2H1IA

Crystal structure of the bacillus cereus carboxylesterase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
TENLYFQSNAMMKHVFQKGKDTSKPVLLLLHGTGGNELDLLPLAEIVDSEASVLSVRGNVLENGMPRFFRRLAEGIFDEEDLIFRTKELNEFLDEAAKEYKFDRNNIVAIGYSNGANIAASLLFHYENALKGAVLHHPMVPRRGMQLANLAGKSVFIAAGTNDPICSSAESEELKVLLENANANVTMHWENRGHQLTMGEVEKAKEWYDKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxylesterase
publication title Crystal Structure of the Bacillus cereus Carboxylesterase
rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 67
structure length 212
sequence length 212
chains with identical sequence B, C
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h1iA00
5LZ8A 4X6YA 2FUKA 2PU5A 4CIAA 1AKNA 3PF8A 4FBLA 5AI9A 3IUNA 1UOQA 4IHAA 4F5ZA 1AX9A 5EIEA 3F8SA 1CFJA 1QIKA 1GQRA 4OYYA 3G0IA 4J0CA 3D5EA 4L9AA 2WFZA 3BWXA 5HFAA 5ALXA 1OXMA 4CFSA 5F4ZA 1CUDA 1R88A 3WL8A 4M0FA 4QLOA 3TRDA 3VJKA 5AM3A 3RK4A 6YASA 4HTAA 5IVDA 1ZGBA 3OPMA 1W52X 3BIXA 1ZD4A 3I2IA 7YASA 1QTIA 5FPQA 1FFCA 2QXTA 1MT3A 1XZFA 1GKKA 1QO7A 1CEXA 2Z8XA 3DQZA 5JATA 1YB7A 2RHTA 5BWCA 1XZKA 5HK8A 5DNWA 4UUQA 1U8EA 1EDEA 2RONA 4AQDA 2WIDA 2ZSIA 2V96A 3BDVA 5AI5A 2WILA 2G4LA 1JMKC 2DQZA 4DTCA 3ZV7A 3F96A 1P0PA 1H2XA 2FJPA 3AJAA 1DQYA 2V98A 3C6BA 3FYTA 2B61A 3D7RA 3G9TA 1KU0A 5EIAA 5AIAA 3MVEA 1ODTC 4BVKA 3F98A 3ANTA 5AHXA 2EDAA 1QIMA 3HSSA 1T2NA 4I19A 4GI1A 4K2AA 5A2GA 3R0VA 4X6UA 2V97A 3I2FA 1X70A 5ALNA 4H7EA 2VEOA 1UK9A 5FKJA 3CN9A 2CBGA 4CCWA 1RYYA 3G0GA 2PVSA 1K5PA 1ZGCA 3GFFA 4B82A 1IZ7A 5LKRA 1QIJA 4X85A 2JEZA 3I6ZA 4AMZA 5DTIA 4G4JA 1J06A 5FOQA 1DX4A 4H7JA 1MAHA 3D0KA 2PX6A 1QFMA 5K3AA 2H7CA 1EK2A 2ZYSA 1BRTA 2D0DA 2WJ4A 4PSCA 4X95A 4KAFA 5FXMA 5CURA 3G9ZA 2WFLB 4BBZA 1WPXA 2GYUA 2XUKA 2HU5A 1GPLA 5SYMA 4QDZA 1SCKA 1FJ2A 2XB6A 4HXEB 1DWPA 1DWOA 4XWGA 4YK7A 1UFOA 1ZI6A 2AXEA 2WG1A 1XZLA 1EDBA 3I6MA 5DWDA 5AKKA 1JU4A 1M33A 1MNAA 5AKJA 4F60A 2ACKA 3PI6A 4FNGA 4DGQA 1HDEA 2XMBA 1CQZA 1A7UA 3AZOA 5HCUA 5LZ2A 4JNCA 2PSEA 1A8QA 1CV2A 2XDWA 4LHEA 2V9ZA 5AK4A 4B84A 4A16A 4KE8A 1XKTA 5AI8A 4DNOA 4KRYA 1BN6A 4M0EA 4JEIA 3DOHA 3WWEA 1AQLA 3FCYA 2WU4A 4KEAA 4IH4A 1QLWA 2O2IA 3WK5A 2VJCA 1IUOA 3HZOA 2IX9A 1Z68A 2XLCA 4FDMA 3WQHA 2OCKA 2Y6UA 4I4CA 3GELA 1VKHA 1B6GA 2B4KA 4UFOA 1WB4A 2HADA 2HA5A 4QDUA 2JF0A 4G9EA 3F9CA 2QUBA 4LXHA 4WCVA 3B12A 4KE9A 3WWDA 3FVRA 3WK7A 2WHQA 1ACJA 3KWFA 1SCQA 3WYDA 5K5EA 4G8CA 4UHHA 5CT5A 3CN7A 5EHQA 5JAOA 2X8BA 1TCCA 3QYJA 4J3JA 3WI7A 3ZLUA 3D59A 3A70A 2Y2VA 5A7GA 4DNFA 5HZGA 2DFPA 3B5EA 4MXDA 1Y37A 4DMKA 2DQYA 2XQJA 1LPNA 4GWLA 5A7FA 3M3DA 1XZBA 3QZUA 1QE3A 3G0CA 2RGUA 1MPXA 4LYDA 3OM8A 4W9RA 2ZYRA 4EY4A 1AZWA 1HL7A 2QXUA 1ODCA 2ZJ6A 5K3FB 1A8SA 4S0XA 1LPPA 3EQ8A 4O08A 5BWBA 5IVHA 4H7IA 4Q3LA 4Q82A 5AK3A 5ALUA 4B9AA 2CEKA 4J0HA 4GW3A 2XQIA 1X2EA 2WIGA 3O9MA 1CUZA 2YH2A 4X3CA 1SFRA 4CG3A 2XUDA 1CR6A 2WIKA 4BAUA 5E2IA 1DWQA 3ZI7A 1LLFA 4WY8A 3ESBA 4Y2QA 4DMCA 1P0MA 3I2JA 5DYTA 4C88A 1VOTA 2XUFA 2QTBA 4H18A 3D2AA 2HA6A 3I1YA 2ZYIA 3DKRA 2OXEA 1GGVA 1EI9A 3A2MA 3DYVA 2I03A 1QIGA 4W1PA 2PU7A 2YXPX 5AOCA 4ZREA 2XI4A 3STXA 1I6WA 4WJLA 1IUNA 1EX9A 2PKYX 4KAAA 2QJWA 3M81A 3QMVA 1LZKA 3UMJA 4INZA 4B80A 1EVQA 1UXOA 1PJAA 4GDMA 3C6ZA 4X91A 3WWCA 2R8BA 3WKCA 1EVEA 4FLFA 1ORWA 4BAGA 3DYIA 3BDIA 4UBMA 2CJPA 3BF7A 4LIPD 2W22A 3W04A 2I3ZA 1KEZA 2WM2A 4FOLA 1AMNA 3IULA 1R3DA 3H19A 1CVLA 2JGMA 3FWHA 1MAAA 1FFBA 5AM2A 3AILA 1XZDA 3C8DA 4UPDA 1R9NA 4HVTA 4Q3KA 4WFJA 4C4XA 3LIIA 3U0VA 3Q0TA 5AKXA 5ALJA 3WL7A 5K3FA 5HF5A 2H7XA 4MQMA 3IDAA 2OGTA 2G5TA 5JIBA 3SWWA 1MN6A 2WG2A 5AI4A 4B9EA 5CMLA 5AK6A 3GBSA 3H0CA 4PSDA 4DNQA 3ZWQA 4OB6A 4D9JA 5T4EA 4BP9A 4BVJA 1NU6A 3FAKA 3I2KA 2HFJA 1R50A 5LLSA 2XMGA 1MX5A 4P92A 4HXGA 1SOMA 1XRMA 4KE7A 4B0OA 2ZSHA 5ALLA 1YA8A 5J3JA 1THGA 2X76A 5FV4A 2PSHA 2CZQA 2I3DA 3N2ZB 5AM5A 5I7UA 1VA4A 4GHWA 2DHCA 3H04A 1ODSA 1G42A 4GXNA 4XIIA 3G9UA 4K6GA 5YASA 1JFRA 1P0QA 3O4IA 4E46A 3HJUA 4Y9SA 2JGKA 2OGZA 4LXIA 3ILSA 1U65A 4J0IA 1BROA 3JYHA 5JAHA 3HRHA 3QITA 1ZI9A 3STYA 3I28A 4AB1A 5JARA 4OUKX 1VE7A 4CCYB 1XZEA 1S8OA 2WIJA 4G8DA 3UUEA 4AXBA 3KSRA 3BJRA 2HU8A 3SK0A 4IH1A 3PUIA 2WUGA 1TAHA 5ALZA 3SC2A 3HI4A 2GBIA 2G5PA 1W6RA 2WFLA 3G0DA 5ALFA 3LIPA 2QJRA 1ZOIA 4BCDA 1FFDA 1F8UA 4G1FA 5AICA 3MUOA 4DSAA 2Z3ZA 3H18A 2AJBA 4UBJA 4B83A 4DM7A 3WK8A 3E3AA 4YASA 1DQZA 4GECA 3PFBA 2GBFA 4U2EA 1LBTA 4BZZA 3N0TA 4NVRA 5KBYA 3EQ9A 2WUDA 1ISPA 4U2CA 2HFKA 4CCYA 2O2HA 5BV7A 3CCBA 4H0CA 2WSLA 1XRPA 1PV1A 3A2LA 2QR5A 5JADA 5JAUA 4YX9A 2BAGA 2JGEA 4MYDA 4UHDA 1CRLA 3TGLA 3W2TA 3VVLA 4BVLA 1GQSA 3KXPA 4E15A 2XUIA 4CG2A 1XZJA 3CXUA 3R3YA 4HRXA 5CT9A 4QDTA 2J4FA 1YS2X 5JAPA 3O95A 4WDRA 4ARBA 2UZ0A 3OC0A 4ZXFA 4Y7DA 2HA0A 3EF3A 2ZJ7A 3ZLTA 4L3WA 5ESRA 1EXWA 4BTLA 2XMRA 2WKWA 2EEPA 2XT0A 2RAUA 2JIDA 3C70A 5CT4A 1GPKA 4QE3A 3O4JA 3BF8A 4C6HA 5E4TA 1TCBA 2W6CX 5CH8A 4AN1A 1O6GA 2OPHA 4H7KA 5LZ7A 2ZJFA 4FBMA 1CUBA 4E11A 5DYYA 2C7BA 5AP9A 5HF6A 4ZRDA 3FYUC 2WIFA 1UK6A 4PF1A 4X97A 4FFWA 2WG0A 4A23A 3IB3A 4M0MA 2DSNA 3F67A 4J0JA 1R9MA 2XMQA 1UZAA 4Y2SA 2PSDA 4B0PA 5LZ4A 2PBLA 5C8XA 4B85A 4DLNA 4AZ0A 4DNPA 3G7NA 2GZSA 2QZPA 5H3HA 4HS9A 3ED1A 3V1LA 5AM0A 3STUA 3W05A 3PF9A 1THTA 4K5QA 2CKMA 4BZWA 4Q3OA 3E1GA 5IKXA 3H17A 1HKHA 2Y2UA 1GPNA 2HA4A 1CUSA 5HQ3B 2JGJA 5LYYA 2HHAA 1K8QA 4J0KA 1H2ZA 4QDOA 2ROQA 5CTAA 2OG1A 1K6EA 3DL4A 3PUHA 2WUEA 1CUWA 4H7HA 4X90A 3H2JA 5HK9A 4HZGA 4UHBA 1E8NA 4OB8A 4AO6A 1VLQA 4AZ3A 3VVMA 2B20A 5AOBA 3WKDA 3S2ZA 3O9VA 5FDFA 1RP1A 2XQFA 1J2EA 1CUYA 1R1DA 2PUJA 1CQWA 2XUOA 5DTJA 5I9IA 4CI9A 3LS2A 4BATA 3K6KA 5ALYA 4MYSA 2IIVA 1CUFA 4W1RA 2XUQA 3IVMA 4NMWA 5LKAA 3HACA 5T4FA 3GA7A 4HXFB 1CIJA 3W9BA 3K9BA 2C5FA 3HLKA 4BE9A 2GBCA 4U2BA 1QIDA 5HQ3A 1BS9A 5K3EA 1W1IA 1YS1X 5C8VA 1CUHA 1EB9A 1J1IA 3FNBA 1IUPA 3VDXA 4EY8A 4J0GA 2BGRA 2XE4A 4K6KA 2OCIA 5AKIA 1HLGA 3C87A 4ZV7A 2C58A 3T4UA 4G8BA 4GBGA 4JH0A 4H7DA 3QH4A 2VA9A 2HU7A 1SC9A 1XQWA 1JJBA 5JZSA 3FLBA 4UBOA 2XQKA 5EI5A 4RGYA 4GEGA 1XROA 5AI0A 1UKBA 1SCIA 2JBWA 2QOEA 4BCBA 4LKOA 5JD4A 4PV7A 1J07A 3H1BA 1LNSA 4WFIA 4X6XA 2RIPA 3WA7A 5AKYA 4HRYA 1A8UA 1DT5A 2VAVA 3W9UA 1ZJ5A 1BE0A 4NS4A 4MWSA 3WZLA 1BU8A 4C01A 4EY6A 2VT7A 1IMJA 5ALMA 1ZIYA 3AINA 3S8YA 1L7RA 1WM1A 2E3JA 3C5WP 2BUBA 4BTVA 2PPLA 3DL7A 1JMYA 1E8DA 1JJIA 5ALDA 4EZIA 3R3WA 1EHYA 3TEJA 4P9NA 3JWEA 1XQXA 3WK4A 1VXOA 4B6GA 4PNZA 4F0JA 1VZ3A 4QZVA 2OGSA 5AM1A 1XZAA 4EA6A 1X2BA 3V1NA 3IUMA 3V9AA 5KWIA 1LPAB 2AJLI 1O6FA 4BYMA 2HRQA 3FYUA 2OQIA 2YASA 3A2NA 3H1AA 3X3HA 5DNUA 3QPDA 2HIHA 1YAJA 2VSQA 4W63A 2JGFA 4JYMA 4OU5A 2AJCA 1ZD5A 3AZPA 4C89A 4FHZA 5CRIA 5ALPA 5K3CA 4OPMA 3I2HA 2VJDA 2XMDA 1Q84A 4DYHA 3SX4A 5EGNA 2AJDA 4QNNA 4AN0A 1MX9A 1XFDA 4BRSA 2JGIA 2BUCA 3M83A 2ORYA 3IUJA 5D3KA 3ICWA 1F0NA 4KYVA 4Q05A 4X93A 1UK8A 5D3ZA 5IH7A 3PE6A 3WIOA 4KAJA 1WOMA 2GZRA 1P0IA 3O4GA 1JT2A 5ALKA 4Q34A 4B81A 2DCMA 3DCNA 3YASA 3G9XA 4EBBA 1LZLA 2GBGA 1FFAA 3QBJA 1E89A 4NZZA 4FKBA 4XJVA 4ZGBA 3VJLA 2GYWA 5AKHA 5IVIA 3LLCA 2LIPA 4EUSA 5ALRA 1WB6A 4IO0A 5A62A 4ROTA 2OLEA 1K4YA 4LXGA 5EIHA 3QPAA 1C7JA 1U4NA 1MNQA 1VE6A 5FP0A 4OB7A 1H23A 3ANSA 4J0DA 2VAXA 4QWMA 4F21A 1JU3A 2CMFA 3VISA 1CUXA 5ALHA 1YASA 4ARAA 1YSCA 2VJAA 3DNMA 3AIKA 5CXXA 5CT8A 2K2QB 1EA5A 3FSGA 4CIBA 4AX4A 3NOXA 5HFNA 2BCEA 4MEBA 4OYLA 4BC1A 5FPPA 1CUIA 2BGNA 1R4ZA 4TPKA 4BAZA 1CUJA 1W75A 1AGYA 3DLTA 2RI6A 2XMSA 1GZ7A 1UOOA 5C7YA 1GT6A 1CUAA 1DINA 3L1HA 5I8PA 3STWA 1MO2A 2VT6A 4G4GA 4XVCA 4YPVA 5JANA 3C45A 1CUCA 1BCSA 1W4LA 1EINA 1HBJA 2WFMA 2C4HA 3WJ1A 1Y7HA 1CUGA 3DEAA 1H2YA 3ESCA 3WJ2A 3HABA 1L7QA 3DD5A 2FX5A 3WL6A 1TIBA 4GLBA 3KD2A 3V1KA 1DT3A 3UUFA 5KREA 3H2IA 4JUIA 4AO8A 1XRNA 1H2WA 2HA2A 5JASA 1G4HA 3H2KA 1WB5A 3O0DA 5CT6A 4OCZA 3C8HA 2NW6A 4G5XA 3C6XA 4EY7A 2Y1KA 4QLAA 3WA6A 1F6WA 4OU4A 3V48A 5ALIA 1IZ8A 4W1QA 4FWBA 3LP5A 1Y7IA 2ZYHA 2H7YA 2O7VA 4DMFA 4PO3X 4I3FA 2I78A 2WHPB 5DYWA 3R40A 5AIBA 1N8SA 2DHDA 3WLAA 4HAIA 2XUPA 1WCYA 3P2MA 4BP8A 3WKEA 1HQDA 2ECFA 4UFNA 4BCCA 4ETWA 4XX1A 3GROA 1FFEA 4C4YA 3WL5A 4P08A 4PQEA 4U2DA 3C6YA 1CPYA 1EB8A 1JJFA 2Z5GA 3AFIA 1TRHA 5CXUA 1QTRA 5CH3A 2QT9A 3PFCA 5FLKA 2XUAA 3WWOA 1TK3A 3C5VA 3O4HA 1QZ3A 4B7ZA 1NX9A 1T4MA 2O2GA 5HKAA 1MJ5A 5JD6A 2J3DA 2OQVA 2WJ6A 4G4IA 4KE6A 1LPOA 4X94A 3ZPXA 1QIEA 4X92A 1XRLA 2O7RA 3FCXA 5ALTA 2WTMA 5AK5A 4J03A 4V2IA 2QRUA 5AJHA 5FUMA 3FLEA 4EY5A 1ETHA 4FFVA 3STVA 2OCGA 4ZWNA 1DX6A 4QWWA 4EHBA 1VXRA 2ES4A 2PM8A 5A71A 3U1TA 1CUEA 4PSUA 4WY5A 2QVBA 4RE5A 1C4XA 3I1IA 5LZ5A 4EB0A 2Y6VA 1XLWA 2C5GA 5CH5A 4DMHA 3DJYA 3PICA 2QUAA 4UHFA 2XMZA 2IITA 2CB9A 1LPMA 5JZ9A 1FSSA 2P8SA 1ZICA 1E3QA 1ZD3A 4JYPA 3WKBA 1YCDA 3H2HA 3WKAA 3OURA 2ACEA 3OG9A 4UBIA 2QS9A 5ALVA 3I2GA 1KU6A 5AKEA 3WK6A 2VJBA 5DLPA 1DU4A 2OAEA 1VJ5A 1EK1A 4N8EA 1XZHA 3HEAA 4Y2TA 5AI6A 4FNMA 5ALEA 1YR2A 4A5SA 1WHSA 2Q0XA 2AJ8A 5AO9A 3QPCA 4UBLA 3JW8A 1F0PA 4LYEA 1QIIA 4KRXA 1Q0ZA 3RM3A 5SYNA 1QGED 1QONA 3I6YA 1EH5A 3R3ZA 1MTZA 1TCAA 4IQ4A 1UKCA 2FJ0A 1HPLA 3AZQA 4ZI5A 1W76A 1XZCA 4CG1A 4FLEA 1XKLA 1LGYA 4OD0A 1YA4A 5HF8A 1D07A 2WTNA 3R3VA 3G0BA 1XQYA 3CCCA 1CUUA 1JI3A 3D4LA 4ITVA 5D7BA 2J4CA 3AIOA 5JYCA 2HL6A 3ZLVA 1XZIA 1QO9A 1XZGA 3IURA 5ISMA 4AMYA 1XLUA 2XUGA 2WHRA 1YB6A 1UK7A 4E14A 5DNVA 1UWCA 4H35A 5JZBA 1TKRA 3QVMA 5AM4A 2R11A 2BKLA 1BCRA 3BJMA 2YYSA 4Y2PA 3EBLA 2XMCA 2ONCA 2WLSA 3M82A 3ESDA 4IH9A 1EDDA 2PSJA 4DIUA 1UOPA 3B3QA 2QKYA 1OILA 1C7IA 5K3BA 2G63A 4U2GA 3RARA 2BJHA 4RE6A 1LPSA 3W06A 1ZD2P 2D5LA 4Y2JA 3RKSA 1L7AA 3H2GA 3MGAA 5JD5A 1BEEA 1G66A 1WHTA 3VKFA 4BDTA 1QIHA 2WUFA 3BXPA 3QM1A 1XRQA 2EDCA 3DKKA 3T52A 3NGMA 2DHEA 4BC0A 2DR0A 2X5XA 3DS8A 4KJXA 3AIMA 3BIWA 4MQLA 5C81A 5HF9A 2XQGA 1VA5A 4Y2UA 1AC5A 5AKGA 4N8SA 1QOZA 2VF2A 3E4DA 4TVKA 2HA7A 4QEKA 2VQ6A 2PL5A 2QM0A 2WQZA 4L0CA 4UBNA 5AKZA 3OTQA 3WMRA 3WYNA 5CBKA 1MU0A 3GUUA 3WZMA 1B41A 2C0PA 4BRZA 4N5HX 5EFZA 5LZ9A 3K2IA 3D2CA 4KACA 1ZIXA 1JKMA 1QIFA 1XZMA 2Z8ZA 5D6OA 5AH0A 1LPBB 4K6HA 1N1MA 4FMPA 1UKAA 4BDSA 1AURA 3FSGD 5DJ5A 5CW2A 5T4BA 1PFQA 2OAGA 3MUNA 5LP1A 3VXKA 1YAHA 4C87A 2WHPA 3ESAA 4W1SA 2XLBA 3TJMA 3GZJA 3EIOA 5K3DA 3LCRA 5KWJA 3FBWA 4J7AA 4MWTA 3A6ZA 4H77A 5E4YA 2PUHA 2VTVA 2WU3A 3IIIA 2CUTA 3FLAA 3NWOA 1Q0RA 3QMWA 2XUHA 4OSEA 4U2FA 4WDQA 4BB0A 3R3XA 4UBKA 2GYVA 4X7BA 1XLVA 3BE8A 5HKBA 3Q8WA 2HDWA 3F97A 4WFKA 3QMMA 5EHZA 2JGLA 3VJMA 4UFPA 1ZJ4A 5ALSA 1VZ2A 1K63A 1N5MA 1E66A 1ZI8A 3WIBA 4Z49A 2WJ3A 4UHCA 3R3UA 4QA9A 4Y2VA 5A7HA 4AO7A 1E5TA 4UHEA 2H1IA 4PW0A 3RLIA 5BOVA 5E4JA 1U2EA 1GKLA 1H22A 4FLMA 2J3QA 4ZV9A 2BFNA 1IVYA 2B9VA 2BUAA 2C0QA 3KOOA 1CLEA 2HRRA 1N5RA 1NU8A 5LIPA 4MJ3A 1G5FA 2H9YA 1USWA 4X00A 3BL8A 3FOBA 5AOAA 4DSZA 1ACLA 4Q1VA 3L1IA 3ICVA 3KDAA 4G9GA 1UT6A 4TGLA 5ALWA 1DTEA 3AUKA 4Y2YA 1ORVA 5A6VA 3C43A 3OOSA 3HC7A 1OCEA 2VATA 1A88A 3WWPA 3FYUB 4Y2XA 5JALA 2HM7A 3KWJA 3D3NA 3DDUA 2OCLA 5AKLA 2PSFA 3R41A 3PDCA 1GXSA 5EHXA 2RHWA 3G8YA 4P93A 4RNCA 1Q83A 4QDXA 2XUJA 3IUQA 1AUOA 5ALOA 4RPCA 2QMQA 3V1MA 5ALQA 4L72A 3NUZA 1MX1A 5EHNA 1QJ4A 3WK9A 4MEAA 1XQVA 2JEYA 2ZVDA 1CUVA 1XRRA 3HXKA 1TQHA 5C8ZA 4KR0A 1QFSA 2HA3A 3L1JA 4H7FA 3D2BA 4X71A 4N5IX 4FTWA 3STTA 5IVKA 4C4ZA 4Y2RA 3IA2A 1LBSA 3DOIA 3HYSA 3IBTA 3EQ7A 1RWQA 3G02A 2Z3WA 5ALGA 5T4HA 3E0XA 1BN7A 1BEZA 4BE4A 4N8DA 1E8MA 5FRDA 1WPRA 3FVTA
chains in the Genus database with same CATH superfamily
4UEOA 4XB2A 1ZRMA 1RPTA 4CIAA 1SBTA 4RTKA 3HXPA 3SFZA 3COSA 1BJKA 2DUJA 1V43A 4L4SA 2G1UA 4AZ0B 5CLLA 4P4UA 3IAS1 1IPFA 4GZLA 4IHAA 1AV7A 4HH4A 1GWNA 2CLLB 3F8SA 1QIKA 4OIMA 4ZEWA 3KTAB 4D0SA 3VU3A 5MN5A 1GQRA 3EEQA 1OBVA 2C4VA 1AT1A 5L3RA 1I51A 1KK3A 3JQDA 3RVJA 3D5EA 2N3ZA 2GA9A 3C3CA 3FMGA 5BUQA 3VSDA 4I55F 4GE3A 5F98A 1N7JA 1HG0A 4OJQA 1N2CA 3BWXA 1TKBA 2LGJA 1OXMA 2Q3JA 4WCDA 5H3LA 3DUFA 4ZCTA 2C2OA 2D62A 5F4ZA 3PVSA 1CUDA 3CA8A 2PMWB 3WL8A 4L57A 4CFSA 1PWXA 4LTDA 3HNOA 3N2KB 3QW4B 3KUDA 4GXRA 3GUYA 1M34E 1WXGA 2PTHA 1NIJA 1QC5A 3GFTA 3L0OA 4GPD1 1U8FO 3MLBA 4XTCS 4G1BA 3REOA 3VJKA 2EJBA 2LKCA 1JNYA 4UM9D 3ZHTA 5AM3A 3ACCA 2XECA 4HTAA 3WAKA 4DIKA 4UE6A 4OHZA 3OTGA 2D1RA 2QRJA 1LX6A 4Z4GA 2HF9A 3L2OB 2BF4A 5AHOA 2QN6A 4E6EA 1UIMA 1K06A 2IEYA 3Q7IA 4LGVA 2HNAA 5E3IA 3PWTA 4DDWA 3OPMA 3ECAA 1VRWA 5IAAA 5CCEA 1ZD4A 2QX7A 3FDFA 1SR8A 3DF9A 4KKXB 1FXWA 2REXB 4G1CA 3N0WA 1ULZA 3FNQA 3H5AA 2YVQA 4D0NA 1BWPA 2QTCA 3GDWA 1R0XA 3OKFA 1G20A 1JIIA 2BI8A 2QRPA 4WH0A 1YZKA 2PL1A 2GAJA 4WZZA 1GXSB 1GZDA 4ZK2A 5LLTA 2O7QA 4ZU3A 4O8CA 5FPQA 2I91A 1EXDA 4IX9A 4KI0A 3VHXB 2CV0A 2O8DA 3K73O 5CVJA 3RSZA 1GKKA 1IY8A 3PIRA 2W8BA 3KQTA 1SZPA 5KKAA 3TGPA 1JVSA 2FOLA 1QO7A 3KKMA 4DLLA 3MT0A 1LI5A 1UMDB 1CEXA 3DQZA 3SYMA 4LZNA 4Q24A 1RQLA 3DBVO 2C03A 4DBLC 3AV3A 1ZVJA 4NYMQ 3LXRA 3TKYA 3RC7A 1A9XB 1F8YA 2P1RA 4Q47A 3ZS8A 1T9GS 1DG1G 1JIJA 1H4VB 2W71A 3DWFA 5HK8A 3TQSA 2IE8A 5DNWA 1AOXA 1MOSA 2Q3LA 3HB0A 1XKQA 2CHQA 1GIAA 4LN1A 5CU7A 2WIDA 4E32A 3MPUA 4WN9B 2CDNA 2JRLA 5BSGA 1HXHA 1CB0A 3QUTA 4I14A 5LB4A 2V96A 3AEKB 4BLSA 3BDVA 3HCDA 3FTEA 3FOAA 5T3YA 5NULA 2Q4RA 2JIRA 2AKYA 5AI5A 3BRCA 1FUKA 4N7JA 2G4LA 1S01A 2XYPA 4MAFA 3GZ4A 1NFRA 2DTXA 4PYMA 4AICA 1CQIA 4J4TA 5HM6A 4PC7A 1JNXX 5BQ5A 5T64A 2IUUA 4A0SA 1RTTA 1Y6ZA 5CJ2A 4HZIA 4R3WA 5GONA 2JL1A 3SNHA 4TTTS 3H3JA 4QG3A 3T52A 4ENTA 5KTPA 1DQYA 2V98A 2XX3A 3C6BA 3FYTA 4Y6QA 5L8VA 1FUUA 4FONA 4M0UA 2OGUA 4A8TA 2GK4A 4RKEA 5JSYA 3OQHA 2C7QA 3RIXA 2VG8A 3D7RA 2FLVA 4XVRA 4TS1A 1KU0A 3HKBA 4PCVA 4YIKA 5AIAA 2WNSA 1ODTC 3U60B 3OAAA 3I5UA 4JQYA 4MW0A 5EAIA 4AS2A 4LHVA 5KTOA 3F98A 4PG4A 3ZCSA 3AFOA 5IXYA 1XN1A 2G3YA 2Y8EA 5DBHX 1H9BA 3L0SA 5EKUA 3GEBA 4AUEA 1YL6A 5K0TA 4FE7A 4JYBA 2QAGB 1XYYA 2YYYA 2EDAA 5DTMA 5A3VA 4AJ9A 2AE2A 1I7LA 1HETA 1QIMA 3QTTA 1UDRA 1Y8CA 1A4RA 5JC1A 4K2AA 2JHFA 2IA5A 1K86A 1R18A 2Q29A 2V97A 3IV7A 3QBEA 2DUMA 4RWZA 4GG1A 3TLCA 1X70A 4JQCA 5BQXA 1MC8A 2VPTA 2ZBRA 3OWHA 3NAZA 4H7EA 4QPPA 5M04A 2CLFB 3NHPA 1SK9A 2P9JA 4QQNA 1KQOA 2VZLA 2Q5IA 3CN9A 3HJAA 5ANRB 4IAOA 4KIWA 4X1KB 3GVPA 4CCWA 4ERNA 1T9DA 3G0GA 3VZDA 2CCGA 2IZZA 4CLOB 4UEJA 3R8FA 3GEDA 4PXSA 4B6QA 1QP7A 3GZNB 2ISQA 4B4UA 3B51X 2A5DA 1BQ3A 4RK5A 4OGKA 2PMKA 4B82A 2FMXA 1IZ7A 5ICFA 2NYAA 3K9FC 2JIOA 4IICA 2N1BA 1S6YA 1OWNA 3FPLA 2O8VA 2D5BA 1P4AA 5KTNA 1UOEA 5DTIA 4Q4HB 4DCGA 5FUWA 5F1KA 5AW7A 5ADHA 3FRHA 1ADBA 4PNPA 3O3CA 5HUHA 4O33A 3EJ6A 1R6DA 4JXJA 3ZY6A 4RTJA 4DCOA 3CYFA 1BRTA 2D0DA 1R27A 2V45A 2WJ4A 4PSCA 1FQOA 4Z4EA 3O38A 4X95A 1P73A 2P4UA 4NJMA 1GRCA 3M5DA 3QE3A 4KAFA 5G40A 3SOPA 1JFTA 2H31A 1J23A 4GX1A 1KZ7B 3VMMA 5FTJA 3RC9A 1J39A 3L49A 4EHNA 4ABTA 1L5YA 2X15A 4D42A 4FKZA 1OC2A 5GINE 1HDRA 1GDDA 2EZ9A 5L40A 2HZBA 2E4XA 2X41A 1AVTA 1DAFA 1GSAA 2GYUA 3NHYA 3Q7EA 4LYHA 3TPFA 2C8LA 3BB4A 4NOLA 1IN4A 4OIFA 5IN5A 1P5FA 4XQCA 2PJDA 3NCHA 2YBEA 2V4MA 3PS9A 5SYMA 4DF3A 4KDFA 5DPMA 2P8JA 1WZEA 4DR5B 1V71A 4LRSB 5DM0A 1FJ2A 3AI1A 1KC3A 1G3UA 3CNQS 2PKCA 3GRZA 2JD1A 4FYMA 4IYJA 4RJTA 5IZCA 2QV7A 1PE0A 3CF4A 3A1EA 3WSWA 2I7TA 3HKBB 3LECA 1XZLA 4KOAA 2ZROA 3AX6A 2HLNA 1NV8A 2G72A 2LDXA 3BD8A 5DWDA 3MRVA 2R4TA 2QZJA 3H3XA 4UXIA 2ZYAA 3FDZA 3NO4A 3M89A 3OCYA 1COZA 3PIDA 3SU8A 1L4HA 1YI8A 4OUDA 4Q9HA 2AF4C 2BBOA 2NU9A 2XCUA 1SUPA 1BD4A 3E05A 3PXCX 1SVKA 1TCUA 3QU5A 5GJCA 4EM6A 4TTJA 3WY9A 4DGQA 3KIPA 3QW2A 5AJTA 1N8KA 2H11A 1CQZA 1LJLA 2Q6VA 3U1VA 1AQIA 3W1EA 1GP2A 4P0PB 4LF5B 4WXMA 3U3ZA 3QGMA 3P9ZA 2NSYA 5HCUA 5KNDH 4JNCA 1ENPA 2IFTA 3G2KA 3WP0A 3U2QA 4BO5A 3GC6A 1B8OA 4F4JA 2PSEA 4YAFA 5CFMA 2XDWA 2XMPA 1NMEA 4BLQA 4XRGA 5FBLB 2V9ZA 3JASB 4MLPA 4B84A 4A16A 1VLHA 1US8A 1RIIA 3D0QA 2WF8A 4KE8A 2GETA 2VUUA 2WDPA 3ZDZB 4BOYA 1EBUA 2HO4A 3BB1A 4H3KB 4E31A 1PS0A 1OKKA 4IDQA 4RL6A 4F8EA 3QVXA 3QPBA 4BO3A 3EPLA 3OJLA 1YA6A 1PK7A 3VX3A 1AZSC 5IUNC 1MIOB 3WWEA 3OPXA 3QPUA 4D80A 3FCYA 4D74A 4F6CA 4JI7B 4B8ZA 4EHLA 5CM2Z 4QASA 1NVTA 1BHO1 4AZWA 2UYHA 4KQFA 5ESDA 4EB6B 2IX9A 5COQA 2VPXA 4FDMA 4YAOA 2Q3EA 4INAA 2O8BB 3AEUA 4GZ3A 2G0TA 1O77A 2C3PA 3K0AA 1DRVA 1E4YA 2WTXA 1XD8A 4OHMA 4CZ2A 5K0ZA 2UXBB 2B8TA 4EVSA 3PQ3A 3IDZA 6LDHA 3QFRA 2A1IA 2FW8A 2YWFA 3GELA 4PSAA 4Q1BA 3ZV5A 4IL5A 4RM2A 1MO6A 1PL8A 2MSLA 1BDHA 2BKUA 4QECA 3VU8A 3HBMA 2HA5A 4D9IA 4G9EA 4M0DA 4ZJZA 2YICA 1B0UA 1PWZA 2QUBA 3CLKA 2A0XA 3R4VA 1EDZA 2PIDA 3AK4A 3B12A 3F1KA 4MZDA 3N76A 4NNPA 1OFIA 4X45A 1CJKC 1I7NA 5CA1B 5CITA 3RVKA 1C8KA 3LSTA 4FNAA 4XWKA 1V5GA 2YC2C 5ERYA 4L7QA 2HGSA 1GARA 1JP7A 3CE9A 5ARDA 3TTSA 3AL2A 1ACJA 4QLBA 4YHHB 2RBKA 3P1JA 2I6FA 4LF4B 1OE0A 3EOAI 4LISA 3MWDA 4WIAA 1TYDE 3KHKA 2WU8A 1RWXA 5E2AA 5L3ZA 3AXTA 3K94A 1EP1B 3ROXA 4MVJI 2R751 4NYJR 5JH7F 3S2GA 1EXNA 1M83A 5KNBH 5AW5A 2Q41A 4DVGA 3N75A 5EHQA 3DULA 4DWWA 1CZOA 1ZQ9A 3RIMA 1F2UA 1WQ1R 1X7ZB 2ZTLA 2X8BA 4J90A 2BR3A 3L6UA 4QRIA 3ZCRA 2MYNA 1RYEA 4N01A 5FX2A 5KUTA 3WI7A 1VQ1A 3K8YA 1IG3A 1VKZA 4UMDA 2F48A 4WCFB 1G4AE 2BH9A 2R66A 4KO3S 4XQEA 3S28A 5KJFA 5KU1A 2JK0A 4IW3B 4D3YA 3B5EA 2DEUA 2Q1WA 1Y4UA 2MJLA 3CURA 3M2PA 1ZUHA 4K9SA 1OZHA 1P62B 2P77A 4DMKA 2QVYX 4LY6A 4UNIA 5HSGA 1LPNA 4S24A 2IXAA 1SVUA 3LMKA 3HA5A 4GWLA 5EJ8A 3RU9A 1Z5UA 1U98A 3GO4A 3LOQA 3NAQA 4I5EA 1VLMA 1IQPA 1ZA2A 4O0LA 1D1SA 3QTBA 1T2VA 2GAOA 3F5QA 4G89A 4V0RA 4DUPA 3HA2A 4RS3A 1FLAA 2ZYVX 1E60A 2ZTMA 2P78A 3FDZB 2QE6A 4MI9A 3HO8A 3QVLA 1HL7A 1Z36A 4KGZA 4LDJA 4W7SA 3VSBA 5AJYA 2YCLA 4QQKA 4I81A 3NONA 4IBOA 2I4MA 3EQ8A 1QHFA 4O08A 2JIQA 2AZTA 3ZKWB 3QWHA 1JQJC 2P1ZA 3M49A 3A6FA 2B94A 2GWRA 5F9HA 1N6KA 2CNWD 3WGQA 4B9AA 3WSVA 3SI7A 3W2IA 1YDWA 3TQFA 2H3EA 1QO0D 2E6UX 2H2WA 2WYVA 3COWA 3GP3A 4POAA 2C5LA 4ABYA 4F9TA 4EW2A 1J4AA 3G2QA 5JVDB 2EF1A 3MD0A 4XFJA 2CDCA 1CUZA 4CMIB 4DSUA 3QBVA 3HB5X 2SCUB 4Q7MB 3A6LA 4G1EB 3FAZA 3P9QA 4LJ5A 2WNIA 4U8GA 4CG3A 1JI0A 4UMFA 3O6VA 2WIKA 1RSZA 4ONEA 2RHMA 3L7OA 4BFLA 3ABOB 4BAUA 1AKVA 1OXXK 3BRWD 3K0BA 1LLFA 4U4AA 5K0SA 3IAXA 4AJ2A 1OU4A 1ZS9A 1N9KA 4DMCA 1P0MA 3NDIA 1U99A 5AXCA 1WP4A 4EKYA 1UBNA 2MYUA 3I2JA 4EDFA 1KJ8A 2PAAA 4N7MA 4YB8A 5D1NA 1XMOB 3MWEA 2J3LA 1KOLA 1QR6A 3L3BA 3PU6A 4D25A 5CDFA 2QTBA 2V6MA 3NT4A 4H18A 1PKXA 1P3DA 4KMSA 1MJGA 3ISVA 3T0FA 4RA6B 1CY7A 1Z0KA 3GD5A 4R3UC 3QSYA 1GVHA 3HCAA 4BLWA 4IJQA 2IY9A 3C3YA 5SY4A 1PT8A 1V8PA 4KH1A 5K8IA 3A2MA 5I45A 4X54A 2CYAA 5C3UA 1QIGA 4W1PA 2F8SA 1WDMA 3AQ4A 1K08A 5IF9A 4ATNA 5I4CA 1RLUA 3IIJA 2CZCA 3PQ2A 1OGJA 2YFQA 4K9PA 4KXFB 4NBTA 1G38A 3K70B 2M1ZA 2W6JA 1JLRA 2ZSUA 4JKIA 3P2YA 3UFXA 621PA 4O8ZA 2GN9A 3S8EA 4NDZA 1GYQA 5AESA 1G59A 1AO3A 3D8HA 2AR0A 2N47A 2NSDA 1XNJA 2BFBB 3HVUA 1PTJC 1NW6A 2FLKA 2I80A 3HCPA 4E5SA 5HRCA 2BHTA 4YRBA 2YWRA 3M81A 3NTVA 4A2CA 3O8DA 3T3DA 3QMVA 1W59A 3U80A 5IBQA 4EMUA 2VJOA 1UBGA 1LZKA 3DA8A 3OE7A 1U8TA 2AC2A 3CO0S 4OAPA 2Z98A 3O74A 2L2QA 5DM60 4D5EA 3T1HB 1XDUA 4I1RA 1P1CA 2WAOA 4KP7A 4YJ2F 2Y27A 3PRYA 2AG8A 4M49A 1GILA 5M3BA 4DLPA 3B82A 4NBRA 4ZVTA 3BWMA 4QBGB 1UJCA 3OCVA 4CV3A 4AC9A 3OZTA 1U3TA 3U6KA 1IBKB 3DQQA 2R8BA 3K1JA 1K92A 1EVEA 1QPGA 3RS4A 4FLFA 1LLCA 4WLOA 4CR7A 3ILVA 3NTOA 2CLDX 1M2FA 3BF7A 4UBMA 2FH5B 2C2XA 3VO1A 5F21A 4HWSA 1F2TA 1OIVA 3WGYA 1KEZA 3K5HA 2WM2A 1AMNA 2RGBA 1JH9A 2DFTA 2GXSA 1KEWA 2WJZB 3DC7A 3KR0A 3JSAA 1R0SA 3PDHA 2NT3A 3DCYA 4FVTA 4TM8A 3UW3A 2NU6B 1Y6QA 3IIEA 3AM4A 3H19A 4WK4B 4MP6A 3CEJA 1P1KA 2VWPA 1CVLA 2V7PA 4LF9B 3FSRA 2CVPA 2JGMA 5A9SA 3FWHA 2PIAA 1OY1A 2CJFA 3ZWCA 1XB2A 4HDSB 2FRDC 2WA2A 3VU9A 3R0XA 5AM2A 1ZNXA 3C8DA 3GLFE 2I76A 5E7IA 1U7DA 5U1PA 1I2ZA 3U3XA 4PC3A 1Y5RA 3A9TA 5LMCA 2OB2A 2JHCA 3L4SO 4MVJG 3DEFA 3H4VA 3OF2A 4NE7A 1MXFA 3ZK9A 1ITZA 3D81A 5L51A 3U0VA 3ZHOA 3FWKA 1WBBA 1NGSA 5ALJA 5IBRA 5K09A 1C0EA 2AQ8A 4PLTA 2RGWA 3RRNA 3GY0A 3AEXA 2GPWA 1A2QA 4ER6A 2UXCB 1NRXA 4XPIB 2HHHB 1JQ5A 2H7XA 1T3HA 5ICGA 4K0RA 2OZEA 4TV9A 1KAQA 2OGTA 2CXNA 4WPGA 3AR5A 4BKPA 5IJ9B 3U3DA 4HSEA 2WG2A 2R48A 2DT5A 3OVMA 1KS9A 1Z28A 3L0DA 1ZH8A 2XIQA 3QPVA 2OK8A 4FEAA 1JB1A 2VP2A 4KN6A 3HJCA 3BGIA 2WJAA 2W8BB 3GPIA 5CX1A 5FJJA 1YXMA 2PBRA 3O31A 3UK2A 2CCJA 5CMLA 5I47A 4WZBE 5B4UA 1J8VA 3HHEA 1FIUA 4ND3A 3ZWQA 1ML4A 2RB5A 1O89A 3KYDA 4OGLA 1M5TA 1Z8DA 2XB8A 5T4EA 4D9JA 2IBSA 1JVBA 2BV3A 4TL9A 1NU6A 4FWTA 3CVXA 2EYQA 2RC6A 2HFJA 3WHLA 3NBKA 1W0JD 2ZIEA 3BMQB 4BIIA 2IWHA 3C3JA 1O0SA 5LLSA 2XMGA 1MX5A 4X8MA 4F96A 4X20B 3WIEA 5JXHA 3IT0A 4B0OA 4UTOA 2TECE 1IL0A 2PNJA 4MVYA 3RV4A 4EGFA 4OKIA 2X2PA 3EQ2A 3ZE8A 5LVAA 1KYVA 2YN2A 3TX2A 2E5LB 2YW2A 3VR6H 4JK3A 4BU0A 4H17A 4ZZ3A 4KYTA 4R41A 1A5TA 4K3VA 3Q3IA 4TKZA 2I33A 2VSOA 1Y48E 5JYDA 1ZXBA 3K7EA 4V02A 2V4UA 3S27A 4QJ3A 5FWYA 1AS3A 4AI6A 4CYMA 2B4QA 4B3RB 2J6HA 2CZQA 2PL3A 2BRUC 4XLLA 1OFVA 1XWWA 3KVYA 4J94A 2OXIA 1HEYA 4HZUA 2C7PA 2BGWA 2Z2KA 5CYOA 1KY3A 4PLPA 3KD3A 3H99A 4XIIA 3HUFA 3T5PA 3VNRA 4CEJA 3H9GA 4N3AA 5B2EA 1NNUA 3G0HA 1I2MA 5JSKA 2IUYA 2H18A 3PA6A 1JFRA 2JVIA 3I12A 1B6RA 1FS6A 3GAFA 3O73A 3SOZA 1EHCA 4AG5A 5KJ6A 2ZJ0A 5TQ2B 2JGKA 3RJMA 3A4YA 3JZMA 1TTTA 3OJEA 1EP9A 4PX5A 4LXIA 2DX7A 4KYUA 3DXXA 2RHCA 1WPGA 2OZPA 2C20A 1ETUA 4G24A 1O0BA 4JJKA 5C51B 3RRFA 5CVDA 4UD6A 3DLPX 3IVXA 1ZIPA 4I1SA 3UMGA 3A28A 1NZDA 1SNYA 4N6NA 3RRJA 3STYA 4NMLA 1NPDA 2I65A 4BGEA 1BHSA 3VTZA 4S2UA 1N2XA 3O1IC 3HZHA 2C5BA 1K97A 1CRWG 4C7MA 2P3OA 5FR1A 1SUBA 2ZJOA 1QZUA 2F55A 2HLDD 4BQRA 4IKOA 4N7BA 3LCVB 4RETA 3P32A 4RPJA 2PKWA 4JLPA 2BMJA 3NEYA 3GGSA 2HMYB 2V6IA 5AVSA 3LQKA 5CLFA 1I4LD 3D8BA 2O8EA 3PUIA 1WY5A 1ZK3A 3GG2A 3IJRA 4FX5A 1VLVA 2AMLA 1NE7A 2B36A 5DHAA 5FBVB 3SC2A 2DETA 1YBMA 5FUYA 2GBIA 2ILTA 3TOCA 4A0GA 2FHPA 3CJRA 1GOTA 2JLSA 2GCOA 2Y0PA 1QJCA 1IAQA 2F43B 4RYLA 3OIGA 4JV5B 4X1IA 1GUDA 2A4KA 1ISFA 1BU5A 3NTLA 2RAPA 1UP7A 5HIAA 4RKQA 1H5UA 2J5KA 5AM5A 2OCPA 4R1QA 5ALFA 3EQ6A 2X0IA 1CQXA 1DAMA 3E1SA 2X19A 4OQXA 4Q4JB 4MV6A 1EDOA 5BSWA 3GMDA 1II9A 3RYIB 4CL0A 2A7XA 5DSZA 1R2QA 3NBYC 4G6ZA 4M60A 3UK7A 1FSGA 3AYZB 3PNKA 3DTTA 3Q3GE 4URHA 1H66A 2H1CA 1PT6A 3KOMA 4DSAA 1CF2O 2B9EA 2BEVB 3C0KA 3H18A 3Q4GA 1UJ4A 4PYNA 4BNFA 4D43A 2EXXA 2EIHA 2QIOA 1TF2A 3TIFA 4B83A 1E9EA 1M73E 2QZSA 3H5OA 1SBYA 1N7IA 2GZ1A 2VZ0A 1FSZA 5BWMA 2RH4A 2NO6A 4MW7A 4E09A 3EQZA 1DQZA 4NBVA 4D99A 3GJ7A 4ZAXA 3SZUA 5B7GA 2JFHA 1P4SA 3S44A 3R7WA 1XDZA 5JW6A 5K0EA 3X2EA 3G8AA 3E27A 3NWBA 5C2JB 4PYLA 5KBYA 4YV7A 3UB2A 4DR6B 1KEPA 4M2LA 4DQDA 5IDXA 2AXQA 4JEMA 4YAIA 3NV7A 2HFKA 1J2RA 4MW2A 2NQ2C 2OHFA 2CWDA 4MHSA 3NM6B 5BV7A 2HSGA 4LHSA 2YC4C 4XX0A 3HJRA 3S2EA 5KYXB 1QHYA 3W5BA 1XRPA 4HLUC 4KQMA 4MR9B 2QDKA 3LF1A 4RCZA 1PV1A 2G5GX 3C85A 5HTOA 1JALA 2QPOA 4FMDF 5IS2A 4KQIA 1R15A 2JGEA 4D6YA 1CRLA 2V54A 3EAGA 5CNMA 4B3DA 3WGMA 3WQQA 3IXQA 3L46A 3N2KA 2O48X 3R6LA 2XPCA 1Z8NA 1NSYA 4JT2A 3OQ1A 2PYIA 4KIJA 3DZGA 4E15A 2XUIA 3O26A 1U94A 4A6XA 3RSLA 5EP2A 1EGMB 4C6TB 3MTEA 1FMLA 5FWAA 3D4NA 5F4BA 3MMXA 3N6RA 3UAWA 3ZDQA 2HK6A 2WJWA 1YS2X 4IZIA 4MWBA 4YQYA 2IIPA 2EIXA 3G2LA 4IF6A 5G0VA 4BPBA 5K45A 3AVVA 3GHHA 4JUCA 3EG9B 1VL1A 521PA 5IAKA 4ZXFA 3V7FA 5EUMA 2J5BA 3IXMA 1YKSA 2WMOB 3KPYA 1VG9B 1YVDA 2J67A 2DR3A 5EA2A 1KMHB 2BGJA 2FWPA 4Y7DA 3D2LA 3GXBA 5EP4A 3TSWA 4JYCA 1P2DA 3EF3A 5KVVA 4FR2A 1R66A 4JP8A 4L3WA 5LJIA 1IXRC 3QX7A 2ZRCA 3DWEX 5ESRA 4YRCA 3ZVNA 2VHYA 2YMMA 3HP7A 5D85A 3SQOA 2UUAB 4N5NA 4R2HA 2IBTA 2PBZA 4C3UA 2H52A 2OO5C 3JWHA 4LZWA 2QZ4A 4INPA 5BV8A 1A50B 1U0JA 3CEHA 1GPKA 5AVWA 1J5PA 2JGDA 2GM4A 1AKEA 5CA1A 2CDBA 3BF8A 1A8PA 3NHMA 2NQTA 3D3WB 1HE2A 1OU0A 2ZITA 3OEED 1TCBA 5E4TA 3RTBA 3TLYA 4EA8A 4BFUA 4FE4A 4O5OA 4A82A 3RWOA 1TYCA 2A9QA 4WOKA 3EHEA 4BUCA 3JX9A 1JJAA 1Z6YA 4EO4A 1S3SA 4GH5A 5LZ7A 1G9TA 3ESXA 2QENA 3IQIX 3JARA 3GPLA 4QAQA 1M2VB 1VHJA 3AKYA 3RHFA 1FP1D 3EFOB 1Q2XA 2WY2D 4CV0A 4M46A 4V38A 2R60A 1WXIA 3RSFA 3AEUB 3D7KA 4FSDA 4GMDA 5DYYA 4M1ZA 4YRKA 2C7BA 2EQ5A 1Q1EA 5AP9A 4B79A 4MI1A 4IWYA 2BRUA 4RPGA 4ZRDA 5HF6A 4EEZA 1T13A 1CCWA 4NBWA 1YFKA 3SIPA 3TKAA 5E7JA 1UK6A 3MB5A 4MGZR 4X97A 1F8XA 4P83A 5DGDA 5BT9A 4CM6A 4FFWA 4DE5A 4EY3A 3TL3A 1X3LA 3IMCA 4GPZA 1R12A 4UQPA 1F38A 3UC5A 4D79A 1PRYA 1NN0A 1U1FA 1WUTA 3F67A 4J0JA 3VR0A 4HNTA 1U6KA 2G8NA 2H0AA 1E1MA 1KOFA 3ASYA 5JXWA 1E6CA 2IZ6A 5IZCC 1GG8A 2M9MA 2I87A 3LUGA 4HNGA 5FBZA 4Y2SA 1CY6A 3WS7A 1UJBA 4BN0A 2IZ1A 1F1BA 4IHJA 4RJLA 5IJAA 4EATA 1VHLA 2H0RA 3MC1A 4FQ7A 2NNWB 4QBHA 2X4LA 4NULA 4ALNA 1JE0A 4K7JA 2WSSA 3IQZA 2XNDD 1J0XO 2QP3A 4Z2YA 4HRAA 3M4JA 3S6JA 3O1LA 2YIJA 3LUDA 4X0EA 3U4HA 4DLNA 2CBZA 3DKVA 2AF3C 3D8UA 3ELYA 4P54A 4D92A 1NVUQ 3EFHA 4BBJA 1VJ0A 2VH2A 2WTUA 1ECGA 4CIXA 2DWOA 1K3FA 4NFHA 4UMEA 5IABA 3K71B 4O2AA 2EF0A 3B9BA 3KL2A 3TLGA 3PPVA 4HS9A 1DAKA 4C5CA 4TTVA 5JS1A 1WZCA 1UANA 3B6EA 2NPIA 1SUWA 1UC8A 1WUKS 3K2BA 5LC1A 1UMKA 1V47A 5DX8A 5JWHA 1KPIA 3V1LA 2DOKA 4OG2A 1KE1A 3STUA 1O97D 3NLLA 2I2FA 4ZYXA 4DA6A 4MUHA 1LUAA 4YMGA 3LOPA 3PF9A 2AUNA 2GBLC 4IUCS 5CLIA 4C2TA 3DV0B 3TNJA 3NKFA 2AMVA 5JDCC 5FF9A 4LGMA 1P9RA 3E1GA 2BC9A 4P33A 2OCAA 3C3PA 3EXHC 1CF9A 3W7AA 3VZPA 1IPEA 2PH7A 2IHKA 3OHMA 2E21A 3GJ0A 1UBKS 3LJKA 2CD7A 3MJSA 1DBRA 1UQRA 2V0GA 2XSZA 5C8YB 1AF4A 3DTVD 5DCUA 2QBYA 3ZDFA 2XOEA 2BD0A 4J0KA 1H2ZA 1I24A 2FW9A 4QDOA 3D4PA 4P0QB 2FKNA 4JA0A 5JTUA 1NW9B 4IGKA 2EKLA 2O54A 2VDKB 2AA3A 1K6EA 1PN3A 4P4NA 3ZZTA 4DLSA 3N86A 4MITA 2EBWA 4EHDA 5B64A 3DL4A 1YR8A 4DCPA 2GFHA 4PG7A 2X0JA 4EG0A 3G49A 5H9WA 4ARCA 3R3JA 3E4CA 5JEEA 5JNLA 4MUYA 3H2JA 1Y3IA 2BBTA 2PR7A 3LZDA 5K0NA 5H5JA 1JSCA 3UN1A 4DPMA 1E8NA 5HK9A 4C07A 4IZ6A 1VLQA 1XP8A 1MGPA 4NJMB 3BTOA 2OQRA 1FQKA 1HQYE 1YRQA 2GF2A 4LC1A 4QFMA 5DNEA 1JHRA 3KQSA 3O9VA 3JD0A 1KVTA 1W0KD 3QU4A 4ISBA 5J5VA 3U09A 1B23P 1J2EA 1MIHA 3Q2IA 1U2SA 5KMGA 4XM0A 3Q9NA 3PDIA 4IEFB 3T99A 1J8DA 4FKMA 5DTJA 3PFKA 4EUFA 3C6QA 2QAIA 4KUEA 1EFDN 1NR7A 1VI2A 3LS2A 5DI3A 4IWXA 5B1YA 1IG0A 4NCKA 4AP5A 2PMCA 4UM7A 3PGMA 4HTFA 3H3FA 1SQ5A 1SXJB 3SX0A 3T7JA 4DRYA 4G0MA 3G7SA 4OLFA 3N2NA 3OX1A 4HLNA 1NQ5A 3E7WA 3T5DA 4X7RA 3X1ZA 4X66B 2SECE 1J99A 2CE7A 1RLJA 4XGRA 3SY8A 3LT1A 3P2JA 5AVOA 1TUBB 4NMWA 3T9AA 2FE4A 2XRZA 1WR8A 3P9RA 3O82A 4GXQA 4YUAA 3HACA 1RZRA 4FJ2A 2MINB 3GAZA 3JWIA 4P7KA 2HQOA 3U44A 3NM4A 4JB2A 2HNBA 4DCSA 4BP3A 1Z6ZA 1QIDA 2O1EA 2OYRA 1BS9A 5U4QA 2YVLA 5EESA 4UPVA 5C8VA 2AIRA 5HNKA 4QYTA 3JR3A 5JROA 2G0AA 3IT1A 1EB9A 4LJLA 1DUVG 2EJVA 2PRZA 2YXDA 4PLGA 5H81A 5GTDA 1S8FA 1HKUA 3S29A 3JALB 2CFIA 2FSSA 4J0GA 1XL1A 3DZHA 3UWDA 1PQ4A 2BGRA 5KINB 1K5DA 1NP6A 3NPAA 1J22A 1Z0DA 5AKIA 1HLGA 1U7WA 1XAJA 2X0EA 1FW6A 2C2YA 1YBFA 1DMSA 1K7CA 3PLNA 2O59A 2FQXA 4FGJA 5K0CA 4JXZA 2KSQA 4G85A 4JJIA 2E1RA 4HSGA 3RVNA 1DIGA 5EERA 3T9FA 3O75A 1GZSA 3MWKA 2A5JA 3A14A 3EVZA 1DDOA 1XQWA 2HU2A 3DZDA 1E58A 4NP6A 2QSZA 2X4GA 2W4QA 3VV2A 1V1MB 4ALLA 4CMKA 1J49A 3DAYA 2V5VA 3BTSA 2GPYA 3W3ZB 3PHIA 4DIEA 5DBIA 4QYWA 3AP2A 4E13A 5BXQC 4JU8A 4LG1A 3V7UA 1BDBA 4BNNA 4DIDA 5MF6A 4Q4DA 4DG9A 5FLXA 4YRTA 4RGYA 2JZOA 4GEGA 1XROA 1RRGA 5TMEA 5FFMA 3DB2A 4DZTA 2VHZA 1IQRA 3E9DA 4P35A 2JBWA 4O4IA 2IYFA 1O0CA 3AVWA 1RFLA 2WYHA 4RZXA 4Z9AA 5K3OA 4BCBA 2VYQA 3R9WA 3QJ5A 4G5HA 5JD4A 3DE4X 4ZI7F 4PV7A 1ND5A 1K7SN 1UBLS 3QV1A 2BMWA 3ADKA 3AY7A 4B3HA 3ZWAA 2V7QA 4JBLA 4WNAA 1U2GA 1CZKA 3EIEA 4IEEA 5KAPA 4BYGA 3KEMA 4MQ5A 2R6ZA 5DGXA 2YVKA 3TW6A 2QJTA 3U39A 2JLVA 1THZA 1W49A 3KWMA 3OQIB 3LRPA 3N3AC 5FUBA 1C9EA 3DV0A 2QXYA 2V3WA 1Z26A 4CW7A 5HS6A 3HYTA 1UT5A 1VBNA 2G1JA 2IKSA 1ZJ5A 3BXXA 1BE0A 2QR3A 3MGGA 3W9UA 3AUJB 4LOKA 4NS4A 4BVEA 2OXCA 4CM8B 1NDUA 3DOCA 4DL9A 5HJEA 2ZJBA 1NWHA 1SCNE 1XTIA 2IT1A 4V0QA 3CNHA 3E7DA 4FGZA 2C9ZA 3AHDA 4HF7A 4ZI7B 1KZ4A 2PFGA 3F47A 1PBNA 2P9ZA 4PINA 3BXHA 1BU8A 1PCXA 3RSOA 3UV3A 1XD2A 3EH1A 4HFMA 4EY6A 5TY0A 4YJFB 4LQLA 1F0YA 1GZVA 2IPMA 1WV0A 2VT7A 1NI4B 3B38A 5EG5A 1R0WA 5TJHA 3SDSA 5EJAA 2IL1A 1SBQA 5L3SA 4D9FA 1KVRA 3LDFA 1JBEA 1JG3A 5B36A 3CG4A 4P32A 4BIMA 3CLUD 3CSSA 3K0CC 3ZYCA 4QXMA 2QN8A 1A71A 3QF7A 1OLUA 1G6HA 1ML3A 2CK3D 1XTTA 4IIJF 5CPFA 1CDZA 1Y7LA 4BTVA 5EIXA 3H97A 4ZV4A 1SUIA 2BM0A 4DLXA 1MORA 3M8KA 2FWMX 2RBGA 3MIZA 4DRXB 3HYLA 1GTSA 2GCIA 1SVLA 2ZI9A 4LRQA 3TEJA 4QTUB 4AJPA 1KO4A 4P9NA 4Y1RA 1R37A 3JXEA 5LQSA 1H65A 2CB0A 5DTRA 4PNZA 1VZ3A 2P4QA 3PD7A 2ID4A 2OGSA 3VPSA 4LSWA 5AM1A 2OFPA 2G1KA 4B4KA 4EA6A 3E3LA 1Z5ZA 4ND2A 3CVYA 4HC4A 3UXYA 4OQZA 3G6WA 3HNPA 1A3CA 2VP9A 2Y0BA 1S3IA 5EKSA 5KWIA 1X7GA 2AJLI 4IFEA 1HURA 5FNVB 5JHHB 4B3GA 1YHZA 2QVGA 1TZ2A 4BYMA 1KZ1A 4MUIA 3KAJA 3EXAA 5IM4A 3EUFA 3VTFA 3FFWA 1N6OA 2IVFA 3ZIUA 2OQIA 3A2NA 3H1AA 3L05A 2DKOA 3NHLA 2ON6A 4AKSA 3X3HA 3KHUA 1D0IA 4LBZA 5B5SA 1XCGB 1FYFA 2FDRA 4YJ3F 2FMHA 2BTQB 2ASEA 1YAJA 2D2EA 1A0OA 1HEIA 2YZGA 5I7VA 2VXYA 1SBIA 5B7PA 2I4OA 4DTIA 3QIAA 1GADO 3HFGA 1U9ZA 4D46A 4I55B 2AJCA 4DREA 5E7MA 2BZ0A 1YQGA 2I71A 2PKQO 5BY2A 1KRWA 4NMXB 1VPWA 1SBHA 2GRUA 4RNDB 4PZLA 4ASUA 1X0VA 3NHFA 5CLQA 3G1UA 1E7YA 1CB7A 4ZODA 4UULA 5ALPA 1OFHA 2FEOA 4MKGA 2R79A 4OPMA 3KR9A 4U7JA 4OHFA 4ACBA 2ZSEA 1RT9A 3CTPA 3PJRA 4X1IB 3C6MA 4A8JC 1UCFA 3RRYA 3QJYA 1Q84A 1QPBA 1WBJB 3SICE 3SX4A 1Y33E 6AT1A 2AJDA 3JQEA 3OWOA 5JH7B 3K6SB 1JHOA 4NZYA 4WTOA 1YU9A 2FR8A 2IF0A 1I5EA 2PAFA 4AN0A 4ZT2A 5CLHA 1OB2A 2M98A 3F3KA 1GPBA 2NUPB 3PNYA 2A92A 3CUKA 1SXHA 3F7OA 4ICIA 3QHQA 4K6OA 2IEDA 1XFDA 2XUZA 3DM9B 4WLNA 4BRSA 5JV5A 3HJFA 1H4TA 2BUCA 4E0BA 2EG9A 3M83A 2YHUA 4YV1A 5KYUB 3ICWA 4Q05A 2BEVA 1L7DA 2DF8A 2Y1XA 4CIDA 1MAUA 3B7WA 2PVCA 4RJIA 4X93A 5KOJA 2XEXA 3PE6A 3KYJB 2FR0A 3OPVA 4C7OB 1TJ5A 1WKBA 5IC4A 1FRZA 3GRAA 2X8WA 4NZ9A 1OWLA 3P0HA 3ZHVA 1I7DA 4OQMA 3O8OB 4DLBA 5IP5A 4R0NA 4TV8B 4UVEA 2BI7A 3FDIA 3KQKA 3UWMA 3ZCPA 5DN6A 3F78A 1HTBA 1WMSA 3DCNA 3DE5X 3GEHA 4R54A 3YASA 1A9XA 2H9IA 3EXEA 1EE9A 4ZKEA 3Q7PA 1RMTA 3I4FA 4R8KA 4OXNA 3DCJA 4Q6WA 1LZLA 2GBGA 1FFAA 4LV8B 1QRDA 3BRWA 4UZEA 1HI9A 1S7GA 4EW6A 1ZEJA 4H3VA 3U4CA 4EFMA 4FYJA 4NZZA 3DPUA 4XJVA 4G56A 1T9KA 4ZGBA 4R8SA 3A6KA 2GSDA 3G17A 4P3PA 4MV5A 4U02A 3VJLA 5K4HA 1AMUA 3DF7A 1U9JA 1T5DX 4FDAA 4FMDB 2DSTA 1FFHA 1Z0UA 4QU0A 2GYWA 5AVZA 1P80A 1OOEA 1YB2A 4MQBA 2B25A 3R74A 1WQ3A 4KHZA 2D2FA 3U40A 1A5SB 1WU8A 1A9QA 3FIJA 3GJ4A 5FBKA 2LCQA 2LIPA 3U1BA 4MRRA 3BFPA 2WHXA 2FUG1 1U5BB 3ICOA 3FPBA 1N5KA 4HB2A 1Y3DE 1HNWB 3D0RA 2YOGA 2IYYA 1TM7E 4IQFA 4TN5A 3THYB 1Y5MA 2PUCA 2WF7A 3G0OA 3AUFA 4N47A 3GNQA 1ORRA 1DUIA 4I8XA 4OATA 3GLIE 1H3NA 1LDNA 2OSBA 4ROTA 2QQ5A 3B2NA 1ZHFA 5EIHA 3I34X 2BGKA 2DHRA 4PC6A 1G5RA 4JT8A 4PPGA 4LF8B 3I6QA 1CG6A 1U4NA 3RSGA 4QL3A 2CN1A 2P7HA 2EAUA 1QH9A 2JCGA 2OXFA 3ANSA 3KLBA 2VAXA 3C3AA 4QWMA 1Q2UA 5F5NA 4GQAA 1TUGA 3ZNNA 3BEOA 3NTRA 5B1SA 3PGJA 2NU8B 4KQKA 3D9QX 2FN7A 2KI5A 1GZ6A 1BHJA 1CUXA 1HDGO 3CRRA 2X0RA 3CUTA 1RQ7A 4MV4A 1FFXA 2NUPA 1MEEA 1TAGA 3R8CA 4BQNA 2VJAA 5FFFA 2A9OA 3DNMA 3KQVA 2VAWA 4RZIA 1LBQA 4FGSA 5CXXA 5TS3A 3LLMA 1P31A 1PNOA 3MJ4A 4FC6A 4TOIA 1T0HB 1Y3AA 5CT8A 1Y63A 1E1QA 4S2EA 3SZGA 3DGEC 2HNKA 3A1DA 1C1DB 1R0LA 4EJSB 3MXTA 4H08A 5CX1B 5DLDA 3OP1A 1XDSA 2JI6A 4O59O 5FNVA 3TB6A 3HZZA 1SC6A 4AX4A 4F5YA 3OTWA 4LFBB 3UG7A 3QWIA 1JJVA 3Q5EA 5HFNA 4F9GA 5C1DA 2YXNA 1RNLA 1FTNA 3L8ZA 1PF7E 3WLLA 1PK8A 5GGXA 1AUXA 2JAXA 2BKEA 3ROEA 4E88A 2XXAA 4R3NA 1HFJA 2EX4A 5FPPA 1GN8A 4NH4A 3UMMA 4LF7B 1R4ZA 5FWYB 5KDOA 1RAGA 3WNVA 3AHCA 4IV5A 4RS4A 2X22A 2BP7A 2NZXA 3INNA 3EASA 1GZ7A 2RGGA 4B7AA 1N2EA 4RGQA 2XNDA 3PTZA 3NKVA 4GSYA 1D2MA 1W96A 1PGNA 1IHXA 4MUAA 4N65A 1GT6A 2CXXA 1Z17A 1CUAA 3EPPA 1VCIA 3GRPA 1QG6A 2IH4A 3STWA 1MO2A 1U0RA 3OKPA 2GDZA 3OCUA 3OOJA 2C96A 5MFPA 3FVQA 1ST2A 2VHQA 2WD8A 2W6NA 3LUJA 5DIZA 1GUAA 1YR3A 2QPTA 3GH3A 4Q48A 4V0KA 2XB2A 1BCSA 1WW8A 1A7KA 3ZCTA 3SXJA 1XNGA 4ND4A 1F4LA 4KQHA 1EZ4A 3LP8A 1HBJA 4YR7A 5FPSA 3QBDA 3Q98A 2Y71A 1VSBA 3LHDA 3TSYA 2BGMA 5E9QA 4FGWA 3WJ1A 2O8CA 3PQCA 3RHZA 5K8UA 5LQUA 1S2IA 2PRIA 1CUGA 2ZJZA 1U0HC 3DEAA 3LVFO 4P34A 5K03A 4Y1FA 1Y80A 4O4LB 3WJ2A 1T3TA 1PT7A 1U7OA 1ZO8A 2WKQA 4NENA 4QGFA 1SU6A 2IGBA 1CR4A 4NAHA 1L7QA 3HXMA 4E2FA 2A58A 1GRQA 2Z2ZA 3DD5A 5DYNA 2J0QA 4DR4B 3NBZC 3C7DB 3UCEA 3KD2A 2V4ZA 1E5QA 3HDQA 4TMWA 4W7HA 1AUPA 3G5TA 5MN6A 4MWDA 1V7QA 3H2IA 3ECCA 4AO8A 2GCNA 4WFQA 4IHJB 4TLBA 4XWOA 3P2OA 4M21A 3X1JA 1POXA 3UUGA 3FMFA 3FWZA 2ZWIA 5LA6B 2Q1UA 3ZJ4A 3D6AA 4YAGA 1SIBE 2Q2NA 4JHXA 3LY8A 5EPOA 1WB5A 1Z3CA 4FCVA 4TSFD 3O0DA 3NBAA 3FHJA 1Q1ZA 1QCZA 3I8OA 4AUMA 4BNKA 1C7FA 3BMOA 4WQMA 5FV7A 2PX5A 3C8HA 1XBTA 2ZUTA 1POWA 3V4LA 2EJCA 4N0MA 1ZESA 1YQDA 3C6XA 3G68A 1F2TB 3WA6A 4I50A 4U2KA 3V97A 1RKXA 4YAWA 1IYZA 3ZWVA 2VK8A 1FFXB 3GCXA 2PUBA 2B78A 3R7AA 1OX4B 1XCOA 3GLFB 1OYOA 2G1PA 2GBLA 4AQYB 4Q4AB 1QH1A 2REBA 4YLEA 3WGOA 4C06A 4ZOEA 4HJXA 2GILA 2XEDA 4L02A 3PRJA 5K8VA 1CR0A 5EXXA 5CBPA 4NE9A 1YS4A 2IYZA 4E4RA 3CNLA 5AIBA 3A1UA 1TAUA 4J49A 4UPEA 3ZIAA 5A4MS 2KBFA 3ASUA 3RVQA 3WLAA 2XB9A 1ZVVA 4Y7CA 1T43A 4K6CA 4DAOA 4BB6A 4NXNB 1YUBA 4HWTA 5DN9A 1E7QA 2XNHA 1UJNA 5CG2A 5AW1A 4YC7A 2VDWA 4K87A 3EWAA 4ETWA 4HMQA 1T4CA 3GEEA 3ZDRA 4OL0A 1XTQA 5HJ5A 2BMFA 3CT4A 3DTYA 3UA3A 1A9TA 2VAPA 1XF9A 1TDJA 4HDRA 3LYUA 4L9SA 2Q5JA 5C8DA 4KB5A 2GZ3A 3C6YA 4MS4B 2FZWA 2JVKA 2ZI5A 3O7WA 2RHLA 3AFIA 4NOJA 1TRHA 1IB0A 3OFND 3ETEA 4QPNA 5GP1A 1T24A 2Q5OA 3DZBA 4AF6A 2FMUA 1EFCA 2ZWPA 3Q2KA 4MULA 1P3Y1 4OQPA 5CH3A 3THSA 1CSEE 1N32B 4MNTA 4EG8A 3BGOS 3KKPA 2EX1A 5JVDA 2YY5A 1KMIY 4HZUB 2F3SA 4QOSA 1DEOA 5C35A 4HB0A 4AZSA 3UICA 3TQRA 3R76A 1S9DA 1AHNA 1GR1A 2Q2OA 3HM2A 2BR5A 1DJLA 3E9MA 5T5QA 3RWMB 3N39C 5IKOA 2HCRA 4NG4A 3VH1A 2WJPA 1T4MA 2O2GA 4BQEA 3W6NA 4D9BA 5AVXA 1RBMA 3NOQA 2EKBA 1ES9A 2D5AA 2M6RA 4QODA 1AQJA 1NXXA 2VNSA 3OQPA 2J3DA 3V4FA 3VHLB 3HN7A 3MUFA 4B87A 1RRMA 2ZR7A 2AOUB 2C2BA 2WFAA 4X94A 3ZPXA 4IXNA 1U0SY 1HTWA 5E6RA 1HLFA 3E9NA 4DB2A 1ZM9A 1U7TA 2B83A 3IO3A 2VRCA 4AYTA 1QIEA 4NV1A 4XIFA 3KSZO 2D8AA 2VSNA 1PS8A 2XZTA 1BTOA 3PQFA 2XE8A 4WN3A 5BMOA 1LDMA 1U2DA 1TMGE 1V96A 1NP3A 2J5XA 2WYUA 2NTYC 2J9RA 3KQYA 2IUEA 4ZYWA 4RV5A 3MAGA 3GK3A 3EXIA 2HEIA 2A6PA 3FPFA 3IE2A 1JIVA 1YOVA 1OYYA 4PE5B 5BNWA 1DX6A 2PUAA 1TVMA 3VR5A 3BULA 2D74A 4DQXA 2R7LA 4QWWA 1MENA 1X38A 3MJEA 3PC3A 5J1TB 3MOSA 1QH0A 4PAGA 4TX1A 4MI3A 1PLJA 2PA0A 3NOOA 4J76A 1KZGB 3WLIA 2BMVA 4OLHA 4JI3B 2YY6A 1M1XB 3MCZA 2V65A 3U1TA 1YZLA 1ESMA 3ZDDA 1CJSA 1Y1PA 2JIMA 1CUEA 1NW4A 3KNZA 1W5TA 2IRWA 3WMFA 4RE5A 2X3FA 1RJEA 4HQOA 1QB7A 4UREA 2GZMA 2VTEA 2VH5R 2YX1A 4EB0A 2Y6VA 4J7UA 4QHSA 1GZ4A 2C5GA 4L4YA 4PQYA 5C1BA 4DMHA 4R0MA 4CXMA 2NUBA 3ZDAA 4N41A 1W46A 1JTEA 4X64B 1N57A 1QYXA 1H6DA 1R5NA 1NVEA 4TUYF 5TVGA 1SZJG 3GGJA 4BLVA 5E1MA 2Q27A 3I4CA 2WWGA 3PKIA 5JWOA 4LBVA 1A04A 1QHGA 3O8QB 1ZK1A 4IOMA 1RHJA 1CULC 3F74A 3MRSA 1BCRB 1ZICA 5A5EA 3HRIA 1PJCA 2XA1A 3U3OA 4IIYA 1D3AA 4HNHA 1YCDA 2WJYA 4PXAA 3H2HA 1T1JA 2WWIA 3GCDA 3HU5A 5EWJB 3WKAA 4ZPXA 4FB5A 5HOEA 1U3GA 2HPVA 1N6PA 2HN9A 2R6AA 1UJMA 1KPGA 2J9FB 3GX1A 1JEEA 3OQJA 2FDCA 1XZNA 4HAXA 1KP9A 1DKMA 4JMLA 3GVXA 1JDUA 3V6LA 3RIYA 4QGBA 1KU6A 3SR0A 5AKEA 3FPHA 5DO9A 1HO3A 2CLKB 1W2WB 3TD6A 2DUWA 3PX3A 3TS1A 1O94D 3FY4A 1JDZA 1A8HA 2RH8A 3DMDA 3MJHA 3IUYA 2F3QA 2Z9CA 3GL9A 4P4LA 5AHWA 3BGWA 1VM6A 1VJ5A 3D6FA 4OXQA 2JH9A 4PQFA 4UDNA 2AKAB 1R0RE 2W6OA 3GNLA 4HGOA 4KPUA 4ZVOA 1TYZA 2IU0A 2Z2JA 2G06A 4DIOA 2HIAA 3OM9A 4NU0A 4N8EA 3HEAA 3R6GA 2AWOA 4KMRA 3AVXA 2B8WA 2PZ8A 4O2AB 4FINA 2GZ2A 2FTKE 4RSGA 3C3XA 4ME6A 2Q4BA 1Q0QA 3BHMA 3JRNA 2AJ8A 3WOVA 3WFIA 2GAAA 4ML3A 3TRJA 3X44A 3KUUA 4YV0A 2PWPA 2H3HA 3O47A 5TMDA 2E37A 5J4VA 2PWZA 1QK3A 3JW8A 1RE1A 2XCQA 4YALA 4E1VA 4EAQA 3IAM1 1F0PA 3HBLA 4LYEA 1D1PA 1E64A 2AOXA 3VA7A 3N87A 3Q3VA 2DAPA 3AY0A 4CT0A 4B3JA 2G1AA 1WDLA 4HRVA 4PGMA 1G64A 1TUEA 3LT5A 4C4AA 1QHHB 4NCXA 4MRPA 2QVCA 1CZRA 3IPCA 4XW2A 4IDHA 5I9SA 3FG9A 4BNHA 2JLAA 4YCSA 1EH5A 2RHJA 2ZI3A 1TXGA 1MTZA 3V8QA 5THQA 5ITZB 3OZBA 4A6EA 1LQUA 4F38A 4YUWA 2QE7D 1BW9B 3FDJA 4I9UA 1EYZA 1PQPA 1UKCA 2UU9B 1F51E 4OF4A 5F1OA 4W9MC 1GG5A 4A26A 1EJ0A 1K0UA 4KNWA 4X1YA 4F9FA 2ID7A 4JODA 3B85A 4WK2B 1QFZA 2OY0A 2IPAB 2P62A 1BXRA 2CDRA 1IU9A 1ZCJA 3OAAD 1JW9B 3TBKA 3S2SA 4PSKA 2GLTA 4FYVA 5HIKA 1PJ2A 4GKBA 4JLDA 3UJ7A 3VPHA 4EYOA 3IQDB 4K6MA 1Z2DA 1NYQA 5AYVA 4ZICA 1D2CA 2V5AA 3R3VA 5ABPA 4ZKDA 1O96A 4BFWA 3ORSA 2RC5A 3JWPA 1UP6A 1CY4A 1PX2A 3KSDO 5CGQB 4D98A 2MWMA 2OV4A 4IY1A 1QPZA 2DWUA 3LYAA 4ZHQF 2NO5A 4MYTA 4FMCF 5LQNA 1GNRA 1HY3A 2J4CA 3R20A 4Q7QA 2QB5A 1QRSA 3ZBUA 5JYCA 5I8ZA 5HG0A 3EAQA 2GF0A 1ZPDA 4K6FA 2NAFA 5B37A 4RHEA 1Y8AA 2YFKA 3NJ8A 1FPMA 4JB8A 3L8GA 4KH0A 5KHLB 1XVUA 1JQ3A 5TARA 4M1TA 1CZUA 4RVHA 1E2LA 3FBTA 2MYTA 3SCZA 2O6HA 4YI5A 3KG2A 1QO9A 3DE7X 3EMVA 2KWIA 3M4YA 1XTUA 2O3JA 4O1HA 4PX3A 1EFAA 2IU3A 4IIUA 1QBGA 1VJDA 1E7RA 1VE1A 1B74A 4BWGA 2JFNA 2VUSA 4RJKA 3TSCA 4ZO8A 1Q0SA 2XUGA 4RK7A 2ATCA 4DV4B 5E1DA 1DHTA 4ZJPA 1PR6A 5LDGA 4FOTA 3DMHA 1NATA 1K98A 4BVFA 4BX3A 4J75A 5FPYA 3AVQA 4MCIA 1KZ6A 3JQ8B 4EHJA 2WHRA 3HYNA 3UJHA 4RL4A 3NXKA 2QX4A 1IM2A 2YMQA 1H2BA 1P9NA 3E9ZA 4QHYA 5ICMA 4X1OA 4B4DA 4DM4A 4E14A 1E2HA 3EEYA 2WC1A 2EP8A 1UWCA 3PHGA 4Y8VA 1PEYA 1JHDA 5D84A 4L5AA 1E3WB 1ZJYA 4H35A 5BSKA 4PN7A 5K99A 1TKRA 5LXTB 1G8AA 2FQ1A 2A3NA 2H5EA 3EGDB 1YV9A 4G5QA 4N1AA 4PYQA 5EY5B 3W8EA 4F06A 3U61B 1IIBA 4MP8A 3CNBA 5DI9A 1YB1A 3TCNA 4AWXA 2A67A 1AHIA 3PNVA 3WNZA 1BCRA 1N2CB 4JWKA 4ZCRA 2WB2A 3EJWA 1B3RA 2VBFA 4OHUA 4IIGA 2QQ0A 1C9NA 3L07A 1XC7A 3ESDA 4TTQA 5EWJA 1H85A 1FYDA 2WD9A 3VHRA 3NFRA 5E6UA 3H0KA 2I1LA 5G1NA 1TO1E 4DCTA 1FDUA 1Z4OA 1AKUA 1AKMA 1C29B 5CAEB 4Q1DA 1OILA 2A0WA 2ZT5A 3NI2A 1X8KA 4UJ5A 1C7IA 3JQBC 1U81A 2G63A 3GT0A 1RQ2A 3OPNA 4EPWA 3RARA 2BJHA 1ICEA 1HE3A 1IE3A 5C4MA 2OD2A 4EF4A 3RVBA 4HCJA 3RKSA 1YC5A 3E7FA 1RI2A 1QNLA 1DEXA 1QMGA 2F3UA 4BDTA 1M1YB 2IYLD 1T15A 4R69A 4WOCA 2KHZA 4K28A 1QIHA 3MM4A 3LXUX 3TZLA 4EG7A 5JJIA 4C05A 2YWHA 3MTQA 3BXPA 1EUQA 1QFXA 1E1QD 5FI1B 1N3LA 2AOTA 1TTPB 1Y34E 2VFAA 1Z22A 1R7RA 1Q7CA 3S0JA 1I8TA 4EB3A 4BV3A 2EDCA 2X8AA 3DKKA 2LV8A 3RYCB 3ONDA 2LKDA 2FN3A 4A36A 3JQRA 4R2JA 3NGMA 1E3LA 4ER0A 4P5PA 4BC0A 1O95A 1SBCA 2F90A 3BMCB 3DS8A 4FP9A 1JXMA 1KHHA 4KJXA 4REMA 5EFOA 1Z4MA 1QVAA 3PEYA 2B7LA 1P7PA 3H4IA 2H57A 2IYNA 3OLWA 4PZDA 4WNIA 4BB9A 2GTHA 1DXOA 2D2XA 2NUAB 4RD0A 2VPZA 4QPDA 4ZGWA 4G2NA 2XQGA 2QRVB 3A36A 1N2OA 5EIWA 5L4LA 4Y2UA 1AC5A 2K87A 3OQOA 2EZUA 4KMOA 1PWHA 1BSVA 2VRWA 1TVEA 5G4KA 1QOZA 3QJGA 1SXJE 2QL6A 1BFKA 1NJFA 1T3SA 1IOLA 4UJ3A 3KYBA 2EL9A 5AVKA 1MO3A 3T5CA 2O0JA 3RBZA 4ALKA 1T91A 3ABQB 3IOEA 4MRMA 4JC0A 1D0SA 1JB9A 3RG2A 1B4DA 3T38A 3EISA 4R1SA 4L0CA 4CE6A 4QT4A 1V1RA 4BRWA 1TQ2A 2XOKA 3OTQA 1GL6A 2GD1O 4PFQA 1ZH0A 3SC2B 2IWRA 3GUUA 3C15C 2JZNA 4C0BA 4IJUA 1GV0A 1V5IA 2YHBA 3KJXA 3PNBA 1WUHS 3KB1A 4RFLA 1V8FA 3T3IA 1OASA 2C0PA 4DCNA 1YZGA 3DDWA 1Y3BE 3TWOA 4EMBA 4ZO7A 2H1WA 5KNBD 2BL4A 1QO0A 2J3MA 4NFLA 5BRJA 2PUEA 5CFQA 1ACMA 4IOKA 2DYKA 4JKOA 3M9LA 4ZT6A 1M8FA 3IUEA 1I9GA 2YV2A 5KKCA 4PVDA 1QSGA 1JHYA 3WLTA 3OCWA 3IUBA 2VP4A 2GMWA 3INGA 5HGXA 4KACA 1Z6TA 3HGMA 1PSWA 3H42B 4DLVA 3IMGA 1M0SA 3ZW7A 2C4WA 2HWUA 3WYGA 1V5FA 3HJBA 1GAXA 3RS3A 3V1TC 1MF7A 2E1PA 4Z53A 1M5UA 5CG1A 4LCJA 4YGYA 1QIFA 2VZ8A 4S0ZA 3ND7A 3DBHB 5DTQA 1JQEA 4YP5A 4HUQA 3TZBA 4F4IA 2CNNA 4K9MA 1RI5A 4TWIA 4FFMA 1E98A 2FWBA 3IDFA 4XDYA 3WGZA 1JEYB 3RT7A 5FPHA 3A11A 4RF3A 5DRTA 4K6HA 1UXIA 4ZA2A 1IHPA 4PCAA 3RFXA 4RPKA 1QQTA 1J7KA 2EWVA 3ANNA 1YTLA 3O83A 4RPHA 4D8VA 2IJGX 3NGXA 4YRLA 5J5CA 3LGAA 1JV2B 3HY6A 4LZZA 1GPMA 1PFQA 3O4VA 4TYWA 3W8DA 3EG5A 3G5LA 5BQFA 3AKCA 3LHKA 4MK4A 3BCRA 1FUIA 4IRUB 1F3LA 5G0UA 2BZ1A 2B5VA 1T6XA 1V35A 3GNSA 4XSHA 1X7DA 5DHQA 4WI1A 1UKZA 1NOJA 1OC4A 2BPOA 1H9CA 4EK9A 1OGYA 2QW8A 2XLBA 4O4LA 4YRNA 3K92A 3D3WA 1T5HX 2ZBFA 1E1NA 1V37A 2TSYB 3Q3HA 2DWPA 4ER7A 4UDXX 3PP8A 3VOBA 4LDZA 3D1LA 5KWJA 1ZGGA 3CF0A 3I76A 5HE8A 2EGGA 1Y6JA 2ZRGA 3FBWA 5CB4F 2OO7A 1KY4A 4IEIA 4IJWA 5BMVA 2W2TA 2FJUA 4B33A 5FO0A 1Z25A 1T26A 3FMVA 3EVBA 1IZ0A 3CR3C 3AO0B 5JRZA 1KEEA 1E3JA 2B2CA 4AECA 4WX2B 1J20A 3PSAA 2BHSA 3AF0A 3K8ZA 3G23A 4ZPJA 1X1AA 1YL7A 1JG6A 2V9CA 2ZIWB 2PZGA 3DE3X 3L8EA 4YCBA 1FDIA 1P7WA 4Z86A 4O4JA 2HRZA 2JBHA 1JILA 2R86A 3QMWA 3SZOA 1HG1A 2CLOB 2QQFA 3MMZA 3TLXA 3DPSA 1NVVQ 4RXTA 5ARBA 1GYPA 3SBOA 3DKIA 3UFBA 5HKKD 4C0HA 5LSAA 3IP8A 4G0NA 1JEOA 3UHJA 6ABPA 1OF1A 2AK3A 4B2YA 5MDHA 4HEQA 2WP0A 4UM8B 1RKUA 3I39X 2QN1A 3KB8A 4WCVA 1COWD 4IO1A 3V6MA 3M0EA 5TB5A 4A3SA 2GYVA 3VBEA 4BV2A 4QTZA 4X7BA 3IQFA 4KNVA 4PNHA 1OSNA 1Y4DE 5FTKA 4WW0A 5SZIA 3EIUA 3RIHA 3U3RA 2ZM5A 2W11A 4COKA 4L75A 3GN2A 3HFJA 3EF0A 5HKBA 4P82A 3D64A 3KT0A 1PNTA 4C76A 2Z8YA 3R5KA 4WFKA 2ODPA 2QSUA 5FA5A 2BW0A 2VWHA 1ISSA 3ONNA 4XASA 5LQKA 4R6XA 1ZJ4A 3A1WA 3U37A 2F4NA 4UCQA 1T2DA 4L5JA 5IJWA 2XZLA 3HA7A 2I55A 5KVSA 2OO5A 2HDNB 4LOHA 2PGJA 4CU2A 2XODA 3DOUA 3OQIA 1N5MA 4DEVA 1E66A 3WIBA 3RKRA 3N8IA 4Z49A 3X2SA 4Y2VA 3ZOZA 5A7HA 5JCOC 3KLPX 1QAOA 2P9HA 4NFYA 2H1IA 4UHEA 5H1YA 1Z5OA 4TV8A 3ND9A 1AUQA 4AY2A 4RZSA 1ZZGA 4RTOA 4BE7B 5E4JA 4HUQB 3WG9A 1QF9A 2ODQA 1YE5A 1VJ1A 3KC2A 2JB9A 4BS9A 2B8NA 3UK1A 3EVGA 2AS0A 5CDTA 4ENUA 2IDZA 3TX6A 3HXQA 3NVAA 4O2BF 3AETB 2WNHA 4YRDA 2BFNA 5E6SA 4GZMA 3FTCA 1ZD8A 1IVYA 1E1LA 2RGCA 4ZC8A 4FJ1A 4E5YA 1H8EA 2BN4A 3B6MA 2IYUA 3T6KA 2AYXA 1DG3A 3WP1B 2C0QA 1CLEA 1U5BA 1VMEA 2QD2A 4TV8F 2BSQA 5K4AA 1QG0A 3EC7A 1H0HA 1YVUA 1EQUA 4JNKA 1F9EA 3BSYA 3JD4A 2H9YA 5F73A 5AXBA 5LIRA 1DTWA 4MLCA 1QKJA 2FFQA 4X00A 1CJTC 4H0FA 2GUGA 3HWRA 5AOAA 4LBWA 1AM4D 1K0FA 3OMLA 2R3SA 3O2NA 4E03A 5BN3B