1A 3V4VB 2XGSA 4QO8A 4DLBA 1IU9A 3QPAA 2CFIA 3A9VA 1AZSC 1H3FA 4KH1A 4BTVA 2Q0HA 2FZVA 2J3IA 1NJ2A 4LHYA 2PD6A 2XX3A 5KKAA 5BWLA 2R00A 2H7VA 1IQ0A 2MHCA 1XDSA 4I3GA 4TV8A 4F5DA 3QYJA 4HNSA 3L0BA 2CCJA 2WL7A 3CKMA 1JJFA 3HB7A 4ER6A 4XD7A 2Q9VA 4KAJA 4YI5A 1RYHA 4AP6A 1AKEA 1BA3A 1L8LA 1TJ4A 4OHVA 4WPGA 4LGCA 4CLOB 1PFYA 2G4VA 2VKTA 4E6EA 1I3OA 4UNPA 5BN5A 1B43A 4FP9A 3UK2A 3ND7A 4G0QA 5INTA 4CUKA 4ALKA 1ESDA 1U0GA 1YJQA 3GGSA 4NYIQ 3SDZA 1FP6A 1SIWA 4HQOA 3SMQA 3LYLA 1V8ZA 4F2HA 1Q1NA 4OGFA 4PCLA 2JI7A 3GEBA 3KUUA 1VE3A 3NBAA 3C6YA 3ONWA 2UUBB 2DQYA 3FVWA 2K20A 4NDNE 2E89A 4CDRA 4PNZA 5IJXA 3USZA 1D1QA 3P7MA 3K1ZA 2IXDA 2FCAA 2OHIA 2VDRB 3FFWA 2X6TA 1NVWQ 1JAIA 1P0MA 2OGSA 4ARVA 3PUWA 3PZBA 1ULAA 5C7OO 2J0QA 4UXJA 1XA0A 4TWZA 3N2IA 4Y3UA 2XUPA 3MHPA 3GAZA 3GT4A 3ZU4A 2J0EA 2H7CA 5DVZA 5KYYA 3DWFA 2XXAA 2O48X 3G7SA 3AHHA 4GMDA 1QYVA 4MWEA 2JCXA 3P9PA 5BW6B 3AM1A 1FQKA 3LNXA 2FSVA 4YPOA 1KO1A 3IUMA 3VV3A 4G4SP 1C2TA 4Q3LA 1OLOA 4JA2A 3EXIB 2W2LD 4KAFA 4OGKA 4GZ6A 4IIHA 5T41A 3R74A 2G5TA 3COPA 3CZCA 2WJIA 3Q3IA 5K45A 1LBIA 2XB2A 4OB6A 3DGFC 1C7IA 1SN7A 4FYMA 2OD7A 1YT5A 2V97A 1SCNE 1V6SA 4PZAA 2ATIA 4L9WA 3C97A 3GMTA 3R0ZA 4FDTA 5D84A 2UDPA 3K4HA 2D92A 1BD4A 4UASA 4BASA 4BO7A 2QYTA 3LX6A 4LK3A 2J8ZA 4HVAA 3RL7A 3KYDA 3KWFA 5JCPA 3P8ZA 1XL1A 4YRTA 1U0EA 1EVJA 4MV4A 1ZL0A 4B3IA 1A76A 1GCAA 5KNDH 1NQAO 2QPLA 4NHEA 1WSAA 4X7BA 1VCIA 5JNUA 3DAGA 3LIIA 1NKVA 2H16A 1S8OA 2JAPA 4OSOA 4UDNA 2IZ7A 4IJKA 2NPOA 3OO0A 2FLWA 4ARAA 1WXDA 2HTEA 2K1ZA 1RWOA 3PJDA 2H9IA 4A0GA 3DOIA 5KREA 4L07A 5M3BA 3Q88A 1HG0A 3KB1A 3THSA 4JI5B 2OA0A 4JJ6A 2GX6A 4EY4A 3C8HA 2NUPA 2RK3A 1TVEA 3IJ5A 2X0KA 3HU1A 3UH0A 4BU0A 5JNWA 1G8SA 1OGJA 2QPTA 4HYTA 5KYYB 2XXAB 4HG2A 2Q6LA 4EG7A 4D4IA 2B1QA 3K7EA 2PG3A 3CEHA 2R8BA 4TWIA 1XKXA 4OIFA 3ANTA 4QBHA 2HL6A 2FKAA 1MDFA 4DNPA 2QK4A 5JFGA 3U31A 3K4QA 3SX4A 1LX7A 1QG6A 2B82A 1PW5A 1ANKA 2JLVA 3OUZA 1FFBA 1CTQA 3QU4A 1E66A 1BA2A 3L1VA 4NMWA 4IIDA 4PYIA 1IXSB 1ORTA 2WP0A 1UEZA 1AB5A 2NO0A 3O4GA 3PNMA 3T3MB 5H8WA 3BF8A 3KLNA 4EQZA 3L04A 4CLRB 1TMKA 1NU6A 3FX2A 5HEBA 5B42A 1RMYA 5ISMA 4LF6B 2J9RA 3RQIA 2CJPA 3DWEX 3LD9A 1EUDA 4GM0A 2I6GA 2QUJA 1IM8A 3WQSB 4TVSA 3AFMA 1JBKA 4NJMB 4KU4A 1KR2A 1NATA 1F0NA 1T9GR 1ULBA 1Z5VA 5AM0A 3S0JA 3X43A 5JXBA 1Z0DA 3SPXA 2DMRA 4OYHA 2I87A 3RWBA 2AG6A 1KQGA 4PHTA 4B3HA 2HO5A 2BHRA 3T94A 2PUBA 2Q7XA 3QP9A 1GADO 3DR3A 3NOQA 1ZZGA 3PRYA 3OTWA 2NUAA 4MUHA 3UAOA 3H75A 4W5RA 1DUIA 5CH8A 2QRPA 3BQ9A 1A77A 3NOXA 1DIAA 2AYYA 2GEKA 2C0QA 3KR1A 4JT2A 4YFYA 5KB3A 1KMCA 1J90A 2UZIR 1EWYA 3DVRX 3GI1A 3CRMA 3L8MA 3OX2A 1ZN2A 3IEVA 2N9UA 2KA9A 3GNLA 1MP0A 4PIPA 4JLNA 5GM2A 1EX9A 1OIXA 1VPEA 2L42A 2NWQA 5DI9A 3ZW8A 3ZG6A 1C30A 1WB6A 5HFDA 2DM8A 3D6NB 4BZZA 4EELA 5C8DA 1EG2A 3OURA 2C8KA 4I1YA 2ZSAA 1U1EA 3AIKA 2O1EA 4TKUB 4ZGGA 5FLYA 3U2QA 5JDIC 4NATA 1WUKS 2XECA 4KXQA 1PK8A 3E70C 3O38A 5HS6A 5B3LA 2QP4A 3P9NA 3R20A 1RI1A 5IJ9B 1IOZA 3KS9A 1VJ5A 2ORED 4XFJA 4YRCA 5D3KA 1KJ9A 3RUIA 3G1TA 3WJ2A 4LF4B 1TIPA 3EOBI 3GR6A 1NNI1 3ZE9A 4K78A 1ZLXA 4CR8A 4BBZA 3DMPA 2WM3A 5ALLA 4QT4A 4IMIB 2P7HA 4DPLA 4M88A 1HUQA 4NE7A 3FSGD 1NXQA 3ZIAD 4B9AA 2YFKA 4K6CA 4CQLB 2DLNA 1Y1TA 2VUHB 1LNQA 3EZFA 4R31A 3QWHA 2WJGA 3OQBA 2A14A 4BECA 5KNBD 1I5RA 1LVHA 4MQFA 4PHHA 3NC4A 2JB9A 2PL9A 3M1YA 5B1SA 5JROA 1VE7A 3JVVA 3ZZ0A 3NZEA 4EP1A 4F9GA 4GR9A 5K3CA 2DWPA 4ER5A 4DTIA 3N5CA 3E2IA 4WKBA 1JECA 4TTPA 4XKJA 1LTHR 1S89A 2PO5A 4MEJA 4PYMA 5FYQA 3S99A 2ZYVX 4FGJA 3RVQA 5DN6A 3LF2A 2ACWA 4MRRA 3FTFA 1FU8A 2JGEA 1OWMA 5FBHA 5L9AA 2P4UA 1AS2A 1U94A 2D2VA 1TYAE 2FOXA 2GPJA 1I13A 2R1TB 3LFHA 3GRAA 4LDAA 1TRKA 3MTEA 4B3XA 421PA 2B25A 4RSMA 3L7BA 2FWIA 3OM8A 2RHRA 1SA0B 4J07A 4FZRA 1I24A 3SM9A 4HH3C 2P4SA 4FXPA 2C2ZA 2R8PA 1XNGA 1RXYA 1WPRA 1T9KA 1YFKA 4NZ9A 4EJSC 1QHNA 5CYGA 2WB4A 2Y4OA 3BXHA 2Z1NA 1LJUA 2J3LA 4R05A 5AJWA 3CRRA 1F2VA 2WNIA 2KX7A 4L50A 2C4NA 3N0VA 4ZVSA 4LCBA 1E32A 2G9UA 3ZW9A 1L4GA 2PH5A 2P9YA 3ETEA 1F6BA 4NYMQ 5I8PA 1Y4DE 3GZTB 2I04A 2VK8A 1AS0A 2J5RA 3DCNA 3L0YA 5FCDA 4IDBA 3VKWA 3LI2A 4BGVA 5DYNA 3PIDA 3W78A 2QVXX 2FTKE 2RGNC 4OXIA 1KPHA 2GA8A 2FMXA 4UU7A 4L73A 4LOLA 2QRKA 4NZPA 1VI6A 1Y5RA 1SC1A 3I8XA 4OHKA 4PPGA 3D8UA 3RD5A 2AOVA 3ROMA 2HA4A 2QS9A 4IILA 4QGHA 3RBAA 2I4TA 3FOCA 4P32A 4QAJA 3RKSA 3SZOA 5IZCC 5KEIA 4Q4HA 2FWAA 4BO5A 3K0HA 4GSLA 3T0GA 2HN9A 2INGX 5ALYA 1IY9A 1KKUA 1LLQA 1JA9A 1JP7A 2Z4SA 3NT4A 3H65A 5TY0A 4XVCA 2B34A 4KQHA 1ORDA 1WF8A 4CM9A 3SI7A 4J0QA 3B78A 1JA1A 3U62A 4CMKA 4B8WA 3O92A 1L7PA 1N57A 1NF2A 1NW7A 4FIZA 4ER3A 4WD3A 4GXQA 1P91A 2AI1A 2XUQA 3S7TA 3U44B 4OYRA 5EYZA 3QVMA 4NBRA 1PYGA 3VQGA 2R5NA 5J58A 1K6EA 1M2WA 4P93A 4RCYA 3OIVA 4HRXA 4MV3A 1NULA 4NYMR 1U1FA 5TEVA 2GCOB 3OZWA 2OZFA 1U8FO 2Q3CA 1QWOA 2ASVA 1XQVA 2O3JA 3MJRA 4LXHA 2WUDA 5DYYA 5E6UB 2FZ4A 3FNFA 1OXKB 2FKNA 1T0BA 4OBXA 4YCJA 5EI5A 1NXXA 5BSKA 1NR7A 5DX0A 2H07A 4KDFA 4HEA6 4MWSA 3MW8A 4QAQA 1PG5A 4GZ3A 1Z74A 3NHMA 4S35A 1GOTA 5GONF 1NLZA 2BGJA 4GC9A 1EFRD 2IJGX 4QUJA 4TVOA 1M1YA 1KP3A 1CQPA 3VR6A 1WZIA 1KEWA 2JAWA 1Z7YA 2J48A 2ENOA 2I3AA 2O1SA 2OWEA 2BDEA 2PT5A 1SZCA 3Q0EA 4D3ZA 5HGXA 1QHHB 4V38A 2V0NA 3ZY5A 1J8DA 2BPOA 1QB8A 4FLEA 4E5SA 4EKNB 2OK8A 1M9NA 3C3BA 5H68A 3T1HB 2E4YA 1G16A 4ARUA 1VYVA 1CRQA 1VB7A 1ZL2A 2ID9A 3C6BA 4BKRA 4D44A 1XK7A 3IYLW 4QGBA 4S2EA 1P1EA 2CNBA 3L02A 3WB2A 4QNMA 1NYRA 2IHTA 2O2GA 3BICA 2IBSA 4LY6A 1DJLA 4WEQA 2W2TA 4N0DA 5DHTA 3VKHA 2AZXA 4JFAA 1XSEA 1ZJJA 3QVOA 5FOVA 2AZTA 1L7VC 3GJ5A 3Q9NA 5COAA 2PKQP 2ZJOA 4HRVA 1GNVA 3WK5A 2CEKA 2C2YA 3OP1A 5CDYA 1EGQA 3A6JA 3BEOA 3NJ4A 5T4HA 1V1TA 3GUYA 5I8WA 4FKBA 5JCOC 3F9RA 1N5JA 1KAGA 2PQ6A 3R5KA 2VPPA 3BZWA 4YJ2A 3WA7A 3TIGA 1CVRA 1YJAA 4WUTA 1DO0A 1SWWA 3B53X 1KAMA 3EDCA 4QOSA 4R81A 3WGMA 4JB2A 4BB5A 5JBQA 3AOEC 2BLLA 3KDPA 2XA2A 2D5IA 4I4TA 1PF7E 1G1AA 1J1ZA 1GZUA 2RIRA 3BFJA 4RHCA 5LIPA 4LECA 4PSVA 3AY7A 3FDIA 3HR7A 1SKUA 5EMNA 5AVSA 3RC8A 2J0VA 1KDRA 3K15A 3L05A 3OE5A 3PR1A 1FZQA 5C46F 1GL9B 1I3CA 1TCUA 4E2XA 1CJUC 4QBFA 2GM4A 5KOJA 2Z6AA 1FSGA 5DP1A 3LPMA 2V7VA 4L0DA 2Z57A 3LIPA 2GBLA 2GA9A 4I99A 4CKCA 2VT3A 4PV7A 2I66A 3KSRA 2PWYA 4EDHA 4EHBA 4RF5A 1VG0B 4TTRA 4EX7A 1NJ8A 1QANA 1J8VA 2PGOA 4M37A 3VBCA 3S1SA 2GXQA 3MTDA 2NVOA 3N2NA 4Q00A 5ICFA 3JD4A 1G7SA 3ZU3A 3LC7O 1AB6A 1D4AA 3EXHA 1J21A 1NM5A 2WYVA 1Q7GA 3FMFA 1QHSA 4FU0A 3AFOA 2W7TA 5E7JA 4UTOA 5JSZA 3ID1A 2EDVA 5DXJA 4E11A 5CA1A 5FH9A 5JYDA 2YCBA 1XA4A 2PX0A 2OCXA 3ADPA 3WL5A 3D02A 3O8BA 1W8IA 2XXBA 4LPSA 4F7DA 1UBHS 5LDDC 2PJRA 4E5MA 1Y6QA 1DIHA 4ZYVA 1ZVKA 2RH4A 3WBJA 1W36C 1LS1A 4Z0PA 1VZ2A 4LPKA 2XQKA 3UAGA 1N7JA 2P4HX 5H59A 3FTEA 3KP1A 3ZWPA 4WQMA 4PQEA 1G5QA 5G1OA 4XYGA 2QR3A 2B6HA 1A04A 3LGSA 3HM9A 4Y9RA 4GD3Q 1MF7A 2GMWA 2H1WA 4BVFA 4CNQA 4KB5A 2V1XA 2PX5A 4RELA 3H1PA 1ZU5A 5ESRA 4GKVA 2AVDA 2H6EA 2A3NA 2I34A 1GCIA 3AEKB 3HYSA 1Q3KA 1SELA 2X40A 2X2FA 5JECA 4GMGA 2YVQA 4HQFA 1DEAA 1PWHA 5DGDA 2Y0CA 3S3TA 2VXOA 1XKLA 4F5EA 3UJCA 2BDUA 2Z6VA 5HJ7A 2V7EA 1W5SA 2AN5A 1LK7A 3ZWQA 1V9CA 3LNTA 4XUCA 4C7XA 3I6MA 3HVQC 5FPPA 2IV2X 1NY6A 1ZJZA 3G82C 2ONCA 3HV2A 5FBWB 2GHIA 1VKZA 5J2TB 3ASVA 3JR3A 4NNLA 5DRYA 5FPHA 3R5TA 4AN4A 4ZYUA 4C0SA 3B89A 4OJYA 3K5HA 4MA4A 4TWJA 3RLFA 4ZVVA 4P4SA 1X9ZA 2QAGB 2CMDA 4EUSA 1AF4A 1IRIA 2O50A 1KYXA 1U5CA 2HK9A 1TB4A 3AO0B 3WG9A 1E2BA 2WHPA 2IEDA 5JCJA 2LA8A 4RSRA 4ZEMA 2ZRNA 3LWBA 1RIIA 1WXXA 3GLKA 4BMPB 5K6TA 4M0KA 3AKYA 4TL9A 4OQNA 3TLCA 1C3JA 1A96A 1H8HD 1Z08A 2KW5A 1SKAA 2NZ8A 2YVKA 2BBTA 3H86A 5ALJA 5BYBA 3UJPA 3A1TA 1DNPA 4JC5A 2JD1A 1ZW6A 5FOXA 4JGIA 4RGBA 1ELOA 1I4LD 4OXRA 3KKMA 5C31A 1WQ1R 2PH3A 3L4SO 3GAMA 1P81A 3L5KA 2A9RA 1SUCA 3KJGA 4JZYA 4D3XA 2P2YA 3NKVA 2ZPLA 1P7CA 4QBGB 1SUDA 1A5BB 2PL1A 5JBNA 3USES 5IAEA 1EK6A 1P2UA 2JJMA 1EFCA 2XIJA 4PLWA 3HPQA 4RHUA 3AF2A 3PHBE 1WUHS 2XA1A 4ECAA 2VRNA 4J9VA 4ESEA 1IEQA 1BE1A 2QD3A 2FI1A 3P96A 1SC3A 1OH7A 1H2ZA 5EZYB 4G5HA 3HB4X 2DKRA 3BWYA 3LQYA 3TRJA 3EIEA 2ORIA 1HKHA 1T1SA 3NAQA 3ZQ6A 1JG4A 1Q2UA 4TTTS 4QTZA 2AQHA 4X24A 4UTVA 2QT0A 4QIHA 5CW1A 2PYIA 3BC1A 3QVGB 1ZAKA 2JNWA 5T8KA 4CT0A 1ZINA 2V59A 5CGQB 1IB6A 1EZZA 1RWKA 3BK1A 3IQGX 4ZYYA 1WBDA 1U2GC 4Z2YA 4M22A 4KHPB 3RYIB 3HA2A 2PUEA 1NJ5A 1XLUA 3ACDA 4UW9A 3TVYA 3LQQA 5H3CA 2G1JA 4BNLA 1TM7E 5EIOA 1CNEA 4DJ5X 5FFMA 2VJAA 4WVLA 1Q0QA 2RCZA 4QJ5A 1YR9A 1CRPA 3G5UA 5I9TA 2I7TA 3NXKA 2NG1A 3AYXB 4TRMA 4DLZA 2ZVQX 3P2KA 4P33A 2BM8A 2XQGA 3UT6A 1O6GA 3THXB 3EEIA 2PJUA 4KMSA 1OH8A 6REQB 5KJEA 2DWQA 3HP4A 5JEDA 1E2QA 2QX8A 3SBXA 4JLMA 4F6RB 4HN2A 4ZCSA 3VZDA 2F3SA 1JTEA 3M2PA 3GLQA 4J2HA 1R6TA 5KWIA 1YQGA 1G4UR 2CB9A 2J6HA 2P68A 2GKSA 2YOHA 5BMVA 5IU6A 3RTBA 2ZUCA 3ANMA 4R2JA 4YXFA 3TXXA 4IWNA 2OCYC 5AXAA 4ES6A 3KKQA 1TGYA 2RC5A 1E4EB 4LXTA 5GV8A 3VH2A 3GH1A 4XLZA 4CYMA 1DLJA 2X4LA 1X8JA 5IAOA 1J0AA 4RXUA 1NI5A 4O2RA 4CL8A 3G0HA 3FNIA 4J4TA 3UXHA 2J5XA 4HUQB 4PS1A 4KSCA 1EWTA 2VAMA 3UMSA 2BUAA 3VU8A 4EHAA 3TF5A 5E0OA 2VL7A 2JJ8A 4L16A 2Z3WA 3WWCA 4D79A 3PEVA 4AQDA 2I5PO 1C29B 2AMVA 2FPGA 4ZT6A 1JKFA 1VG9B 5FLEX 4U9HS 4RTOA 2A67A 2DQSA 3IR6A 4NJOA 4KSBA 2Z2ZA 3WRWA 4N12A 3FOAA 3TLAA 3ZI7A 1QAQA 4JQZA 4AZVA 4ENVA 4ZHQB 5CYFA 5IKEA 5FOUA 1UJDA 3IT2A 2RKBA 2WUEA 3BFPA 1IPFA 1BFEA 1DC7A 2XMPA 3LA8A 4FHCA 4JEHA 2C78A 5HFNA 4XAQA 3ZE0B 3VPCA 1UKYA 3KZOA 3Q0IA 2M6RA 3CM0A 5A2QA 4D0GA 4ALNA 1HE2A 3FCAA 2VATA 2H29A 4AK9A 1T43A 2BEWB 5YASA 4PLTA 2JCBA 4N0EA 4LJ7A 1WXHA 3DDHA 2WKQA 3A1WA 3PPWA 4PG8A 2X9QA 3HSYA 5J2UA 1BS1A 1JMYA 1VGVA 2BGNA 1YI1A 4D9EA 1E79A 3KVOA 3VPXA 2BGMA 4OO3A 2FE5A 5EJMA 1KAEA 1K3TA 4Z9FA 5FB3A 3V9PA 2M0TA 3NUQA 3HBFA 2ZU0C 4WW0A 4CIXA 1EBUA 2LRHA 3IKJA 4OBEA 3H0EA 4WLVA 2CLKB 2FZKA 5E6UA 2FE1A 3NB0A 3WAKA 1SQ0A 1USWA 4M9RA 4X1IB 1S2LA 2AI2A 5K0JA 1P2SA 2OGTA 1NP6A 4ZK6A 2PBZA 3PFWO 4UXIA 1NXOA 4B3GA 5IWCA 2O3RA 1HEYA 1WEKA 3I9OA 3QE3A 5DOVA 4BMXA 4Z9YA 4MJ3A 2JSNA 3RVLA 1C9MA 2WJPA 1TVCA 3VAYA 3KZEA 3F5SA 3I9FA 1TUEA 3GJ0A 2VDUE 3OJXA 4KBGA 1EMDA 3U3KA 3JW8A 1TAQA 3UJBA 5AUNB 2AFHE 3O0TA 5DT9A 3EQ8A 5HBRA 5L4SA 3CLRD 2YVAA 4GVPA 1TOAA 3NT2A 3FCUB 4IHJA 5DW0A 4E4YA 3ETDA 1HI9A 5NLLA 1NVKA 4PTYA 2BTQB 3ROZA 4CTNA 4RY2A 5AVQA 4Q3KA 4GSKA 4YV1A 5KSOA 3K6KA 1FDVA 1LVGA 2XCRB 2YXDA 2PLWA 1BFDA 2B94A 3DL0A 3T9EA 4AP5A 5ERYA 3RIXA 3NHPA 4Z9XA 1UEQA 3QLUA 2YQZA 4NFSA 2XTZA 1Z35A 2REOA 4TXHA 2IF0A 4EYSA 3HBNA 2IVFA 13PKA 1C3VA 2NIPA 1GGHA 2QDXA 5I5EA 2NW6A 2QE7D 1VE6A 4LRWA 5LNK6 2C3PA 3SHUA 4HGYA 4PR0A 1VG8A 4NI5A 4YDRA 3CLVA 4YRJA 2B99A 1YQTA 2BCGY 1G8PA 2R65A 3GFQA 4EW2A 5BWOA 1T4CB 2ODPA 1DMRA 3MOIA 3EJ6A 4OHMA 4PGHA 3BCUA 3PSAA 3RC1A 3ZCPA 1KC1A 3VSBA 1QG4A 4DJDC 2ZQYA 4PN3A 2GZ3A 5F3DA 3OZRA 4AO8A 4ABYA 3T3PB 1KJWA 4XEUA 3IHWA 2HNKA 5GGYA 4JHXA 5LZ5A 5AO9A 2XB6A 1P80A 3A4TA 4MULA 3DHYA 5IJZA 1BW9B 1IIBA 2YNMC 3ZDYB 2CL7X 5SY9A 2C4HA 3UHOA 3QYFA 1W48A 4MKGA 4DCGA 2AEEA 1OA0A 4G25A 1ZA1A 1ABBA 1RJWA 2C98A 1JQLB 4C5AA 1E9RA 5IM4A 2ZRGA 2VPZA 2PUGA 2R7MA 3DCIA 3RAEC 3TB6A 4CODB 3UPUA 3K0BA 4M8SA 2V90A 2QNBA 1JHRA 4E22A 4GF5A 4MKHA 3N5KA 1ENPA 2B4QA 3T61A 1ZMXA 4DA0A 3THYA 3BGVA 2P0EA 1GQSA 3HABA 3F8WA 3CLUC 3FBGA 2Q6OA 4O33A 1FVOA 4ZAGA 3W2TA 2MR5A 1PR1A 1UIRA 3IAXA 3KLOA 4V1CI 1QZ3A 3CTPA 5KSYA 3TD6A 4E5NA 4A8HA 4DCVA 2E87A 3MJVA 1KNQA 1UZMA 3B1FA 4Q9DA 2I6VA 4DABA 4UOZA 3ETHA 4HFRA 2F00A 4AD8A 3ADDA 5CVVA 3O9MA 4D5GA 2G3YA 2XRYA 4KQKA 2C7OA 4YJGA 2WWHA 3LW7A 4BV9A 3OIGA 1NXTA 1X1RA 4YQYA 2EZ8A 1U7WA 2IC5A 2C2BA 2QG9A 4DMFA 4RTMA 1U8EA 3HXLA 4XJVA 1O94D 3B3JA 3O4RA 1L5SA 3DV2A 4OFZA 5FWAA 1BXZA 3AUAA 4NICA 4HWSA 3W5BA 1EWQA 3LFTA 1MZPA 4OKIA 1RGRA 5J1TB 1JDUA 3GQVA 5CB6A 2PCJA 4PC1A 1KMHA 1W52X 2OMKA 2QV0A 2V54A 5F5NA 5JFTA 5EXTA 1UDXA 4Z4FA 4X62B 2XNKA 1B8VA 4ND8A 1JPUA 4V0RA 1ZMOA 2CFOA 4PZDA 1QFZA 3S4YA 4D43A 3ILXA 4NS1A 2GFQA 3PGMA 2G06A 4DCUA 3L4JA 4YMHA 1HYHA 1P74A 4NMRA 1YK1A 4MR7A 3FIUA 2Q3LA 4PWZA 3UMJA 4JOCA 3JWIA 2PXAA 2WHQA 3QFRA 5JC1A 1M33A 5ES3A 3A2LA 5EHNA 5AW5A 1J4AA 3BTSA 3CSUA 2E4WA 2QLMA 4NMVA 2Y0DA 3SX2A 3MS4A 3CF4G 4P7FA 4ZCTA 3MUOA 5FUYA 4ZYLA 5K8VA 1DWQA 1OOEA 1QS0A 3Q1KA 2AEMA 4F3TA 1Z38A 1L7XA 4A26A 4JBWA 2NU7A 3FFBA 5AOVA 4R1LA 1U0BB 1WZ2A 1PX0A 3DEIA 5HJEA 2KAWA 3KK0A 2XUAA 4TGLA 4S05A 4R51A 3KYDB 3WGIA 4FCTA 2ZYRA 1BGXT 2QRNA 4AWBA 5L7TA 3EDYA 2N1MA 4AIRA 1J9ZA 1XZIA 4JV5B 2ODAA 3FUUA 1RFGE 2IH4A 4KPYA 2QG6A 3F46A 1GTRA 3ZCTA 2ZJ1A 3I9KA 3JASB 3UJ9A 1N8NA 3EIFA 3H5WA 3GZNB 4IW3B 2P77A 1RI4A 1RLUA 3BWMA 4RC9A 3NTOA 4E09A 3PQEA 1OWLA 1JFTA 1EZ4A 4JKYA 2FA9A 3KTOA 1U9ZA 4C4PA 1UEIA 1I0IA 1H0SA 3UJ3X 1OBOA 4HYEA 3HRKA 4G0ZA 4BNUA 1VSUA 1CUAA 2FZLA 2AUTA 3HPKA 4O1HA 2R751 2BRUA 3KVRA 2O54A 1IZ0A 1E1CA 5DHSA 1XQ1A 2A0FA 2V74B 3I3SR 1UC4B 2OFXA 3CVYA 1ZH0A 5HE8A 3ZWYA 1DKPA 1XMXA 1GR0A 1GY8A 1NHWA 1KDTA 1RJGA 3GAFA 4JP8A 5D7BA 1T6YA 1J23A 2QQEA 2XIQA 1YE5A 5K0ZA 3RARA 2F1HA 4QUEA 3T9FA 1EUQA 2WPDA 3E5HA 2TMYA 4X1YA 2RCNA 3NHYA 2QNRA 1VL1A 3AHGA 1YL6A 3C5VA 3KYIB 2JJYA 4FS3A 2YXBA 1EA5A 4PC3A 1IY0A 2ZE6A 2W90A 3SQOA 1L9XA 3HKDA 2VC2B 2IZ0A 1M2VA 1MIOA 2QL7A 2R7LA 1EUCA 1X0XA 2F43B 4B34A 1FVXA 1B1CA 2GYYA 1L5YA 2VN8A 4Y6RA 5FWYB 3SN6A 1NBME 2QRGA 5FWNA 5B37A 4LKOA 5CUQA 2FEWB 4Y2PA 4JDUA 4R0NA 5KOHB 4XPIA 1GXSA 2G0TA 1OE0A 2GS9A 3Q3VA 4L28A 1TO2E 2GSDA 4EG3A 1PZXA 4AF7A 4ZU3A 3C3KA 3P2MA 4MIKA 4ZODA 4GX2A 3EPKA 3MINB 3KJIA 2IH5A 1G17A 3ABOB 5LZ9A 3B3GA 4LYFA 3COSA 3FYDA 3V7UA 4JIGA 4P0QB 3DFZA 3ONVA 1V1JA 3ZEAA 2V55B 2E49A 4OQYA 3TBKA 3WAGA 3AF6A 3C8DA 4QUIA 3QMVA 5JS7A 1WNTA 1UKZA 3F74A 5BWMA 3V1NA 2IYZA 2J09A 4R1OA 3H5IA 1KI9A 2DM6A 3AVPA 4RK1A 1QQ6A 2DGDA 2O8VA 4NNMA 3PRKE 1HT2E 2JA1A 1NZDA 1T1GA 1SAYA 5IH3A 1QM5A 1YBVA 2H17A 3D4LA 3T4PA 3GEEA 4N7RA 4NQZA 2O7RA 5ULLA 1TADA 3BDIA 1L5ZA 3JS5A 2HX1A 1WKVA 1I7DA 1XWIA 2WIJA 2ZS9A 1NLMA 2WMDA 5A62A 3A6GA 2GTHA 3EASA 4GZ5A 4IHQA 1NSYA 3RVBA 1XXHA 4L78A 1XF1A 1OY1A 2EKBA 4KI7A 3TZCA 4G89A 1U7TA 1RYMA 3U7QA 4EHDA 5A4AA 2GEBA 3FWNA 1SCQA 2WMOB 1ADFA 2HK7A 1O95A 3CZAA 4DZRA 5F3RA 3OJCA 2P65A 3FPAA 2NN3C 2R97A 4WV3A 1E6UA 1YO6A 3CPHA 4JWKA 4WK2B 1SKYB 3PNOA 1J0XO 1Z6TA 1D09A 1FDWA 5JE8A 1T8SA 3ICVA 2BIFA 3E84A 1XBTA 4MV7A 1CLUA 4G0MA 1MT0A 1NI4A 3IUQA 5JH7F 3LSTA 3AI7A 2G1PA 2B1GA 4ZQIA 3B70A 1RKVA 4DY6A 3ER8A 1LPMA 3TSYA 1I2CA 1LJ8A 2OXTA 4B32A 4KFVA 1UBLS 2E1RA 3CYYA 3OQHA 3UPDA 4C7MA 4XR4A 1QZTA 1ZDMA 3CJRA 4REMA 4NWIA 5B6JA 2GR9A 2SICE 2RIPA 1QQTA 4D9JA 3CWZA 3Q7PA 1X9GA 5ELMA 4EW1A 5LZ2A 4FD2A 3HU2A 2XMSA 3MLAA 4OJMX 4J0CA 4D3YA 2GPBA 1N1MA 2J67A 4QULA 1PWZA 4TMWA 1KVQA 1W88A 1VBNA 1FUIA 2L19A 2X19A 3IODA 4FSHA 4M7RA 5A06A 2LOBA 1W4RA 3OCCA 1C9EA 4BRWA 1TM2A 1E3EA 4JGGA 4H9GA 2Y3IA 3UJAA 3AR6A 4RKEA 2I80A 2OV6A 4YCBA 3AY6A 3K9GA 5IHPA 2XPCA 2BFEB 4KLRA 4O2AF 4X1KA 2NUBA 4EEXA 3CFYA 3IBCA 4F2WA 5KQLA 3EIHA 3LXMA 4A23A 5DBOA 2VDJA 2BOVA 1IY1A 2ECFA 1JSCA 4KLNA 1H3NA 1ZBQA 4EG4A 1A1VA 3DDUA 2H2CA 3HCFA 1NBOA 3SC4A 4Q6WA 3EGGC 1NN3A 1CVLA 5AI6A 4LG1A 4D4GA 4S3MA 3IR5A 4UU0A 3WK7A 2CDAA 2O2DA 3EH1A 4XCQA 2YIJA 3LY7A 3NDIA 4U6NA 2AHOA 1T9DA 2KHZA 1Z6XA 1V0JA 3E3LA 4FEYA 4YN3A 5TQJA 1ZIYA 1Z8NA 1WP9A 2NTJA 4ETIA 4D9FA 4LJRA 3T15A 3A25A 1AQNA 3UA4A 2EX4A 1RM5A 3OT1A 3THYB 1AHNA 1BSVA 4FHZA 1ND6A 5IAGA 4BTLA 3C87A 1K06A 2AKYA 2HLDA 4NPHA 1QOZA 4PG4A 1QHYA 5LQAA 4J03A 4R40A 2O3UA 2XCTB 4QOIA 3ESAA 1TU0A 1M34E 3KRTA 4CM5A 2EV8A 4PNEA 5FLXA 3DVSX 1DUSA 1FF9A 4BUJA 1CFZA 1QE3A 1KBOA 2FY8A 3P9QA 1CJVC 4YCMA 1T8PA 1JRLA 1GNLA 2SBTA 4YUWA 1Q50A 1IOVA 2W22A 1MO5A 4KNVA 4UOQA 1GNRA 5LP6A 4TLLB 5DYIA 4LF5B 1DWUA 4YROA 2QL9A 2VKQA 3PXBA 1UQRA 1X7YB 4FMPA 1D2HA 4G1UC 4XIIA 3O4JA 1RABA 2W00A 4FMCF 5AJYA 4RPKA 4NX2A 4RF2A 3L1UA 3AWIA 2P40A 4H1WA 1C7FA 3NIFB 4HLQB 1SBZA 5J1SB 1H66A 5CXSA 3LYUA 4I8IA 4F11A 2Z08A 1F9EA 4LZPA 1SB9A 2BSAA 2EFHB 3MVEA 4LBZA 3NONA 3QWBA 1Z6YA 1G4AE 1TEXA 1UK6A 2QRHA 3FPBA 2J9GA 3QKWA 4GMHA 1XJ0A 3E18A 3S5UA 3E9MA 3UYKA 4CMBA 3DTVB 1Z18A 2JL1A 1WR8A 4CQJA 3KLPX 2YXEA 4LBYA 4UUQA 1QRUA 1NE7A 3F67A 4XE5A 3DUFB 1YDWA 2I6QA 3DC7A 5DASA 5DDIP 4BB6A 3U3DA 1VL5A 1WV1A 5HKLA 8MHTA 2VYND 3OA0A 3NNSA 5HF1A 2Z9IA 1ZA2A 4E30A 1IBMB 3UM9A 1QWSA 1U3FA 2PR2A 4ZEWA 2A0XA 2CFRA 3KAJA 3KT3A 2G8NA 3WI7A 3WLIA 4D8YA 3CS0A 3OD5A 5CYPA 3GCOA 2EV9A 3G89A 1SUBA 5L4NA 1G2PA 1I0LA 3O83A 5CD9A 4AY2A 1Q0RA 4MUKA 2QTMA 3TIVA 3K9LA 4D9CA 3Q5DA 2GAOA 2POCA 4F6RA 1IQRA 3R7WB 2O8FB 1C3EA 2AJDA 3T52A 1EX7A 5D3QA 5CAEA 2YUYA 1R4MB 4A6PA 1NVEA 3KXLA 3H6KA 4F4HA 2FRVA 4IUBS 1OBZA 1P6QA 3IILA 4QSMA 5EJ8A 4FZVA 4LF9B 4JR1A 1QKJA 3BWDD 3RUHA 4U0JA 1JHUA 1I2DA 4WOJA 2LV8A 5JG7A 1V7PC 4KO1S 2QN9A 2D13A 5DNEA 1YDGA 3TLMA 3QVTA 3T54A 4YRZA 4PIMA 2DRIA 4JAVC 4BX8A 1B73A 2R4UA 2OILA 1JE1A 2G83A 7REQB 1QMPA 1HNWB 3UWSA 5IC5A 2VO1A 3WLEA 1H9AA 2EEJA 3CR8A 4DZTA 4GDFA 1SK8A 3D0KA 3L9XA 1YK0A 4ZAXA 3M7IA 5FHQA 3WO0A 1PS9A 3D6TB 3NDRA 1ZFNA 1FTWA 2G5MB 4IZHA 4QSHA 5AR1A 1NW4A 1WIFA 3JSXA 3J7AC 1B2RA 1IHPA 1YRYE 4INAA 1GKIA 4CLDA 2XYPA 2F9FA 2HGZA 4P83A 3OMWA 3RJ9A 3WJ1A 4C0AC 2ZETA 3KFXA 2PQ0A 3GJTA 4MW9A 2RBGA 3AF0A 4CXMA 2PSDA 3GUVA 3KYJB 2CLIB 4RAQA 5HHTA 5I4CA 2G6BA 2ANCA 5EFOA 5AQEA 3G5MA 5GV7A 1U3BA 5B7GA 1ORVA 4Q12A 3W04A 1QFSA 2CLDX 1IN7A 1DJMA 3EQ7A 4QDZA 1KO4A 1E9BA 3Q85A 1BJRE 3JZMA 5B5SA 4OUKX 4JXXA 2ONJA 1AUXA 1E4OA 4LDQA 2DC1A 4BGUA 3F4BA 5LLTA 1VPTA 4JCCA 1AY0A 3U60B 1S0UA 1L7AA 4C01A 1I2AA 2Q6KA 1P45A 3DHWC 1E7SA 2JLUA 1ZCZA 3PLRA 4Z7NB 2O2EA 4FM9A 4Y2UA 1A9RA 4IHJF 2ZIGA 3HCDA 4UTZA 4JI3B 5F23A 4R1MA 5CXXA 3VHXA 3T9AA 2FETA 2OQ2A 4RUKA 2ZJ8A 4CM4A 1UPUA 3RAJA 2I03A 3PEFA 1P33A 1C30B 3S27A 4K03A 4I08A 4LHXA 5JANA 3RJMA 3EDMA 5KU1A 1XPOA 4IAOA 2WDPA 3OLWA 4LOIA 1PSDA 1TU3A 1U8AA 2NTEA 1P9NA 3HDQA 3O8QA 3RIHA 3TM4A 1NIJA 4EF5A 4MHTA 1Y48E 1EFVB 2H1FA 2V6MA 3CF6R 5FJJA 4BNJA 3AEKA 1ZWKA 2HCFA 1E2EA 5BORA 4MQ4A 3A26A 3QKSA 4ZQCB 3A4YA 2LKCA 1M34A 1RCTE 3OOYA 5IF3A 2HJSA 1Q2XA 2PD4A 3AOEA 4RCVA 4HYQA 1ZITA 3I1IA 3CH7A 3KE9A 5FBVB 3BAZA 4JBIA 4N3NA 4JBNA 1TCVA 1A7AA 4PYNA 1VLQA 3E9RA 1WFVA 4IBOA 3TFQA 3VOBA 4ZPJA 3EGHC 3H4TA 4L5IA 3EBOA 3G9XA 3FNEA 1HQCA 2J07A 1ZHHA 3BN3A 3F5QA 4AKIA 3AP1A 3SY8A 4UEJA 4TKLA 1GL3A 5G40A 4XQCA 1WJLA 2PMEA 2AMYA 3BL8A 4TWBA 3WOHA 1MABB 3A3KA 3IUSA 2QM8A 3W6OA 1YV9A 4RTQA 4BVAA 1SCAA 2WU4A 1IK6A 3GEPA 5CLLA 2NACA 1CULC 1SXQA 1JH8A 4EWLA 3Q7IA 1C4XA 1CJCA 1GZ6A 2P9HA 2ZJ2A 4E7OA 1CV2A 1I1QB 1E8MA 3GGPA 4MW4A 5EIFA 4XWYA 3ORSA 4PLZA 2OV3A 3GN1A 4L4XA 3FPCA 4X6LA 4XGKA 2ZB8A 3P2YA 4YECA 1M6WA 3JPWA 4EO9A 4ESHA 2H2BA 2O57A 2NAPA 3WL3A 1AM4D 2QP9X 1Z4LA 5CVCA 5I7FA 2QVZX 3K6JA 4XQ0A 4JYZA 4DMHA 2I0FA 2P1RA 2IBTA 5L51A 3U6KA 3EB9A 3LBYA 3QEKA 4HOPB 3E1SA 4B47A 4EVRA 1PTJA 4MR8A 2WKRA 2KYLA 2CDBA 4G5QA 5IRCD 2UUCB 3U0VA 1VSBA 2VWQA 1E2PA 2BFDA 2R6DA 5M29A 1AKYA 4UCFA 4GO1A 2CV2A 5H02A 1ACLA 5JWHA 1BS9A 1NBEA 2R6R1 3AL0C 1Q12A 4HD8A 3FMOB 4KWHA 3ZC3A 3UEOA 4K6YA 2JINA 3U4MA 3RTEA 2NP7A 4QEZA 3SUZA 1TC1A 3JRWA 4NIMA 1ZUHA 1MXHA 2R00C 2BMFA 1RPJA 4D8VA 1V41E 4EF4A 2GK7A 4URWR 2AJTA 1Q92A 1N0IA 2Q3MA 4AJJA 5A2PA 2HW8A 1IXYA 4HR7A 4GRAA 4JD5A 4LNHA 4H35A 2IGTA 3OA2A 1ZGBA 4Y9TA 2FN9A 4M1QA 1U7HA 2DC2A 4BGDA 2XI4A 2G07A 1CT9A 4HDNB 3GF4A 2C4UA 2XRFA 2Q2OA 3FLAA 2WV9A 1KY5A 4JUCA 4YACA 1YI8A 1HFJA 4CQMD 4UDXX 2H3HA 2H9YA 3IC5A 2IU0A 1BO6A 1MU0A 4L5AA 3F98A 1B74A 4WZBA 2YV5A 1NXVA 3WGUA 2EJYA 2KPKA 2V6IA 4PAGA 4TWAA 4XCXA 1FU4A 3EEQA 4H0CA 1GQQA 3GFRA 2NSLA 3LP5A 4N47A 4BNZA 1G55A 1OU0A 5B57C 3GDWA 4L76A 2NZJA 2ZRDA 5CVEA 4R8SA 3KQUA 3IDOA 2KRGA 1FFHA 1JNYA 2VAWA 2Z0MA 1P7WA 2A5YB 1Y3CE 3HO8A 4MS3A 4WY5A 1V3QE 4I3HA 3U1VA 4DYHA 4ZK2A 1I4DD 3GGEA 1D6NA 1H69A 2ERYA 2FR1A 3FSJX 1E5LA 4KN8A 1VCOA 1QAVB 2FSVC 1EFLA 2JLQA 2Q0QA 3JZDA 5EC8A 4CLRA 2OPGA 5JD3A 1N3IA 3TMHA 2QSYA 4RIHA 4LZLA 3D0QA 2E4ZA 4MV8A 5ALPA 3MXOA 3TRFA 4A9AA 1VJDA 1Q1ZA 1F2DA 2VWRA 4MVJA 1JPNA 1Q6ZA 2P1ZA 5KWJA 5LN1A 3BB3A 2KOMA 2AK2A 2CLLB 3DM9B 4KMRA 4LCEA 3D31A 1R00A 2NU9A 2DWOA 1X5NA 2B5VA 2A92A 3GXOA 1ECJA 1ZR4A 2REYA 1TI7A 1USKA 3HY4A 3M5WA 4DRXB 2WWVD 2PUDA 2AD5A 1K5DA 5HF6A 4LK2A 3BXZA 4MDYA 1SWVA 4ZQBA 5CRIA 1GFWA 1MO4A 2F1OA 1D1SA 3GT3A 4DCCA 1L3BA 1XEWX 1NVAA 3BFVA 3VMMA 4CL2A 4FT2A 4C88A 4DM7A 2D0DA 2D5AA 5HDYA 1XZQA 1Z4JA 2HO4A 2IY9A 4O2AB 4IXNA 1Z25A 3F6CA 3W9BA 5C7LO 2GRAA 5L3RA 3HH8A 3RTCA 3V8NA 4G4SO 2HBZA 1KY9A 4BMZA 4X93A 3OLZA 2PRJA 3B6MA 1IJBA 4Y7DA 1N1DA 2CKDA 1UOPA 5HX7A 2WTMA 3FPKA 2NMVA 2AH5A 4ZOCA 1LDNA 5KVCA 5C1PA 5KYXA 3DM5A 3PVZA 4OJKA 2J6CA 4MQ6A 1N36B 5EKTA 2F8TA 2FPIA 5FOWA 2JCGA 1M1NA 1WUJS 1DPFA 3LK7A 4F12A 5CFLA 3VU0A 3T3OA 3N8KA 3NH9A 3R6GA 2AN4A 3TIXB 3JQ8B 4L5CA 5KJFA 1U8UA 3PKZA 5IDVA 3S81A 4MVJD 3RFXA 4LHVA 4OKSA 3SK0A 1D2AA 4OBWA 1KSGA 1QZXA 4AY6A 1H2FA 2FDXA 3OUUA 4LGMA 4RO0A 2JFPA 3TLJA 5CLQA 5I9MA 1RHRA 3BDVA 2XZTA 4WLEA 2OO5A 1DZIA 3BS4A 1MEOA 2WE7A 4HDMB 3PYLA 4C0QC 1XZJA 1F6WA 2D2EA 2PT6A 4RKFA 2C99A 3P20A 2ZUDA 3V4SA 1QUEA 1US8A 5EUCA 1T4CA 4D80A 4BRSA 4UNRA 2GXAA 4JORA 2OHFA 3JQAA 5PNTA 2P30A 4EEKA 1A0OA 5TDHA 3DT6A 4ID9A 3EFOB 1PVVA 5IYZB 4TTSA 3NBFA 3UUGA 3OZIA 1I6WA 3C5WP 3DH0A 3KUXA 1M8KA 4B3SB 1XVLA 2CXTA 3L6DA 5JJBA 3OJLA 2Q50A 3R6LA 1WS6A 1EP9A 2CMHA 1XZFA 5AK3A 1OXUA 1RZRD 2YJTD 1FIUA 3ML1A 4YYXA 2HSWA 1LPBB 1UKBA 1G9XA 2PLNA 4N54A 1AGPA 2WUFA 2CSSA 1T34A 2IXFA 2RGNA 3BYZA 4MS1B 4BIMA 4B1FA 5ED4A 1NZJA 1J7KA 3R2JA 3SIXA 4WOCA 1JE0A 5BN5B 1XCPA 4TMFA 5EZYF 1G5RA 1QZZA 1UBEA 1XOIA 1N6FA 4CMEC 3E9NA 3AZQA 5AXBA 4Q9KA 4CWAA 2EDPA 2G63A 1XKQA 1U3DA 1DBVO 1SCUB 2CLHB 4PAOA 3BKXA 1K8YB 4DY4A 1KZ7B 1U2DA 1NRXA 2CJFA 4YAOA 4WZ6A 3KOUA 1DEOA 4O4JB 2EHRA 1HFWA 2X0IA 1WDTA 3OCVA 1T36B 1SUFA 1AURA 4KQ6A 4M9SA 1SVIA 3KFLA 3EEOA 1VFNA 1XXHB 1ZX1A 1NVFA 4QHSA 3LGAA 4MQEA 4RK7A 1CZRA 1EVEA 2IWHA 2ZRQA 1PRYA 5T3YA 2PSHA 1C50A 1LY1A 4ON9A 5DFAA 3SJ7A 1NVUQ 5B7NA 2ATVA 4GOOD 4UU1A 5ER9A 4ZYWA 1O95C 2MSKA 3MHTA 2J3HA 3GAAA 2OQVA 2VQEB 1NJ6A 1G7TA 1U2TA 1H5QA 4I1SA 4D9NA 4DBVO 3FYUC 3MT0A 4OXNA 5G4LA 3DO5A 3TTVA 4LXXA 1KMMA 4OJTA 1GTZA 5FUQA 2J0UB 4H6PA 3NFYA 4FB4A 2FK7A 3FSEA 3HP1A 2ZIWB 5E9QA 2ZJAA 5KYGA 5E7IA 4B80A 4N0PA 2GN9A 3E3AA 2EFYA 3CHYA 3H97A 2PZLA 3ND6A 3QE0A 1YR1A 3QXXA 1UC8A 4LHSA 4UMVA 3Q7SA 3T7IA 1AKQA 5KS2A 4L5YA 1NJFA 1DJQA 1MFPA 2R5WA 1KI6A 1UMKA 4QT0A 3QVVA 3U3JA 1R2QA 1SVKA 1CY0A 2CMFA 2PRKA 4HK4A 1IN6A 3MERA 2OB1A 5LQSA 4LX0A 4QGGA 4YMWA 1QQAA 2CW5A 1NHGA 2JGJA 4XVQA 1VRVA 1J39A 1DRVA 1R64A 1LH0A 2JJQA 1GR1A 3R8CA 3UOAB 4ADSG 5CFPA 3K20A 4WY2A 1EX1A 3IBTA 3DFMA 4HUQA 4BOYA 3PCTA 3GSLA 1NVGA 1QHGA 3M9WA 1Y8AA 1BGVA 1R5BA 1L5LA 1E6WA 1E3DA 5AK5A 2VS1A 3PPVA 3BD6A 3H1EA 1J5EB 1QF6A 2C82A 3MBOA 1YGPA 4NECA 8AT1A 1Q0TA 3WGKA 4YP7A 4ETWA 3V2IA 3VBEA 1N8KA 4W6QA 3WLAA 2WWFA 4FXOA 2EEHA 2VA8A 4QARA 1CZHA 1C7ZA 2PGNA 3PCXA 1JQ5A 4JQCA 3ZHBA 2REQB 2GBPA 3FTCA 2NXNA 1JZSA 4LXQA 4LZZA 5GZ3A 1L6IA 2WF5A 5HA5A 2XV1A 4MB2A 4U9UA 1FQJA 1DJNA 1N9KA 4NXRA 3IQDB 4UPEA 2CWDA 2Q0XA 4O4IB 4P22A 6REQA 4JQYA 1WM1A 2JI9A 3AXSA 5IDYA 3B82A 4G1VA 2YYZA 1UEJA 3DZCA 4XYMA 3P94A 4BO2A 3AVVA 1F1BA 2VSOA 5E3IA 2P69A 3U19A 4RZHA 4FSDA 1CRLA 1TZJA 2I65A 1KI6B 2HMUA 2XBLA 3E27A 3PB3A 5KYWB 2OUKA 2TMKA 5BSGA 1AHIA 1ULSA 1HL7A 1FDOA 4HNAA 2JIPA 5J59A 2PQMA 2NT3A 4FFWA 2OV2A 4GHNA 5B6IA 3AVWA 1IBSA 4ZEOA 3KC2A 2HJGA 4UZFA 2NO7A 2G9VA 3K1TA 3NS7A 1EQUA 2MYTA 2YWRA 3SS9X 2RHJA 3N58A 3QXJA 3R76A 1RKBA 1AZLA 4TV9B 2RAVA 2VTKA 4FR0A 4PSDA 3GPCA 1DDGA 1EM8A 1VGQA 1ZI6A 4Q3AA 4OX9Y 5T7BA 1KK2A 2JAOA 2EXGA 4H18A 5JTTA 5LYYA 1WHTB 3QJGA 1T2UA 4PU0A 1Q14A 2ZM6B 3GLHA 4QUBA 2RARA 2HBYA 1XFDA 4KR0A 2Q9AA 1EH5A 1KYQA 1VMEA 3CKLA 3CURA 4YGYA 2OYCA 3W2HA 4FI3C 2SKCA 5JD4A 1DC5A 1E2HA 3E05A 4BQFA 3SVLA 3DDCA 1J9EA 4Q7EA 3IQFA 4LSWA 3SG0A 3PE6A 4OYYA 1K4KA 1IEXA 3BXGA 1A71A 1IOLA 5D6NA 5B2FA 2O19A 1R6VA 4TS1A 3NIWA 3HNOA 1RHQA 1QYCA 3NTQA 3ZJ4A 5ALHA 1Z0ZA 2HAEA 4L9RA 3V7FA 3W8FA 2B2XA 3ZBTA 4FFLA 3PRHA 4M0PA 3M34A 2PH7A 3OIFA 2D0PB 1WTCA 3HO6A 4I5IA 5B53A 4EW6A 1J5XA 1AKTA 1OWOA 2N75A 3R9WA 3LH5A 3U9SA 3VR5A 2VK4A 4YRQA 1YB6A 5JS8A 1DU4A 1LSJA 2F43A 2GEVA 3KXDA 2WWIA 1NNSA 1RAFA 4LHWA 2LIVA 5EIBD 1JWLA 2FMHA 3QF7A 4IDAA 4U1RA 2IS2A 4PSCA 1G9SA 4B79A 1ONSA 1GYQA 2HIHA 5C1OA 1KE2A 1QAVA 2UU9B 3HM2A 4KN5A 4BX0A 3HWWA 1QTNA 3P9IA 1LW6E 3E53A 4IXMA 1EFTA 4RXMA 5MGBA 4I1RA 5CB8A 721PA 1CYEA 3PYMA 4C20A 1SD5A 4JOJA 1WFGA 1INLA 4Y1RB 5I9SA 3BILA 1DAOA 3DEFA 1I16A 3B1ZA 1BX1A 1PFWA 1V11B 4GPZA 1QRTA 5CTJA 5B64A 3DYVA 1Y4SA 3LWZA 3W5DA 6LDHA 2I9KA 4LE1A 3WLSA 1ONBA 3QU7A 3OMLA 1NX9A 1OX5A 3GJRA 2G82A 4CG0A 2YZNA 1DFHA 4X60A 2GEFA 3KKKA 1KPGA 3KJFA 4QOJA 1KYVA 3ZQKA 1IVSA 4MPDA 1YBAA 3GLRA 2CVFA 1JAZA 1NVDA 3FYSA 3VVLA 1PFUA 4E70A 1DRJA 1P2FA 2FEOA 3FKQA 1UODA 4KFSA 2X0EA 3CKYA 4OQZA 1QRDA 5T6MA 3RFUA 3AZPA 3NWOA 2ZRJA 5AKKA 2B1IA 3PLAE 4I55B 5F33A 4WTOA 4DCOA 3WQQA 3LVBA 3R0XA 3UW1A 5AM2A 4UAUA 1BHO1 5CIQA 5AVJA 1HEUA 1YDEA 3QSGA 3QOYA 3VI3B 1X7XA 3L0OA 3SDSA 3WYGA 4IR7A 2FG5A 4KQXA 2Z2YA 1H93A 4D0LB 2MINB 4W8OA 1QUFA 5G4KB 3PL5A 3RSHA 4D2IA 1V8FA 4HT3B 1QFYA 5H3JA 1N7GA 4LVOA 3FDJA 4F1KA 1U65A 4JELA 4O06A 3HG7A 3GVPA 1QC5B 3VNAA 5C37A 3C3DA 2IPXA 4K6OA 4O2AA 2I71A 4WAUA 3GUUA 4P54A 3ZU5A 8OHMA 2C9CA 4HH4A 4P2BA 3NPMA 3OBIA 2H2DA 4Q9NA 5LUBA 5AKLA 3CZMA 4BXOB 4KXYA 1PFKA 1GARA 4KODA 1CUHA 4DUGA 2PA3A 3KZKA 4H0FA 3S8EA 3A8TA 1ZVMA 1K1EA 1UAYA 4RVHA 4JOKA 4NZOA 5FOTA 3RVDA 2VTBA 2ZBVA 5CU7A 1BH2A 3F0TA 1V5FA 2BGRA 4PZPA 3SDBA 1ZAYA 1UCFA 2ZREA 3F97A 5A05A 3A1DA 3HKEB 3MJSA 4HH1A 4EZBA 2YX1A 5CP8A 3R1IA 3SQLA 4J7AA 4M8LA 4LOJA 1M7GA 4R8RA 5FTWA 1LPSA 2JRLA 4BNMA 5I51A 2J87A 1IZYA 4HAXA 2WV7A 2D1RA 3GGDA 2FX2A 3KEMA 5TMBA 4DCTA 3SWWA 4ARIA 5HCUA 5TPWB 2ENWA 1EESA 4BQNA 4M0UA 2OUIA 2V7BA 1GDHA 3HXKA 1BHJA 1GG8A 3RS7A 1I2BA 2Y1KA 3FXAA 3UV6A 3PXUA 3WGYA 3L3BA 2NVWA 2L17A 3DC2A 4HPWA 2Q29A 1UZUA 1NQ5A 3D64A 4J0EA 3HS3A 4TXLA 4HB0A 4JKOA 3LCCA 3K0EA 4KDEA 1N3YA 3AF5A 3FPLA 2OL4A 3UTCA 5AW8A 2H8GA 3TRKA 3VUEA 2C5LA 2ZRIA 2ZRAA 2A9KA 3N1UA 1T2AA 2GFHA 4QOFA 4WZAB 4R2WA 4OREX 3OF2A 3DDNA 1NUTA 2PU5A 2NVUB 1NNEA 1ULUA 1I33A 1P5ZB 4B43A 1AKVA 4KAAA 3A70A 1KSHA 1FTNA 3SC3A 1G66A 4DPKA 4ISCA 4Q9AA 3Q40A 5C4MA 1K08A 3K70B 2ZJFA 2I4MA 121PA 5ALXA 1ECLA 1PG0A 3K1YA 4IDPA 4RABA 2RK6A 1WL8A 2HI0A 4HP8A 1VKHA 2FR0A 1AS3A 1T9AA 1DC3A 1A98A 1CE8B 3GLHB 4H1TA 4R1NA 2PUVA 3L8EA 1VE5A 4KLCA 4DWJA 3B76A 3DZHA 1QYWA 3I18A 3MC1A 4KOEC 1HH4A 3ZVMA 1CUVA 1SJ9A 1XZGA 4CCWA 2CKMA 1EGHA 1X7YA 1L5WA 3B13B 1B3BA 3WIOA 2Y1WA 3IBYA 3PI6A 1AUPA 1VDZA 4NZZA 3FNRA 3F7NA 4DHEA 4X7PA 2AFHA 3VGJA 4MYTA 2W6JA 4FONA 4I1IA 5D7NA 5F2EA 4G24A 2GCIA 2FPKA 5LJIA 3IT3A 3P26A 5G53C 3RRMA 2V4UA 5EKXA 4IFBA 1XZBA 4TL7A 1V39A 3RUFA 1DAEA 1I8TA 5E0KB 3PQ2A 3LA6A 4E3WA 4AIIA 1UBFA 2H1HA 4WK0B 3HJRA 3LHIA 4HDQB 2XW6A 4WNAA 5CR9A 4LMPA 5JJIA 5JSZB 1ZM4A 3QJ5A 2YV4A 4FGMA 1OROA 1ZGZA 5FUVA 3UAXA 5L3QA 3V55A 5KOYA 3A06A 1OH5A 1ORIA 1JQEA 1CUJA 4YUVA 4NXMB 3G8BA 4YUXA 4ZVNA 2Q8NA 3H9GA 3TSOA 3ZH2A 3URKA 2QTNA 4D1YA 2YT8A 1N2OA 3KQQA 1QX3A 5LP1A 1LLUA 3WJ7A 2VTDA 2QW8A 5IKXA 1QIGA 4F46A 2IYFA 4F21A 5CNMA 3GCWA 3RVOA 2WKSA 5JI2E 3EVDA 3DZIA 1DX4A 3GW8A 2ZDHA 2R79A 5L40A 1JR3E 1OAOC 1Y6ZA 3HGMA 5CPBA 2RSLA 2H2GA 3B9PA 2HREA 4YR7A 4D6YA 3KT0A 4K9DA 5LKRA 2A9VA 1ECBA 4MWTA 3KALA 3D8BA 1VHDA 1V7ZA 1EJ0A 1NXSA 1VI5A 2J1LA 1GCGA 3GP5A 2REBA 3OCYA 4GR4A 4HGNA 4A6XA 4UQLA 3AESA 1SOWA 2FX5A 3RADC 5G0UA 2IH2A 3OZXA 1BVUA 4TKVB 1UAGA 2YY7A 2XODA 4JH0A 2BHLA 4J0IA 5IKOA 2GAIA 4WCDA 1M6VA 3NW9A 3ABRB 5IUKC 3UC9A 1U6JA 1ZONA 2VP2A 3AI1A 4JUDX 4MGHA 2DUUA 4Q9LA 2KQFA 4N65A 2XUIA 5KSZA 5G0SA 1RAEA 4OEHA 3SBDA 2JFVA 3NAZA 3SIWA 2AKEA 2O06A 2HR1A 2FHSA 3C15C 2WNHA 4F4IA 1PNOA 3TOVA 1GSIA 1A7KA 4TZTA 1P1RA 2HSEA 2FPIB 2ID8A 4RVOA 5IN4A 1EDOA 4A10A 1Y82A 4OQFA 3JV7A 1YJ8A 1QU2A 4OGLA 2GLTA 1NBHA 2WA2A 3U9TA 2ZUEA 3HB1A 5F52A 3TSVA 3VRHA 4RGYA 1BEEA 4QFDA 5EZYA 2H1OA 1I94B 2G4LA 3RYTC 1E77A 5CCEA 1VLLA 4D41A 2RB4A 1I30A 2O4UX 2VP6A 2KBSA 2OR3A 2C3MA 2L97A 4HFMA 3I9LA 2XVMA 1GAEO 4FGWA 5TEWA 1NR5A 2Z95A 4TZ6A 4J0HA 4DL9A 1JXOA 1L5RA 1ESEA 1KY4A 1UC9A 4OHRA 1K7YA 2UYCA 4QYXA 1C9JA 4KVZA 5IF9A 1U0LA 4G9EA 1B14A 5CB4F 2HXGA 3PNKA 3JWGA 4HEQA 4B33A 3QHPA 4ARBA 4WNIA 3FM9A 4MVJH 2PZGA 1E2IA 1WJGA 3QUTA 2CF6A 3GK3A 1KP2A 1VIAA 3MWEB 4HN4B 1II0A 4NBVA 3CUYA 4PRZA 5E4TA 1M76A 5AKGA 2Z4RA 2GAJA 4GXRA 3SR4A 4L8VA 4TTVA 5HQ3B 4CFYA 1USUA 4LFCB 1EI9A 3G0GA 1W581 4IM7A 2YWDA 3H17A 4INPA 1S8FA 3QJNA 1BGWA 4DLTA 2AQ8A 2FZGA 2H85A 4EQ6A 1FC7A 1FX1A 3HN7A 3M70A 2WHEA 3WLKX 4PIVA 1RJDA 1ZJ4A 2PKWA 4XEHA 1V48A 1M10A 3MTBA 1I3MA 4ZCIA 1UUFA 1SZDA 3KDSE 5LA6B 5BWCA 1JG6A 3LE8A 1JDPA 1WXGA 1XU7A 3ID4A 1PJRA 4OK5A 4XVUA 1RW4A 1TW2A 1VJTA 3EMVA 3VVMA 3DBLA 3C7TA 3IIMA 2V45A 2D54A 2H3EA 4GM1A 4B35A 1CR4A 1Y8QB 2C3OA 3JZIA 1QHXA 1Y6FA 5MF6A 4UAJA 5SICE 1FFYA 2WLSA 5JCOA 3CH5A 1FMFA 1Z0KA 4E33A 1QGDA 2GN1A 2R66A 4ERXA 3PFKA 2R6GA 3HDYA 4MROA 2ZB7A 1UKEA 3O91A 3RAFC 2JBAB 4ZZIA 1PL0A 3P9YA 1NWHA 1W49A 2OBXA 2ZBPA 3IV6A 4Q24A 1C1XA 1VLJA 1OWPA 1X1QA 3ZD6A 3PV5A 1HQDA 4AF8A 1M1NB 2EYUA 2WHXA 5LQUA 4WBSA 3KZVA 1ML4A 4V03A 3SKYA 4RENA 3QBEA 4URUR 2HPAA 1DHTA 4KUGA 3ZZTA 3PEEA 4A2WA 3QXGA 3QWIA 4XWKA 4IIYA 3TNFA 3PBKA 2GDZA 3YASA 3PE4A 3NIBA 4GYKA 3JYPA 2XVAA 3BIXA 2ZJ0A 2HK8A 4Q9JA 5DI3B 3KPUA 4KNWA 1EXDA 4NJEB 4ZDWA 4B2PA 3BQMB 4NY1A 2ONKA 2GXUA 2MJLA 1U3UA 1DDIA 4KIUA 2FQWA 1J24A 5DU2A 4AMGA 3TZKA 3H99A 1RAAA 2WG0A 1G6HA 2GJ9A 1EK5A 5HTKA 3WFZA 1S1CA 2HA3A 1O6FA 4I14A 4P84A 2VWPA 3DE1X 4R9NA 2IBMA 1XELA 3FPGA 2OHVA 3P0EA 4DF3A 1EFPA 1YGYA 2BMEA 1NBMA 3I9MA 1N2CE 4MKZA 5DXFA 4BLWA 5AW2A 4MPTA 1JWAB 4A03A 1ZD9A 3RC9A 4P7BA 1E2GA 1FDUA 2VRCD 4P34A 2CDRA 1X80B 3GPIA 1N6HA 2W2OA 3M3PA 4HV4A 5JBIA 4JT8A 2VA9A 5ICEA 1NGSA 4G0PA 4JJ0A 1W6UA 3PR2B 1CEYA 1Y1KE 1EEHA 2PKRA 1ISGA 4E5PA 5CEJA 3R3YA 3WGTA 1Y5MA 1KVUA 2G5GX 4NABA 3WWYA 2MINA 5I7RA 5EESA 2XD4A 3BH7A 4HSGA 4C4XA 3WGOA 4GBJA 3UMGA 2QUHA 3ZHQA 3I5YA 3RHTA 4Q2PA 4EA9A 2EL7A 1Z3CA 2HLHA 1KSJA 1PQUA 2R1UA 3WL8A 3MH7A 2IY7A 4KP7A 1B16A 5JQGB 2MSLA 3NFRA 2WRZA 4F2PA 2V9PA 1PUJA 2Z83A 4XLLA 3V4RA 3K2IA 4Z4EA 2GJSA 3JVEA 2F17A 3BRQA 2ACKA 1ZXXA 2OAQ1 2RJNA 4LXUA 4JLOA 1QBGA 1YB4A 3ZQJA 1L2TA 3V1MA 1WXEA 3TTTA 1G21E 4IGFA 5JYCA 2V6JA 2CUTA 4K81B 5LOVA 2IYOA 4P53A 3AR7A 3GG9A 3ROXA 4HUTA 4I8DA 3B1KA 2CD7A 1G9TA 3CR7A 3F6SA 3K09A 1NURA 1PVDA 1H2BA 1TQDA 4M1WA 1UWKA 1RR6A 3OT5A 1D2MA 1PJ8A 1W0JA 2NZ2A 2XHEA 4Q7LA 5KQPA 4KR3A 3W05A 4DUZB 1WCXA 1VBFA 3D4PA 4O8CA 4U3JB 3IAUA 2CNWA 5ALUA 4URVR 3PD0A 1PQPA 2GF9A 3LVQE 1PVOA 1PTKA 5JZMA 2D5BA 3OAAA 1NLFA 2UVQA 2OHJA 3PWSA 3F49S 1TPZA 2JPDA 2Q5FA 4XSHA 4HAWA 3IEPA 1PLJA 1YE8A 1ISHA 4PYRA 1UP4A 4XUEA 4RMGA 1YHZA 4I9FA 2BY4A 3SSMA 1HFEL 1FUKA 1XHFA 3SXPA 3RVKA 2ZSFA 3K0FA 5E6RB 1JLKA 3RWMB 2HPZA 4DQKA 1Z62A 2XGJA 2XMRA 1F6DA 3OFND 4ZO9A 1K7EB 1MH9A 2II6A 4RWZA 1EIWA 4HZUA 2O2JA 4JXZA 3GVHA 1E5QA 1KMNA 3IXLA 1CUUA 1P1HA 2KS6A 2ZROA 3KB2A 3K30A 4P31A 2AWXA 4JOEA 1P5FA 1JUDA 4G2NA 4P82A 1MAHA 1R4AA 2IIPA 4HZGA 2Q3BA 4IQ4A 1D07A 7GPBA 4OMFG 2WJ4A 2B2CA 1XZNA 2EU8A 1II9A 3W3ZB 1OMOA 3L92A 4FYYA 3EC1A 4JITA 1VIYA 3W3AH 2WJZB 3LQRA 2XUOA 1O0BA 1XMSA 2O1XA 1BE8A 1ZRHA 1NKSA 3CCFA 5AESA 1HM5A 1NVVQ 3M5DA 4HFNA 2OPHA 1UM7A 2PUFA 4N03A 1QQBA 2DULA 1V1MB 4UEWA 2BL4A 3ANLA 2KJKA 4LEIA 3IKMB 1J8FA 2VDNB 2Y9MB 4ZMBA 4L6CA 1I36A 2EBUA 2GN4A 3HYTA 4MJXA 3RLEA 4DBZA 3VQTA 1E8DA 1E9CA 5J2UF 4XRRA 1Z4IA 4RS3A 1AGRA 1U2GA 1SHTX 1T2MA 3M1AA 1BAPA 1JLMA 3E2MA 3BIFA 4FHGA 1NWCA 4UM9D 2EIXA 3D54D 2H4FA 3AIIA 1UF1A 1HYGA 4RKQA 1XMIA 3HFJA 2GVNA 2XB8A 3LHFA 1HT0A 2P0YA 2B7LA 4IICA 2H8KA 3ZKWA 1H2XA 4RORA 4NBLA 6Q21A 4BMYA 3UXEA 5TQVA 1H0RA 1Y6JA 3GBVA 3VOAA 4RAOA 3DB1A 3NHJA 4KO2S 3ZE6A 3HDJA 2DPYA 2GPTA 3CRQA 1Z4KA 2CBGA 3ANYB 3VVBA 4JLSA 2ZTMA 1VXOA 3QLTA 4WSOA 3IELA 4FOOA 9ABPA 1JDBB 3QV1A 4Y6LA 4PC2A 4TS9A 4XZ3A 4X65B 3GLIE 5H81A 1EJ6A 4JROA 3DOUA 3NOOA 1AQUA 1ADCA 2YYSA 3STHA 1PJZA 5IKMA 3LOPA 4PAMA 5EKDA 5C81A 3MH6A 2FWBA 2GPYA 1XHEA 2GETA 5ICMA 1KZGB 4MK4A 4QUHA 3BCRA 1E3WA 1II8A 4YQEA 1A97A 4EY8A 2BFAA 2BBWA 4X92A 1XAIA 2WSSD 5CFQA 2QT9A 4PSAA 3T4XA 1T8WA 2FPOA 2KOJA 3OKPA 3MOSA 2BKEA 1PJ4A 2Z5VA 3WSTA 1NPTO 2OESA 3AM5A 3B36A 1L3CA 5AW4A 2XMZA 3NTLA 4YB8A 2RHBA 1SVLA 3D7MA 4JKIA 1G20A 2JFUA 9LDTA 5LDGA 3TFOA 1K4MA 3T4UA 4RKRA 4ZQFA 2O5EA 4TRRA 1K92A 2CHEA 1J0BA 1X87A 3T7EA 3W6UA 5JXGA 2GRUA 4L02A 3AEQB 3EEYA 4FPXA 4JA0A 1AA6A 1CDOA 1E9DA 2QLFA 1B3RA 2QN6A 3KQVA 3I23A 4ZRMA 4TXJA 5JSHA 3G13A 1YA6A 5EHZA 1TW3A 3N07A 5TE9A 3K31A 1J2EA 1DQSA 1QV7A 1XDZA 3FKJA 4NU6A 1W9OA 4YVFA 3V4OA 4EB6B 1KRXA 5EKUA 2OSGA 3KZMA 1QQ7A 5EWMB 1V16B 4ZANA 2GYVA 3RO7A 4DV2B 2CXNA 4UBLA 4F4UA 2PKTA 3PK0A 1I1NA 4TN5A 1YS2X 2WJ3A 2P9BA 3JQ7B 4MLDA 4D98A 4UCWA 1WMSA 4WZBE 2ZXFA 4B4UA 3N0WA 2DPXA 2Q1UA 2GN6A 2Z04A 4YJ2F 4IV5A 3OHMA 1ZK3A 4X20B 2DUWA 4UHFA 3W6NA 4O0LA 2YWBA 4ME6A 4URYR 5BXQC 4AECA 1N78A 1U02A 3KTDA 3ADKA 4INJA 4J0FA 5HFEA 3N7TA 4CFSA 4AURA 1JHMA 3RFFA 1LXCA 1D8TA 1PV2A 4DDVA 4B85A 2JGRA 3PIRA 4TROA 2UVPA 3O82A 3I45A 3SLRA 3TL3A 4BWVA 4YAGA 5CX1B 2D1SA 4M9XA 1NUSA 1MT3A 2Z2JA 3D3WA 2Z58A 3GL9A 3DDZX 5FNZA 3VR2A 1JIXA 1XTQA 3U26A 2AUNA 2OXIA 1ILEA 1IXZA 1USGA 9GPBA 3UGJA 3I62A 5ALVA 1ICEA 4GQAA 2HCTA 2OCDA 3JQBA 3L7KA 2BGUA 3RT7A 3CUSA 5TJ9A 4A27A 3RVNA 3GLUA 4MJLA 1QRSA 4ZRDA 4CKWB 2BH9A 1FQWA 5ITSA 4H7DA 1N33B 2F67A 1AMUA 1T3SA 2QJWA 1T8TA 2YJ6A 5LP6F 4MUYA 4WESB 3TINA 3FCCA 5A9SA 5CA1F 3GJ3A 1Y5NA 2Z5LA 2R44A 4V24A 1V8OA 4R83A 4RDXA 5KVSA 4JB8A 3T7AA 4ND7A 2WUVA 2PMWB 4Z6KA 3C6MA 3LBNA 2OZVA 2PBFA 3OEHD 4P2GA 4A15A 4EBBA 2Q1WA 1CQJB 4G5FA 3IV7A 4IOJA 5K0SA 4EKDA 2GNPA 1XRMA 4EYGA 5LMNB 2ZVDA 4Q1FA 3RLIA 2POQX 1PFQA 2WF9A 2DB5A 4RK6A 5BVHA 3RW9A 2OMEA 1VJ6A 2R6AA 2VUTA 1GKLA 2IDZA 2ZXEA 3CEMA 4RA9A 3RVPA 3WKCA 3UWOA 3RVSA 3ZHOA 3DE2X 3P0FA 5CNKA 5EZQA 3L8FA 4Q3NA 1AF7A 5AHXA 4BFYA 5EJEA 2YJZA 1WO8A 4Y0NA 4IL5A 2M9MA 2FR8C 2RGUA 3TOXA 5LMCA 1KIMA 3DMDA 4UREA 4KTTE 3PNQA 3VTAA 1OBVA 4A0SA 1UK9A 3JX9A 1HNNA 2H4ZA 2P9QA 3F8SA 5H1YA 3TD9A 5LA6F 3TNLA 1KNXA 1VLVA 3ZS8A 4PCAA 3FLEA 3J81A 3FI9A 2WZBA 1QH8B 1YOVA 4GZLA 2IUFA 2E9SA 1JEDA 4MP3A 4LHEA 5EJGA 3BVPA 1G21B 2DPMA 4ZTUB 1YDHA 4YJFA 1GPJA 1L8OA 1O96B 3TDMA 4BJ5A 2QBYA 1L8AA 3PA6A 5ALTA 2JK0A 2GB4A 1UBTS 1RZXA 3ZCSA 1IBRA 3A32A 3UV7A 4AMVA 3L7LA 3CNEA 5AVVA 1RLTA 3JARA 2BAGA 5IEBA 2XVZA 4DKJA 5C5IA 4R5HA 1FNSA 3DAOA 3C4JA 3TTWA 3D4OA 1J06A 1RKQA 2FW7A 4AJNA 3EDRA 4CIAA 2F3PA 3NC0C 4JT4A 2JLXA 2MWMA 1PSZA 3QO6A 3O8OB 2PGXA 4HAUA 3DJAA 2BTOA 3MJCA 1MGOA 2IHZA 4Z0HO 2WM9B 4NJMA 2O7NA 2AOTA 3VDRA 4GNRA 4MKFA 2C1XA 1D04A 2RI6A 5GMOA 5AVYA 1FNMA 2P41A 2H1CA 1BDMA 3H04A 4XJTA 3WLPA 4ZAZA 4Q2OA 4QASA 3VNBA 1ITZA 2KJPA 2HWKA 1T1RA 4D9BA 5FA5A 4F5WA 5KTTA 4GX0A 1TPYA 4HAIA 3I2KA 4D96A 2HA5A 1XQWA 4TT3D 3H4MA 1K7FB 3K50A 1W88B 4DTCA 1E0DA 3V2UA 2X23A 3SQDA 3ID2A 3OU0A 1T26A 2CL0X 5FADA 1ECFA 1GPNA 1NXWA 3E4CA 5IZ4A 5G0WA 1ATZA 4WK6A 5BSMA 2EQAA 5JJ5A 1XC7A 1JU9A 1WCWA 2M10A 5C5DA 1Z63A 3T9CA 2JKZA 1U2SA 2DBQA 2AFVA 1JKMA 1XI2A 1WABA 1Z13A 1SUEA 3K1JA 3PU6A 4I4TF 1OQAA 5IHXA 2M0VA 3IJPA 1ND5A 2XQFA 2HM7A 4BXOA 3KAKA 4PONA 4CJXA 5IVIA 5GTDA 1JW9B 3WYEA 3CH8A 2A2ZA 4RM3A 1WRBA 1PHRA 1GRNA 2VDMB 1P5HA 5DM60 4EJFA 2H3MA 2Q1SA 3X1YA 1D4ZA 3G2QA 3T1NA 1E6LA 4YRDA 3JATB 4KH0A 4M83A 3D3WB 1ZGHA 3H2HA 4LVNA 4CM8B 2ZVJA 3Q8KA 4I4LA 4NQRA 2C2MA 2CL5A 3QBVA 3RYFB 2Y8EA 4QHTA 4QU5A 3FETA 3WGZA 1ZGGA 3E9ZA 5KYKA 1DC4A 3S2SA 1CG6A 1UPBA 2R48A 4P5DA 4YNBA 2W6ID 5GLJA 3STTA 1WG8A 1SHKA 2XHZA 1NM5C 1YZQA 4EENA 1PW7A 2P90A 1VMDA 3JRXA 1COWA 4US1R 4XWWA 1TD1A 2BEVB 2UUAB 4EEZA 3MS7A 2X0JA 5JNVA 1TEVA 3F3MA 1UBNA 1NE2A 3RL8A 2R47A 2W6NA 3IJRA 5TQ0A 3N2GA 4N5DA 4DSAA 3T5TA 2YC2C 2D3TA 1U8ZA 1XTKA 5EE5B 5BQFA 1NDHA 1T9GS 3KT6A 1OREA 4RLQA 1ABEA 3UT5B 1E9AA 2X5XA 2JKYA 5C4GB 3WFIA 5BV0A 4UCXA 5K2MA 1HYQA 1CWUA 1JG2A 2MSCB 4MRVA 3E1GA 4TMTA 2EAQA 2V3CC 5IM5A 5I01A 1XVAA 1HQKA 2GN2A 1YZUA 2EAUA 2QGFA 2ZIEA 3DEHA 3KQTA 1X1BA 3HR4A 1UK8A 5F5XA 3CEPB 1RXEA 3M5CA 1PJ3A 4DWVA 3K71B 3EAQA 5EMKA 2A5FA 3AUTA 3B8HA 3GIDA 3NAGA 5D1NA 4RTRA 5J4YA 3K6SA 3VR3A 3QEBZ 2IU4A 4QO7A 1BC5A 3UC5A 5J47A 1EWKA 2EC5A 1BMDA 1T24A 3LC1O 4Q01A 4V3CA 1TE0A 3U61B 1TUGA 1IHJA 4N18A 4AS1A 4KE7A 4MQUA 3EXIA 1VSTA 4XQEA 5IG2A 5FRDA 4NU8X 4GH5A 1TKAA 2X58A 1JXQA 3ROEA 2BJWA 3C3CA 5FTNA 2WIDA 4XDZA 3OOHA 3TLZA 1PJSA 4RE6A 3SXUA 2AZDA 2EKQA 2OBFA 2XTJA 2ZYTX 4I2VA 1BYUA 5I4BA 1OI7A 3DDOA 3LLSA 4HB2A 2HXYA 2AG0A 4WZAA 4DB4A 2GCNA 2IIVA 2L18A 1SVOA 1ZM9A 3AHIA 3LVRE 1NQOA 1V5EA 2BHNA 2FSHA 1ECPA 3HUDA 2IWPA 3EY4A 4MRSA 4N8EA 3LPAA 4UHJA 2JVKA 5EY5B 1CP2A 2ZT6A 2AC2A 1Y34E 3I8OA 4MR9A 4RKWA 4LMAA 2PS9A 5KHAA 3T5PA 2ZSJA 2OC9A 3O5AA 4GLJA 4NF2A 4CIDA 1RYZA 7ADHA 1NF9A 1PCXA 5ABPA 2HY7A 1K98A 2ISCA 3G2HA 3WZMA 4C0WA 3CVJA 4GPAA 4LKRA 2ZZNA 1HFKA 4F4DA 2C04A 2P3QA 1G3RA 5JYEA 4IJ5A 1TVKA 2IEAA 1E1QD 1LRJA 4X0EA 4YO7A 2EFEB 5L6MB 5TIIA 2AT1A 2ZR0A 3ZX4A 3DBRA 1DQYA 1GSOA 5HETA 1SUIA 2IEIA 3WA6A 3O3CA 4HUJA 2VZLA 1S01A 3UMCA 1E9VA 5D00A 1JFFB 1SC4A 2QTBA 2Y1DA 3GY0A 3HA5A 3OY7A 5EMHA 5IYZF 3RS9A 2OBLA 3ES9A 5CCXA 3E7XA 1W5AA 5H4HA 2LDXA 3WC4A 1N4AA 4FGKA 3AOGA 5JSYA 4KR2A 2Y77A 3MUEA 3B52X 2QPAA 4J1QA 1NW5A 3NLLA 2OP1A 5BYKA 3ZWMA 1IC6A 1IONA 1V25A 4O02B 1P18A 1PP4A 5AUOB 1ECCA 5DTQA 3MTIA 2UYQA 5KDLA 3VDMA 4EI8A 2AN9A 2WJ6A 3JU3A 3P0RA 4N3GA 5AI8A 3TCXB 4CM8A 2QIOA 4R2KA 1RCUA 4C07A 1HC7A 1AQJA 3F71A 1KGSA 1CYDA 1Z06A 3GDFA 3EVEA 4YRGA 2QN7A 1UHPA 3IIEA 4MS4A 1FTYA 3VR5H 1EFPB 3RVRA 4DQVA 5CHEA 2QOEA 2QMOA 2OV1A 1I6KA 3E8SA 3OIDA 3PDUA 4MIYA 1PGOA 1ZD2P 4WOPA 1YZYA 3TW6A 3OX3A 2FEPA 5LU9A 4RTPA 2DAZA 1SXJD 1VDMA 2XMBA 3FGNA 3FZEA 4LZAA 3IUJA 1ZRSA 2COEA 4MUXA 1J22A 4WIAA 3HXOA 2R25B 4P86A 1H3EA 3NM6B 1XCLA 4QYIA 1ZMRA 4ZMRA 1JA0A 3MG9A 1EBBA 3FFTA 4PE5B 3B60A 4NJEA 1KP9A 2CV0A 2LE0A 2XE8A 5K0GA 2BGGA 2NYVA 2A0KA 4AXXA 3SIRA 1US8B 2IYVA 1EE9A 1HDIA 1KBZA 2B2NA 4OLAA 3QU9A 1G20E 1FK8A 4MW2A 3DTVD 4IVRA 5LKAA 1Z0IA 5D3MA 1F06A 5DGXA 2YXLA 4D56A 4V0KA 2HMAA 1W2WB 2ZEJA 3D4BA 3ZZMA 4BNYA 3GROA 3QRWA 4FDVA 5KZMB 3V2HA 1TJYA 4F8EA 1LVUA 3DGEC 1O97D 3ZOKA 4BNNA 3T3NA 1UFRA 1U2PA 3QVXA 1IEVA 2MT9A 5KNCD 1FNCA 3KBOA 1MVNA 1P3Y1 4JDPA 4ENUA 1ENZA 3VYUB 3FRHA 1Y37A 5F5LA 2EDZA 1SBNE 2HUNA 1HQYE 2AG1A 3HUFA 3LCRA 3V4FA 3CW9A 3O1IC 2P35A 3QX7A 4BE7B 5HQ3A 4WACA 1JBEA 3PXCX 1XP8A 1DO2A 5DHAA 4BAGA 5C2JB 2C57A 2DQZA 1DKOA 3W8RA 1F60A 1R18A 3B1VA 4L4YA 4B4KA 2VSQA 2G7ZA 1OW3B 2ZTSA 4AUMA 4DLPA 3C6XA 3QU2A 4EKYA 1UWLA 1NBWB 4YJFB 1C8VB 5HIIA 2DETA 1GGJA 2YNMA 3E61A 3HU5A 2F9MA 4I66A 2CK3A 2HQBA 1AMNA 4WZAE 2IOQA 1T36A 1HDCA 2VYVD 4CN8A 4EX6A 2JI8A 5LD2B 3Q6IA 1DCKA 1H5UA 5K8LA 4BBAA 2Q1XA 1HBJA 1T4BA 1A27A 4RFVA 2RHGB 1OFUA 3HN6A 5SZHB 2ORYA 1U8YA 1PJAA 4TWRA 5LWHA 1BJTA 1M75A 3ONDA 2WYIA 4OHWA 4Z1MA 3BL6A 3TECE 3Q41A 4DJJA 2RBKA 2WU3A 1Q95A 1DFIA 6YASA 2VNJA 1IG0A 2FMIA 4ZT4A 2JFBA 1R5JA 2QTGA 3DQPA 4EI7A 4MI3A 3U7HB 1R0BA 5T57A 1D7AA 4H7IA 3VUFA 5LP6B 2YWCA 1JG7A 3EYAA 1SOMA 5THQA 1N2BA 1N7EA 2GWHA 3A4MA 3BM5A 3AVTA 1IBCA 3I92A 4HDRA 4JEIA 2H5JA 1ZH4A 2AEJA 5CM9C 2Q2VA 2D2FA 2CLCX 4M53A 4RZ3A 5J5CA 3L2OB 3WK9A 1KWGA 2D62A 1U98A 3A9WA 2WIAA 1VG1A 4NXPA 1YTLA 3QKIA 4JJIA 2EQBA 5JOQA 1WCV1 2B20A 2JIQA 3DOFA 4I5GA 3AUXA 4QKQA 2V0CA 4O4LF 5F9HA 5E9AA 1SVSA 4I3FA 2GPNA 1L4YA 2ZDGA 4H31A 2XLCA 3N2KA 4OHOA 4BNDA 4UCQA 3VPAA 2H08A 3LRXA 4AYTA 1Z16A 1USIA 1DKMA 4KQEA 4LTDA 5I7ZA 4RPLA 4B3JA 1LC3A 3ME5A 5A5GA 2H4XA 3AGPA 1B00A 4Y1FA 3E3MA 5J4KA 4XD2A 5IBCA 4AVYA 4WI1A 1GJRA 1T0HB 4I0WB 1J0EA 5DTIA 1DV2A 3DHNA 3W8DA 2HA6A 4AJKA 2MX6A 3CUKA 4Y2HA 3IVRA 4XPZA 2OORA 1JAHA 1NAHA 2SECE 2R85A 3BMXA 2V7WA 3JQ8A 5JPDA 1O6CA 3E22A 1S96A 2G1AA 1WZCA 1ZNYA 2BUCA 1BCSA 2WIGA 3ZKWB 1KYZA 1WH1A 3RAPR 1OTHA 4CF3A 3D4IA 3H1GA 1JIIA 4DSUA 2C31A 3UO8B 3HY6A 1KU6A 1C1HA 2CUZA 3B1JA 3KQHA 3RG8A 4OH7A 1LUAA 2ZBGA 4G8JA 1KSFX 2YFHA 3BE8A 5AKXA 3P32A 5I7UA 1JJAA 1S02A 3TGWA 3BKWA 2YVUA 3ETJA 1M2EA 2PPLA 3EGIA 2ZI6A 2ZKLA 2HV9A 1WIWA 1OLUB 3TQSA 5C7IO 4GC5A 3P97A 4LJYA 1OXSC 3A6EA 4RH0A 3LZDA 4WOBA 1XP5A 1V95A 1MC4A 5LQMA 1HDGO 4U7JA 1SH7A 3QTTA 2VPXA 1P75A 4O4HB 4LGYA 4DRXA 4ENPA 5KC8A 2HQ1A 3I0ZA 4GWGA 2VZ9A 4ZU1X 2HRBA 3OHSX 3HPRA 3GIWA 3RUDA 1FNNA