2H5EA

Crystal structure of e.coli polypeptide release factor rf3
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
527
structure length
488
Chain Sequence
LSPYLQEVAKRRTFAIISHPDAGKTTITEKVLLFGQITTSVMQFPYHDCLVNLLDTPGHEDFSEDTYRTLTAVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVENELKIGCAPITWPIGCGKLFKGVYHLYKDETYLYQSGKGHTIQEVRIVKGLNNPDLDAAVGEDLAQQLRDELELVKGASNEFDKELFLAGEITPVFFGTALGNFGVDHMLDGLVEWAPAPMPRQTDTRTVEASEDKFTGFVFKIQANMDPKHRDRVAFMRVVSGKYEKGMKLRQVRTAKDVVISDALTFMAVEEAYPGDILGLHNHGTIQIGDTFTQGEMMKFTGIPNFAPELFRRIRLKDPKQLLKGLVQLSEEGAVQVFRPISNNDLIVGAVGVLQFDVVVARLKSEYNVEAVYESVNVATARWVECADAKKFEEFKRKNESQLALDGGDNLAYIATSMVNLRLAQERYPDVQFHQTREH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide chain release factor RF-3
publication title RF3 induces ribosomal conformational changes responsible for dissociation of class I release factors
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation
total genus 137
structure length 488
sequence length 527
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF16658 RF3_C Class II release factor RF3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3280 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2h5eA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2h5eA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2h5eA01
3AP3A 4TL9A 4ZIRA 3LLMA 2HJVA 4Q1DA 4MH0R 1W4AA 5JJKA 3TRFA 3PG5A 5H1YA 2FOLA 2Z4SA 2ZI3A 3ZS8A 2F6RA 2A3RA 2IWHA 3GLGA 2OE2A 1OFUX 3WYGA 1CR2A 3A4LA 5BW8A 3OIVA 3O8RA 3I62A 4NYMQ 3CWQA 1AA9A 4GMXA 4Z1MD 1E2PA 1RPZA 2HLDD 1XTQA 4HLUC 4CEJB 1MO6A 3U5ZB 1TF7A 1N6RA 2H92A 2YYZA 1NLFA 1F2TB 2WWIA 4QKQA 1IM2A 2ZRDA 4D82A 4KV9A 2Q9CA 4TL8A 1E4YA 5HTKA 1GDDA 1W2GA 2D06A 2QRZA 4GBMA 3UK6A 1T8TA 5FR2A 2IYZA 3ADKA 2C8VA 4LRWA 4CVNA 2DBYA 3H84A 4KAXA 1JR3A 3QE0A 3I8SA 1ZM7A 5DO9A 4KSCA 1OH6A 4M1KA 4DSNA 2ZU6A 4HEJA 3BC1A 4MYTA 4QHYA 1U0HC 2F7SA 2JIZD 1HV8A 3F3YA 3SR0A 3K0EA 4LSGA 4B47A 1CBUA 1GL6A 4PSVA 3SFVA 4AY2A 1U99A 2IS2A 2MSCB 5GJVC 1VPLA 1XEXB 4GFDA 4BECA 3BBPA 3MLEA 3PFIA 4B3FX 2FWRA 5JHGB 3U6BA 1ZVQA 5DYIA 3C7KA 3PENA 4JMPA 1N6OA 2GJ9A 1Z2AA 1AS0A 3FB4A 3AUYA 4JLMA 4Q18A 2A5FA 1EXMA 1ONBA 2FJUA 3I92A 2FSFA 2ATXA 3CH5A 2W2VA 3AF4A 3AV0B 1V5WA 3W8NA 4BFZA 3MWLA 3QY0A 4Q1AA 1G5PA 1GRNA 1W36B 4XWKA 2J9RA 4AWXA 2AD5A 2GF9A 4M9SA 4B6EA 3KFVA 1AKYA 2ZVPX 4M22A 3VR1A 1U98A 2KBFA 1S96A 1W0KD 3IDQA 4HDOB 3TR0A 1L4YA 2ORIA 4PQRA 2VPPA 4ACAA 4BEJA 3H4MA 4OJKA 4HAZA 4TLEA 1E79A 1VG9B 2CHVA 3U3RA 4URVR 2VYFA 1G7SA 4IOLA 4QBGB 4UJ3A 3UXMA 1G16A 1YZQA 3ZYCA 4N0DA 2PLRA 4A0FA 5E4FA 3OHMA 2CLDX 1KI1A 3KUDA 2ZROA 3CR8A 3AM1A 4ZCMA 4KYUA 3WHKA 2XNDA 3LH5A 4XTRA 3QXHA 4A2WA 4ARZA 5JSZB 2R6FA 3NEYA 3A4NA 5BYKA 5GVSA 4DZZA 4LUCA 5BN4A 4II7A 2QU8A 2P0EA 3CPEA 4BGDA 2ODNA 2QT0A 5AK0A 5F98A 4IOMA 3GLIA 4B76A 4C2UA 3B1XA 2BBOA 2R6CA 4KJZA 5DIFA 2IL1A 1W4RA 3VKWA 4B2LA 3S1AA 2JJ2A 4A15A 2PZGA 2ZREA 5DN6D 1M7GA 2I3BA 1E9FA 3QVUA 3GLIE 3KZ1E 2WJVA 1D9ZA 1I4LD 3VU9A 3QIAA 1HT2E 3T12A 4CEHA 1KJYA 1U2RA 1R10A 1JPNA 1N2CE 1MOZA 1SXJC 5L3RA 2OG2A 1ZNZA 5P21A 4ASUA 4P4SA 3VX4A 2N42A 3HYRA 3LD9A 4PQYA 2C77A 3KJIA 2HCJB 4F38A 2QENA 1K5GA 2J1LA 3Q5DA 2JLZA 3BGWA 5DNYB 3AH8A 2YHSA 4I1SA 3SYKA 1XF9A 4ARZB 4OKSA 4AKGA 1K5DA 2E9SA 2QMUA 4XIGS 4JVLA 1DAEA 3A8TA 1G3MA 4ZKEA 3EX7C 4AYWA 3EC1A 2OV2A 1J7KA 3H86A 3B85A 2WZQA 3P4XA 4JT2A 3THYB 1OXUA 3QKTA 1S4QA 3EIQA 1RYFA 2HXYA 5DH9A 5FPTA 421PA 3B5JA 4PC3A 4JKYA 4WZ6A 1U8YA 2RGBA 2WHXA 4M0LA 2VHCA 1B0UA 1G20E 1NLYA 2C9CA 3CZPA 3HWSA 1S9DA 1KTVA 2JJ1A 1ESMA 2OFWA 1MRSA 1Q57A 1ZIPA 2GF0A 4DC9A 2LCFA 3BK7A 2KSQA 2GKSA 4GDFA 4M1YA 3NG1A 1OH5A 3IBGA 2ZRIA 3KFXA 5JWRA 3KXIA 1KHTA 2EU8A 2W6ID 3HYTA 2X19A 1TUEA 1G21E 3DOEA 2W83A 3GLHB 1KI9A 1VCMA 1UDXA 3B6EA 5CITA 5KU1A 4Z51A 2B6HA 3B2EA 4EFNA 4TMVA 1NIJA 4G01B 3LBNA 2BM0A 4DHEA 3HU3A 5H70A 2AKYA 2CVFA 3BB4A 1TF5A 2VLIA 4MKGA 4UNNA 1BH2A 5FTJA 1FP6A 3V4FA 1CP2A 3KKNA 4Q1BA 3FE2A 4OHWA 1G3RA 2RHDA 4NYMR 2FSGA 5KNDA 2EFCB 1KO4A 1DO0A 2PCJA 2Q3MA 4DLTA 4U00A 2BOVA 1S1MA 2ZSEA 4P32A 3THWB 4LY6A 1EFCA 4EKDA 3AVUA 1D2EA 1TL7C 5TMPA 1FP7A 5KSYA 1ZUIA 4GI7A 3GFTA 1IONA 2BV3A 1YZUA 4Q48A 2O5VA 1WP9A 1P2TA 1N0VC 1AS2A 3QPVA 5AJZA 3BB1A 1G8PA 3LXRA 4NYJQ 4IHQA 4C0QC 4QNMA 1IOZA 5KDDA 1WRBA 2Q3HA 4CF7A 2SHKA 2OBNA 4Q9HA 5BXQC 1KZGB 2JCSA 1G3QA 2OCYC 5JSZA 1SVIA 1HTWA 4PSKA 3U4QB 5C4MA 5LB4A 2C5LA 2J0VA 3PUXA 4BFVA 3R8FA 4DLUA 1HH4A 1CRPA 1PV4A 1AGRA 1IY0A 3BJIC 4W5JA 3CPHA 1BS1A 4V03A 5KYKA 3UATA 2F43B 4BLPA 1BMFD 2YOFA 1KSJA 2VSXA 1FOEB 5B2ZA 2WJYA 4PZLA 1XX6A 5G3ZA 1YJ5A 1AK2A 3B8HA 4JS0A 2WSMA 1P9WA 1YE8A 1IN7A 4HB3A 1CJVC 2IHYA 3PEWA 3KKOA 521PA 3NWJA 2DYKA 5JEDA 1FMLA 2RGNA 5B57C 4MUBA 1OH7A 1Z0IA 2IWRA 1YU9A 4HB2A 3KQKA 1QRAA 3D8BA 4Q9KA 2YNMA 1P4SA 4RSGA 1NG1A 3GCGA 1W46A 2J45A 4FCTA 1G5TA 3K9GA 4NPHA 2IYWA 1ZNXA 3QXXA 1VIYA 3W9YA 5JS8A 1X3SA 4K46A 1KK0A 1IN6A 3SOPA 2B7BA 3K9NA 1E0JA 2HYIC 3LBIA 4PFSA 2PZFA 3PCRB 1E2GA 1GSIA 3OZXA 2BHRA 3D31A 2XEXA 3ZZUA 5CB6A 2OCBA 1G6HA 3UMRA 1W4CA 3KX2A 2GXAA 3D6TB 1Q22A 4QL3A 1QG4A 1KO7A 1SXJD 1O3YA 1KSFX 1TX4B 3A4MA 3C15C 1EFRA 4TYQA 3U7EB 2KJQA 5EXXA 1H8HA 2QN6A 4PO8A 2XZPA 5FTNA 2V55B 5DN6A 3T35A 4DCVA 5C2JB 2JA1A 3PITA 2ZYWX 1E2HA 3FHOA 3WBKA 3CF2A 1AQUA 4ON9A 5TV2A 1CJTC 3K09C 1TQDA 2DFNA 5L3SA 2ZIAA 3FMOB 3LWNA 4O2RA 3VNVA 5HZKA 4A1FA 4DSOA 5E7MA 5DGXA 1S0UA 1TQ6A 4LJ9A 3G82C 2NOAA 3FFBA 3IO5A 3OIWA 3GLHA 3U7FB 1TUIA 2BC9A 4KCGA 3UKDA 4MKFA 2OBMA 2ZU0C 5KHOC 5EUQB 4CW7A 5G53C 4GNKA 1GUAA 1CS4C 2XX3A 2VP2A 2VRWA 3PUZA 1NSTA 1C4OA 2QRNA 5C1BA 4LBZA 1Z6XA 2CHQA 1JEEA 4AI6A 4LHZA 2YV5A 4NCJA 2QMEA 2VA8A 5BYJA 3CX6A 3T1QA 3BFXA 3MWKA 3PXGA 1DPFA 4HATA 1NJGA 1U9IC 3CO5A 5J4KA 5F9HA 4Q9JA 1W48A 2EFEB 5A5GA 5B58C 1OV4A 121PA 3VR2A 3WNBA 3ZD7A 4E07A 3GPLA 2ZJOA 1GM5A 3W34A 5UKDA 2ZRCA 2QY9A 3QXCA 3TW4A 1FQKA 1YRBA 1NVVR 4ESVA 4BLRA 2Z43A 3VKHA 2R2AA 4F7WA 1F48A 3RNLA 1EG7A 3AKDA 2ZUBA 1L4UA 1GFIA 3GJ0A 3L43A 1S3SA 2CMKA 2PJZA 4HAYA 1U81A 5IK2A 3GJXC 2GJ8A 1U8ZA 1KNQA 2O52A 1PJRA 3C8UA 1HQYE 1NMXA 1DS6A 2PT7A 4DBLC 2NIPA 5JCPA 1DAFA 4B3DA 3ZIAA 2ZE5A 3W90A 2ZJYA 1E9RA 1OLOA 3L0PA 3OE7A 3WRXC 3DOFA 4N0EA 5FPHA 4WZAE 2VP0A 3EPHA 2H17A 1E2LA 4OI2A 4QBIA 3GLHE 4QGHA 4DLRA 4FINA 4BLQA 1E9EA 3CRVA 3LXXA 1CRQA 4YLGA 4U7DA 3K9HA 3DL0A 4HLQB 2B8WA 2QSZA 3TQFA 2ZUDA 1TEVA 3DMNA 1T3LA 1FZQA 3AGPA 4XH9B 1SVOA 2NO9A 5EP2A 1M1YE 1SXJA 4PSAA 5M04A 4Q03A 3TH5A 2RCNA 3EARA 1W36D 2WWWA 1RW4A 4IDHA 1XTSA 5H68A 2BDTA 4CEIA 1XPUA 5J40A 3GLGB 1ZUNB 2Z5FA 5FR1A 4S2EA 4N3NA 4RZ2A 1TF2A 2QBYB 4TLDA 3K09A 3JVUA 1XTIA 1RJ9A 4EUNA 4ESHA 1LNZA 5KDOA 1QDEA 2BJWA 4BFSA 3O8CA 2H7VA 4MRRA 1IHUA 4C3ZA 2XGJA 2V7QD 3FTQA 3TSOA 1G6OA 3VKGA 5CIWA 1JAHA 1L8QA 3FDIA 3TK1A 2QT1A 4MITA 1G5RA 2C78A 3ADBA 2C95A 2MSEB 2X2EA 4NP6A 3LW8A 4PAMA 5JHHB 3ETLA 3RWMB 5L3SB 1NJFA 1T0HB 2BJVA 3K70C 1NN1A 3AVOA 4HAUA 3W8RA 1E94E 2G1KA 4IDOA 3LFUA 5FFMA 2BMEA 2PT5A 5KPJA 2QP9X 2PL3A 2REXB 3B1YA 2FPMA 3G5UA 1FTNA 1PLKA 2DCUA 4HUQB 1XU4A 3QSYA 4RD4A 4X8MA 2REOA 4JJZA 2OESA 2CEAA 1WQ1R 2GA8A 1KO5A 3U3KA 4IDQA 4MYUA 3C5HA 3EA5A 4TLBA 3EPKA 1GITA 3R9WA 4YDSA 2G88A 4RJLA 5JWHA 5FTLA 3CF6R 4XVQA 3ZH9B 4ACBA 1IY2A 4QXAA 2IS4A 2FNAA 1DAMA 2WJHA 2NZ8A 2P5SA 3AVWA 5EE3A 2J41A 4KITB 2B7CA 4WAUA 2ZJZA 1NSFA 5FUYA 5TY0A 1L7VC 5J4HA 1A5TA 4TQAA 5CLQA 4TYWA 3GQBA 4Q1CA 1FUUA 4YMSA 3N70A 1EFUA 2ZRAA 3EWAA 3NDPA 1ZW6A 4A8JA 4AD8A 3WXMA 2ZRNA 3B78A 2IHBA 4JKIA 4UNSA 3UG7A 4NCNA 1DE0A 1PLLA 2UZ3A 1W36C 3MMPA 3IEVA 2AFHE 2W0MA 2O0HA 4WXRA 4Q47A 2FF7A 3BFVA 3NC1C 3FHTA 2G0TA 2OFOA 1LV7A 4KLNA 4DDWA 2ZRJA 1VIAA 1E0KA 2GDJA 2CDNA 3THOA 4DT1B 1M74A 3QKUA 1GL7A 3SBEA 5BN3A 3KKMA 4B71A 1NI3A 2X8AA 4LI0A 4KBGA 1J99A 2OHFA 4RCZA 4E09A 3FYHA 1N6NA 3IIMA 2ZE6A 1GWNA 3C16C 4XVUA 1XMJA 4DDTA 5FOSA 3K9LA 2ZYVX 3O8BA 2CCGA 3A58B 3AF0A 1R0YA 1T0JB 4RVCA 2O8BA 4TL7A 3AB3A 1ZU5A 3DO6A 3W3AA 1N6PA 2OBLA 5JLJA 1SXJB 2B21A 5G41A 5K8TA 1AGPA 5L3QA 4YXWA 1M7HA 1OIVA 3HU1A 4NHOA 1SKYE 3FKSA 5CDFE 3UWKA 4OK6A 2P65A 1LTQA 2P5TB 4A4DA 1NMZA 4D2IA 4V0LA 1J8MF 2J7KA 1P2VA 4FCWA 3UWOA 3H1TA 5EP1A 3ZJYA 3Q7QA 3TVDA 3W6PA 1L2TA 4V02A 3RS0A 2VSFA 1P62B 2WAXA 4HAWA 3WHLA 3P32A 1E9AA 4GT1A 1XNJA 1FQJA 4PAOA 2AXPA 1XPRA 721PA 4TMWA 4L5BA 1W0JA 1H65A 3AKCA 2NGRA 3VR4A 1I4DD 1NVUQ 3P26A 4Q4HB 2OO7A 2ZYTX 2CJWA 3ZQ6A 1E0SA 4W7SA 3K1JA 3IPXA 2VHTA 4R2IA 3X2SA 4XJXA 4NBSA 2VSOA 2GRJA 2LWIA 4B73A 4AYTA 4LHYA 2HF8A 2F3TA 1NVXQ 3ECCA 2ZR0A 2GZHA 3Q9LA 1J70A 1NF3A 1N25A 3SYLA 2J7PA 1OB5A 2GEUA 4DLYA 1QHSA 1DG3A 3I8XA 4Y0VA 5AWFC 2TMKA 4IOKA 4NONA 4ABYA 2ZI6A 4OQFA 1SZPA 2FU5C 4YC7A 2WMNB 5FI0B 2QTVB 4E22A 2ZRKA 4FMCB 2ZETA 4URUR 1PUJA 3TUJC 4TT3D 1UKEA 2OFXA 1UKYA 4DEYA 1XTJA 2OCPA 1G17A 2GXQA 3I1FA 4TLCA 1R5NA 2ZSDA 4B48A 1E98A 4B3XA 3GD7A 1GNRA 3B1VA 1JQLB 2OXRA 3QKSB 1KI8A 1J90A 1NP6A 3IPYA 3MWJA 1W2HA 3LAWA 4M1MA 2CVHA 4IXMA 3AVVA 5A4JA 3KXKA 4DIDA 2VP4A 2EYQA 1FNMA 4CDGA 4LDJA 1OHHA 4BZQA 2A30A 2AHOA 1XD2A 1HURA 3TGPA 1Z0DA 5L3VA 4YMVA 2FE4A 2CNWA 4PC6A 2I1VB 5KNCA 3BH6A 2CLCX 2ZI4A 4TYYA 4FWIB 3AF1A 3KB2A 4JYBA 1N0WA 4DWJA 1XEXA 4Q4AB 1HYQA 1KY2A 1IN8A 1F3OA 1UAAA 1SVWA 2HJGA 4QOSA 4PHGA 4RD0A 5FL7A 2YWEA 4PO1A 4R98A 4TN1A 5KDLA 3VHXA 1TU4A 2Q9BA 2E87A 4FCVA 3J81k 4ZI3A 4M1TA 4DLWA 3CPJB 2O8CA 1EFTA 2YZ2A 4C2TA 3T61A 1NNEA 4JVMA 2PZEA 5EXSA 4F4IA 4FN5A 1YR6A 5CB8A 2JIZA 4QC2A 3VR6A 3AVYA 2AKAB 3GEHA 4A6XA 1Y3AA 5FOTA 5KPDA 1TADA 5DHAA 3TSWA 4MRVA 2IK8A 1SHKA 3MG9A 4MKHA 3EWSA 2VP9A 4PHHA 4UXIA 3CZQA 4OI0A 3LV8A 4MKIA 4IFEA 1KSGA 2B92A 1P2UA 3Q5EA 1QHHB 3CRRA 3R7WA 2ZITA 4D80A 1E2JA 4DEXA 3TKLA 5CK4A 4IFBA 2FX3A 1YR9A 2RGXA 4HZUB 1ZM3A 1I2DA 1E1RA 1Y63A 2GZDA 5TDHA 4CT4B 2O0JA 1CLUA 2HEIA 4BRWA 3FPAA 4L9WA 3I5YA 2WAYA 1T3SA 3OEHD 4OQNA 4B2PA 4C0KA 2JLUA 2QORA 2IXEA 5DHFA 2Z83A 4KYIB 1D2NA 3AQ4A 4TTPA 5J4YA 1HY3A 2R62A 2VHUA 2PH1A 5DLQC 1D5CA 1DOAA 2R65A 2IXFA 3GLIB 5F3WB 1VMAA 3I4LA 2WICA 4B6FA 1NVVQ 3B9PA 4LPSA 3SC3A 2JLXA 4DKXA 2GZAA 2PMKA 3KQUA 1R5OA 1Q44A 4JT4A 3WMEA 4OI4A 4A36A 3MD0A 5FBWB 4D4MA 1AM4D 2XZLA 2QQ0A 2BKUA 4PPQA 2ANBA 1OPXA 4ZDJA 1NN5A 2ZI7A 3B60A 1UADA 3GJ6A 1WA5A 4DLVA 1NY6A 4LYFA 3JZMA 3L0IB 4LV5B 2NZJA 1ZD9A 4IJMA 2YWFA 5H8WA 2FZ4A 2A5GA 5AUOB 3KJHA 4IRUB 2MSDB 1LW7A 4JJKA 3EA0A 5E7JA 2R6AA 4O25A 5K8UA 4C30A 3VHLB 3ZVLA 2P67A 4JBWA 2FEOA 2IBMA 4F92B 3QXSA 2GWHA 1KMHB 1E2KA 1QHYA 3REGA 2PX0A 2VF7A 3L8ZA 5LD2B 4YONB 5F9FA 3KJGA 4PHTA 4UNRA 1UEIA 3A36A 3M0EA 4RZUA 2AWNA 4QFMA 1OYWA 3TMKA 1XD9A 2EFHB 1EFHA 1FMJA 3WMGA 1OB2A 2H5EA 2FPLA 2RMKA 1Z63A 4P4SB 2DPXA 2WBLC 1A1VA 4Z8YA 2QGNA 2ZYUX 1BIFA 3QUSA 2QPAA 4FIDA 1ZNWA 4GOKA 3X1XA 2FGKA 4EPRA 2ZRPA 1DTSA 1XP8A 1P60A 4YDHB 3VNUA 4W5HA 2NO0A 2GETA 2F1IA 3KKPA 4RZ3A 1F2UB 3AEZA 3X1ZA 3CUEF 4KFTA 4JLKA 1YR7A 1YQTA 2W58A 2ZR7A 3CW2A 3FGNA 3KUCA 4AKEA 2WWGA 4GOJA 3A1TA 2H57A 1MKYA 1ZC3A 3N2IA 1VECA 2BBWA 3NC0C 5CJ2A 3ZDQA 4HI0E 1PZNA 3TIFA 4QRHA 1RE0A 4ZCLA 2XTNA 4CIDA 3KL4A 1FTSA 3AF2A 2J0UB 1XEWX 4LHXA 2FDCA 2XXAB 4C7OB 4NCIA 3BOSA 2VQSA 2V6JA 2P2LA 3HPQA 2IUTA 2JDID 1ZNYA 3HPRA 2E1RA 4EQ6A 3UMSA 3MWYW 1NN3A 3LRPA 2IYYA 2PMDA 4LBYA 5AJVB 2BBSA 3LLUA 1QHXA 1G4UR 4O3MA 3QKRB 4QNRA 4D25A 1G3IA 4I4LA 4EJSC 1C1YA 1DBSA 4XWAA 1XCPA 5JBQA 1JQJC 3RABA 1S8FA 1XEFA 3H0KA 5DYGA 4TQUS 1UFQA 1D6JA 3SS8A 4R2HA 1WMSA 4R7ZA 5EXTA 2CLSA 2PX3A 4Q5IA 1HUQA 2RH5A 5FOWA 2IS6A 2N1BA 1P5ZB 4HZUA 4UXJA 1QBKC 4LX0A 4LJAA 2W00A 5KNBA 1H8ED 3TAHA 1EK0A 1B23P 2MMGA 2NQ2C 1TPZA 2RAPA 3C4JA 3BH7A 3AVPA 5J4LA 3B1ZA 1HT1E 4QHTA 1CJMA 2D74A 3RC8A 1FNNA 1N6KA 1JAIA 4JBYA 3RDPA 1RJ9B 1G3UA 1HE1C 2QTHA 2Q0HA 5CYPA 1EFRD 3K0AA 4WOPA 4ZDKA 3HDTA 3ND8A 3QVVA 4FWTA 5AJWA 4A8JC 3S1AB 2A78A 2CK3D 1OFHA 2OLKA 2BMFA 3IIKA 3PUWA 4A6PA 2EWWA 2XOKA 4HUTA 3DM9B 1R5BA 2ZJ8A 4EPWA 2HYDA 4E5UA 1X8LA 3SI7A 4OQLA 2O8EB 2CCKA 4FMDF 3BWDD 1RVDA 4WW0A 1G64A 1J2JA 2QMOA 5AJYA 1IXRC 4DLSA 3THXA 1VCOA 2DWOA 4I1VA 5LB2A 4EAQA 2ZXUA 1OF1A 1TU3A 3O47A 4TSFA 1Q21A 1D2MA 2WOJA 1OHHD 3AP1A 3VAAA 1JR3D 4EIWA 1N6IA 5GVRA 5AJXA 1M8PA 3GP8A 1DAHA 1U0JA 4CYMA 3LDAA 1W5TA 1NBMA 2KWIA 5EJEA 5JFGA 4PTLA 2AD1A 5B30A 3CH4B 3L2OB 5G3YA 4F4JA 1X1RA 2QP3A 4G3XA 3A6PC 2GAOA 2ZI9A 3QENA 1V43A 2QNRA 1COWA 2GVDC 1XPOA 4O0MA 2QL6A 2GAAA 2A5JA 4B34A 4D6PA 3EG5A 1TAGA 4OQXA 2WWXA 3NKVA 3QG5A 4G0NA 4LCBA 2UVQA 2D3WA 2ZANA 4XD7A 3U44A 5FBQB 4D81A 4HUQA 1UKZA 3DEFA 4LJYA 2ONJA 4A9AA 3ADCA 1SVLA 5K8LA 4LHVA 4DSUA 2DY1A 2NPIA 4CEJA 4PPNA 1XXHE 3AKEA 1G8GA 1IJFA 2ZS9A 4Q19A 4U02A 3GJ7A 2V3CC 3SU8A 2YKGA 3R20A 2CCJA 1E1QA 3TQCA 2A5DA 1AN0A 2F9MA 5FL3A 1LF5A 4Q1EA 4A82A 1KY3A 1CR1A 4DLZA 4QM7A 2J0UA 1A2BA 4NL4H 2VP5A 3ZVNA 4OQMA 4QGAA 4RFSB 1R0XA 1CJUC 2L0XA 4IVPA 3MGCA 2QE7A 2V1UA 4OBEA 2RKOA 1NKSA 1XCGB 2GHIA 3CIOA 2KBEA 1E4VA 1JPJA 3ZZ0A 2F55A 2IYXA 1VHTA 4DVGA 3SQXA 2IW3A 3BAFA 4LC0A 2ONKA 2GJAA 2Z6VA 1XTKA 2WIBA 1HE8B 4QHSA 3CB4A 3P1JA 3E2IA 4BFUA 2DWPA 3LVQE 4PC2A 4BZXA 1NG9A 5GADl 3GLFE 5FPSA 1YZKA 4Q7JB 5JMTA 3C41J 1NN0A 2W0SA 1G18A 4AURA 2N46A 2XOKD 3DZ8A 4GSYA 4BLSA 1E96A 1YZLA 2VP6A 3L82B 2JJ2D 3FMFA 5FTKA 2C9OA 1ZCBA 4WIAA 1IBRA 2C2HA 3EZFA 2FSHA 3BRWD 2P3SA 4IVRA 4AIIA 2IEZA 4LJ8A 1ANKA 3KB1A 4OL0A 1S2MA 2IC5A 1ZJ6A 2ZR9A 4I1UA 1UBEA 4WA7A 3ZD6A 4NMMA 4H9GA 4B3BA 2O8BB 4FI3C 4RY2A 4TSFD 4Q1FA 1U0LA 2JLRA 2RGDA 5BN5A 4TL6A 4Q4HA 1TQ4A 4P31A 2Z4RA 3FHCB 4QJ4A 4MRSA 4PZYA 3M6AA 4KO8A 2I4IA 5GJBA 4GZLA 3CM0A 2ZJ2A 2NTYC 4QGGA 3AF3A 4DJTA 5TVKA 4HLCA 1NL3A 2FMXA 2JATA 3K0CC 1N5IA 4LOAA 1HEIA 1IXZA 3OFNA 2ATVA 4G5GA 4EJSB 2DWQA 5JCZA 1F5NA 2F3RA 1US8A 1FL9A 1XMSA 1ZAKA 2CL6X 5FI1B 1A2KC 1OJLA 3RSLA 1BO6A 5FUVA 3DVLA 3BH0A 1XZPA 1M2OB 3CKLA 1Z28A 2WIAA 3FMIA 1EESA 5EE1A 2REBA 5FOUA 1VTKA 3EZ2A 3IKJA 2FV8A 2ZSBA 5EXPA 4JLAA 1E6CA 2CJWB 2MMCA 4NTZA 1P3JA 1G8YA 4RZXA 2D2FA 3A37A 2RHMA 5HE9A 3VU9B 2ANCA 1II8A 2GBLA 2PEYA 4POAA 5J5CA 1ZMXA 4ERNA 2G3YA 4B44A 1R8QA 1KKLA 3AGQA 3CONA 1RIFA 2PCLA 4NCKA 5E7IA 5JI3E 2G6BA 5ELXA 4FMBB 3B7GA 3IHWA 1JJ7A 3PV0A 4PANA 2QBYA 2ZE7A 5TARA 4AK9A 4IDNA 1E2IA 2X1VA 4BASA 4JVSB 2ZM5A 1MO4A 1IAQA 3RC3A 3WYFA 1OIWA 4EPTA 4GP7A 2NMVA 3BB3A 3QEOA 4XSGA 2J59A 4Q01A 4X8OA 1KDTA 3B1WA 3FFAA 4X8HA 2Q21A 2ZJBA 5SZKB 3RS4A 1UM8A 3THYA 5HR5A 2NO6A 2OT3B 3K8YA 1KMQA 5DISB 5EE0A 2CL7X 3BE4A 3ZS9A 6Q21A 1DEKA 1OKKA 2G83A 1AQYA 1UPTA 1NY5A 3EW9A 4CT5A 4ZPXA 1Z07A 2QPOA 3BIFA 2IX3A 4HAXA 4JLNA 3CWZA 4KODA 4NYIQ 4OYHA 3W5IA 1AIPA 1A7JA 4BQSA 1ZP6A 3OESA 3RAPR 2BCGY 1QHGA 1KK3A 3AVQA 1MT0A 4X8LA 2C9YA 4GZMA 3TAUA 3IEUA 3RS3A 1GILA 3CF0A 2XNDD 4V0KA 1W4BA 2JJ1D 3AKYA 3NDBB 3JVVA 3R7WB 1E2DA 3W6OA 4QM6A 2ODWA 5SZJA 4LYAA 2QAGC 1GKIA 4ZCIA 1BMFA 4C0LA 2FEMA 1E2NA 2F1RA 2HF9A 2ZRLA 4TLAA 5EZ5A 2QM7A 1T91A 3ZGXA 5D3QA 1M34E 1PVOA 4RD2A 4MGKR 1E69A 3RS5A 1AKEA 2ZRHA 2DFTA 1W0JD 4M53A 3I32A 3T5GA 3K0FA 2AK2A 4BFTA 2QE7D 4OHVA 4OJQA 4ASUD 5IHPA 4Q00A 1II9A 1YR8A 3HP1A 4JLOA 1UJ2A 4CZ2A 4I81A 1XMIA 1KDOA 2WSSD 3LNCA 2AFIE 1R7RA 1G41A 3PQCA 5TB5A 4PXAA 4C0HA 2QUZA 4KSBA 1Q3HA 2VHJA 4PC1A 3SBDA 3PJRA 1CF4A 1W0KA 3LO5A 4KFSA 1W49A 4JLDA 3NBFA 2JEOA 4LGMA 3MUFA 2XAUA 3NHBA 2FGJA 4RD6A 5HCIA 1XRJA 1NBMD 3TLXA 3SHFA 2C96A 2J46A 3Q7PA 4MDFA 1Q0UA 2GNOA 4WBSA 1JECA 3L0SA 2ZAMA 5EZ6B 1JJVA 2GK7A 4B33A 1GTVA 3ONWA 2RGNC 4DB4A 2PEZA 1AZTA 2EQBA 5G40A 1RRCA 1KGDA 2PJRA 1KAGA 1VYUA 3QI2A 4TZ6A 4NCHA 4F4CA 4C4PA 1X8JA 1Z0KA 2C99A 2VBCA 4L4UA 4NDZA 1G7CA 1Q1EA 1U8AA 4IW3B 4TT3A 4M9QA 1GRQA 1EWQA 2CBZA 3TE6A 4LJ4A 2FFBA 4YXWD 1Z0FA 2PLFA 3QOFA 1KK1A 2W6IA 2FH5B 3DMDA 4HAVA 1VDZA 5LBIA 1MV5A 5D3MB 2IXGA 1KYIA 2OZEA 1XJQA 2WVJA 2OUKA 3QJYA 2ZJ5A 3GJ4A 1XCMA 4GP6A 1OFIA 4NH0A 3QQ5A 2JAQA 4B3GA 1WBDA 4PX9A 4D4LA 1DG1G 3SEAA 5K8IA 1WE2A 3BS4A 4D4JA 3PUYA 4DLXA 1GL9B 1E9DA 1F2UA 3CNNA 2ZPTX 4WZBE 1WDTA 5FPYA 3X1DA 1QHNA 4L8GA 1VYTA 1S3GA 1K8RA 1T3HA 3O8DA 5IRCD 1RRPA 2ZAOA 1R4AA 5JI2E 3A1WA 1GG2A 1G291 2EFGA 2JLSA 2QMHA 2YWHA 2R6GA 3RSOA 1G8FA 5EP4A 4I1OA 3KXLA 4EFLA 3DZDA 1CTQA 1E9BA 4ZDIA 2JLQA 1JR6A 1SGWA 4BLTA 2J0QA 4RKFA 1RYHA 1OE0A 1JB1A 2ERYA 1Z0AA 4JL6A 1VKJA 1XXHA 4OK3A 5GJCA 2HUPA 3W3ZB 3GLFB 1Z22A 2HV8A 1G7RA 1W1WA 2V9PA 1NLZA 1N5JA 3CX8A 1IJEA 4M9ZA 5FPKA 1HQCA 4Q4AA 1KI2A 1CULC 2OXCA 4HYYA 4L15A 1G8HA 1Q20A 4JLVA 3HR7A 1XJCA 2QGZA 3LVRE 3ADDA 2QROA 1CR0A 1LS1A 4DT1A 1LFDB 1FX0B 1E2MA 4NU0A 3LW7A 1DO2A 3MAAC 4Z8XA 3U6KA 1NKTA 4C7OA 3SYNA 4JIMA 2R6DA 3EXAA 1E1RD 4D0GA 5KSPA 1N5KA 1Z6TA 4KU4A 1OH8A 1ESNA 4UKDA 1NBME 4AYXA 1OKKD 3JZAA 1Z6GA 4LK2A 2OAQ1 2XITA 1FFHA 5HKKD 4ZO4A 2CNWD 5SZIA 2QG6A 2C04A 1NMYA 2GILA 2VO1A 4EFMA 1MR3F 1IN4A 1ETUA 5CDFA 1A82A 1KJWA 3SJZA 4PQFA 2YC4C 4ZV4A 1ZBDA 1N0UA 4AKHA 3DHWC 2CE2X 4RD3A 1ODFA 4V0OA 4GMDA 2KI5A 2ZRBA 4LBVA 2V7QA 3NEJA 2QSYA 1MO5A 3UPUA 2IYLD 2WKQA 1OW3B 3P20A 1T4GA 1XZQA 2W6JA 4HB4A 4P3YA 3GFOA 3K0AB 3OAAD 1NVWQ 1GRRA 3B9QA 2JLYA 4JLPA 3OEEA 5KOYA 4EDHA 1BYUA 1GAJA 3ICQB 1P75A 2XB2A 3M1IA 2RGCA 3X1WA 1OXTA 2G1JA 4BFWA 3OE7D 1T8UA 3VX3A 4P0TA 2HT1A 2IA5A 4ZIRB 3TJZA 4MGIR 5KO2A 1FPMA 1QHHA 2BBTA 3F0TA 1MH1A 2ZI5A 3GJ5A 1XJ0A 1ZD1A 2VHQA 4PZZA 2QM8A 1A4RA 4LWZA 3U2QA 2WOOA 4B74A 3B13B 2NPFA 4B3CA 2OAP1 3I73A 4GL2A 4AG5A 2NG1A 2PBRA 2ODBA 3THXB 3P27A 1DAGA 1YVDA 4KBFA 1TEXA 4KLZA 1ZYUA 3AUXA 2ORWA 2QZ4A 4LHWA 3U44B 4CEIB 1OYYA 5FH9A 4JZKA 2CE7A 1SVSA 3L0OA 2C03A 3LA6A 3EZ7A 2R9VA 2H16A 4ITRC 4D0NA 5JJIA 2WWHA 3TNFA 5EP3A 3U3MA 1Z6YA 1KO8A 1R2QA 2G9NA 1YRAA 4UNQA 5A0FA 3SE0A 3T1TA 2ZTSA 3GJ8A 1YZGA 3HU2A 1Z3IX 4BFXA 4OHZA 2XSZD 5BWMA 4WVFA 3LY5A 5E95A 4G5OA 3SJCA 1JNYA 1Q12A 4TYPA 4URWR 3KDSE 2IUUA 5IT5A 1G7TA 1GZSA 2ZJAA 3PEUA 2GEDA 3F8TA 5J4VA 2YC2C 1C9KA 1UBGA 2IYQA 3QXJA 3RRZA 2IT1A 1IN5A 4M4SA 4TMTA 4Q4JA 1H8HD 1XD2B 4V0ME 4MGZR 3SDZA 2ZSFA 3DPUA 4U5XA 3RRNA 1K6MA 2JGNA 3AP2A 3KQLA 2BEKA 4QJ3A 2X77A 2A7QA 1PLJA 3QPWA 4DCNA 5HKKA 4GPTA 3QPUA 3Q72A 3FVQA 5JECA 5KSOA 2FZLA 1LF0A 3EPJA 4J0QA 3REFA 5CLLA 1OXVA 2D7DA 3MRSA 5HCNA 5FOXA 4LBWA 4BE7B 3FOZA 3NBYC 2BWJA 3F5FA 4GOXA 4RFSA 2O8CB 4NYJR 1XD8A 2JLVA 2F1HA 3SJAA 1Z6AA 4Q66C 2G0NA 2XXAA 2Q3FA 5FTMA 4JSTA 4Q7LA 5HZHA 2IYTA 3BD9A 5DI3A 3U3OA 3TUIC 1T5IA 2YOHA 5CIQA 3T15A 1XWIA 4W5WA 2W2XA 5B64A 3OAAA 2GCOB 3TSZA 2OSBA 1XFAA 4ZI2A 1KIMA 5C4GB 3VFDA 1X1SA 5AUPB 1ZINA 1RRGA 1UBFA 4XVRA 2GJKA 3NVAA 4OK5A 3X1YA 3AVXA 2BMDA 4HB0A 4V0NA 3GJ3A 1YKSA 3GEEA 1ELOA 5CK5A 1CXZA 1E99A 5F2EA 1QG2A 1SQ5A 3WNCA 3R9XA 2F43A 1AZSC 2EVWX 4HDQB 2ZS7A 4CRWB 2VH5R 3ND9A 3LBHA 4FMDB 3G0HA 1P6XA 821PA 2NO1A 3M4YA 4LJ7A 4YMWA 4MQBA 3E70C 3SJBA 4EPVA 2WWYA 2V1XA 4B43A 3RRYA 2ZVQX 3NHAA 1XDBA 3WRYC 4W9MC 2GJSA 2XSZA 3NTUA 2WMOB 1QHIA 4M1OA 1VYVA 1QVRA 4EPXA 1R0ZA 4FW9A 4AC9A 4Q7MB 3K53A 3WNDA 1US8B 1HA3A 1S9HA 3DM5A 2VF8A 4HDCA 1XMVA 1KJZA 3K0SA 4URYR 3KTAA 2GESA 2RGGA 1ZUHA 5KTYA 1YZNA 4JYCA 4TTQA 4DB2A 4C9BA 3U3JA 4PR0A 1W47A 2R8RA 1JXOA 1KMHA 3GEIA 4ZKDA 1II0A 1ZD8A 2P6NA 1CKEA 2V8OA 4FXPA 4IEEA 1BYIA 4US0R 3IILA 4ZDWA 8OHMA 4KHZA 2GK6A 2I1QA 4B35A 1OT3A 3N2EA 5J47A 2CHGA 3BORA 2ZEJA 4G5RA 1DAIA 4LPKA 4BEBA 2H18A 4DUGD 2V4ZA 1WBBA 3TUZC 4Q4JB 2FSIA 3EZ9A 1P9RA 1T6NA 2HCBA 3OF5A 4A8JB 2W2TA 2GEVA 4IOJA 2HT6A 3CNLA 2WJIA 4BLOA 2AK3A 2WV9A 1ZM4A 1ZU4A 3RANA 1ZCAA 3DKVA 2C98A 5CM9C 4Y0AA 3TBKA 1SKQA 3QEJA 1Q1QA 5AR1A 1EGAA 2J7PD 1FW6A 2D62A 3PR1A 3QNUA 3D3QA 2BEJA 3FMPB 5LD2C 4AKIA 4PHFA 1AS3A 3VQTA 1CJKC 1GIAA 3T1OA 4OHYA 2YOGA 1LY1A 1DAKA 3EASA 4MRPA 4UXHA 1RKBA 1KSHA 2QA5A 3K70B 3GMTA 4YMUA 4US1R 1X6VA 4UNPA 1BOFA 5FUXA 1Q1ZA 2ZUCA 3NH6A 4HLDA 1P73A 3UMFA 1JR3E 2QPTA 2R44A 3IQWA 1XB2A 2O0KA 2ODEA 2P6UA 3PEVA 5CYOA 3ASYA 5DI3B 1P2SA 2EFDB 3W6NA 1RFLA 4F93B 4XD7D 2O8DA 2EW1A 4RFVA 3CNOA 1KI7A 4BRUA 1ZM9A 3WYAA 4YQFA 3VR3A 1W7AA 1EX7A 3H2YA 4XSHA 2WPDA 2DFKB 2WTUA 1ZRHA 2WKRA 3NIBA 2XTZA 4D0LB 3RYTC 1CU1A 4BZPA 1TTTA 3I72A 1QZXA 1DVRA 3V4RA 1P61B 3C5CA 1JEDA 2ZRFA 2QQEA 3KJEA 5BQ5A 1W44A 2Y8EA 5C46F 4O2LA 2DB3A 1T9HA 1ZC4A 2OCAA 1SHZA 3I61A 3K0FB 3FWYA 2F1JA 1G19A 4L16A 1I4TD 4LJ6A 5JEEA 1IQPA 3L8YA 4PPFA 4NKRA 5IDVA 2WJGA 3E5HA 2O8DB 3VR5A 3EIHA 3W5JA 4QG7A 1XEWY 4D4KA 4CEHB 4B75A 2GXSA 4Q9IA 1LS6A 2H1LA 2AL7A 4MA4A 2O8EA 2FFAA 5FUWA 3I5XA 3ZVMA 3WP1B 3PIRA 1R0WA 3LX8A 1KDPA 1P72A 5D3MA 1VHLA 3NH9A 1TMKA 3ASZA 4MYHA 4URXR 2XB4A 4KFRA 3LX5A 5HE8A 3KTAB 621PA 1Z06A 2GVZC 3ICEA 1OSNA 1M6NA 3CX7A 1FUKA 1YZTA 4NYIR 3WY9A 4H1VA 1F6BA 1F60A 1VCIA 1PUIA 4IEIA 4QGFA 5KUTA 2ZQ5A 1MRNA 4TZ0A 3QBVA 4IXNA 4Q7KA 3EIEA 4UQOA 1RZ3A 2QP4A 4LYJA 4C0BA 2X2FA 1TNDA 1WCV1 4C0AC 4LV6A 2AR7A 4HSEA 2KE5A 2VEDA 4S35A 4URZR 2BVNA 1KI4A 1MO3A 1Z29A 1JALA 1GOTA 2ERXA 4RKEA 4XTCS 4EJSA 1G4AE 5FL7D 5C18A 2YJTD 4G5SA 4E03A 1ZIOA 1ZM2A 2YWGA 1UEJA 5DI9A 3WP0A 1SKYB 2ASEA 1EWRA 4MYCA 3GLFA 3Q85A 1CR4A 5AUQA 1DELA 4BPBA 4JLBA 3ZVRA 3RWOA 3LQQA 3SN6A 3TR5A 3CBQA 2BIFA 4LC1A 3RS7A 4DIEA 1Z08A 1U94A 2FFQA 1T5LA 1OIXA 4G5QA 4DCTA 5IK2D 4TQ9A 2OILA 1QF9A 1S1CA 1Q3TA 4IKEA 1GNPA 2WPDD 3QF4A 1FX0A 1BKDR 3TW8B 3IGFA 2RGAA 2IF0A 1E9SA 3P4YA 1AJEA 1M7BA 4Z1MA 3ZLJA 2ZSAA 3T06B 1J8YF 4A0GA 3QG1A 1KI6A 2IYRA 4R9UC 3U7GA 5ANRB 3SQWA 3SFZA 1CIPA 4BUJA 3IO3A 2WSSA 4DUGA 4KI0A 4M9XA 5EE9A 2FA9A 2XZOA 4DCUA 3KKQA 3A1VA 1JXMA 4M2LA 3THWA 4OI1A 4D26A 2J5XA 2J3EA 1H8EA 5FBRB 4JSYA 5TXGA 2AX4A 4DRZA 2AN9A 3WMFA 5JRZA 3OEHA 3SZRA 1P9NA 4LYHA 4Q21A 4RCYA 4NE2A 2GCPA 3CRMA 3DDCA 2IYSA 3IIJA 1MABA 1R6BX 2VTKA 4LJ5A 3N5CA 4XOIA 2J0SA 1IXSB 1SVMA 4BWYA 1XTRA 1Z83A 2A2ZA 3MJHA 2DFLA 3CLVA 3K70D 2CK3A 1KNXA 3U7HB 3UIEA 4L9SA 3U4QA 2A5YB 5SZHB 1Z0JA 2QTFA 2IUSA 1KOFA 2KB0A 4TWZA 4A2PA 2D7CA 1KI6B 1OXXK 2GXUA 5FBLB 5E3HA 4F91B 4EQ6B 3KQNA 2WJJA 2QI9C 2V6IA 1GVNB 2JASA 4HZIA 4K81B 3QBTA 3D7MA 4Q9LA 3R8CA 5DSZA 4M1SA 2JDIA 3A1UA 1VG0B 2H8KA 3SHWA 1P7CA 3HJNA 2P6RA 4DSTA 2ZS8A 5JRJA 2VIIA 3RLFA 4MRNA 2BKEA 4C0SA 5LDDC 2FPKA 4YMTA 4PO9A 3ZIAD 2HLDA 1W5SA 2V54A 3EZ6A 3MCAA 1Z2CA 2ORVA 1U9IA 5JJLA 2JJ8A 4MGYR 4LV8B 1OXSC 2XJ9A 1UKVY 4G1UC 2QAGB 4JL5A 4P33A 2WM9B 4P4TA 3VMFA 3FKQA 5AUNB 4EPYA 1LVGA 1NIPA 2BCJQ 2HXSA 1E32A 2QEQA 3NBXX 4P4UA 4LZZA 3ZQJA 3ZZTA 3T34A 3R9IA 2DHRA 5JZVA 1WXQA 2VL7A 4CGZA 2B8TA 1II8B 2LKDA 1KKMA 1LB1B 4OHXA 5HPYB 3OIUA 1JI0A 1D8TA 4I99A 1SULA 3PEYA 3CRQA 1E1QD 3E1SA 3LQRA 2ZE8A 4JL8A 1Z5ZA 1U90A 4R71A 2BMJA 4XWOA 3U60B 3CR7A 4FD2A 4V0MA 3DKPA 2FFHA 2XJ4A 1Q1BA 4QJ5A 2IYVA 4C0JA 5LPNA 1IY1A 2QAJA 2EWVA 2GTPA 4TTRA 221PA 2O8FA 1F2TA 3BERA 2ZRGA 4M1WA 4K8OA 4WXPA 3QF4B 1KI3A 2QAGA 4Q02A 2EYUA 5IF9A 1EX6A 4TYNA 3WBJA 1SVKA 3MJRA 2RB4A 3OIYA 4Z54A 2CXXA 3HR8A 4MUAA 1Z47A 2A9KA 4MDEA 3PVSA 3QKRA 4IVQA 4N1AA 3RS2A 3IQXA 3V9PA 4B2IA 4DCSA 4DDUA 4JLJA 1GNQA 3RRMA 3GLGE 2XTMA 4QBFA 2UKDA 3CRW1 4PPGA 5EUMA 3Q8XB 1KO1A 1XXHB 3SNHA 2IF2A 3Q3JB 4TMKA 4H1UA 2F9LA 3A1SA 2IYUA 2AWOA 5EQTA 4ILEA 4TMZA 1DARA 3EPLA 3BFKA 1GP2A 3FKSD 1GKYA 1MABB 5EE5B 1KDRA 5FBVB 4PC7A 2O8FB 4BFYA 3GFPA 3B82A 3RHFA 3KQHA 2NO7A 4M21A 4US2R 3UANA 1E2QA 3NXSA 4QBHA 2D2EA 3TVTA 4TMXA 1E0AA 4JBXA 1UF9A 3MSXA 4RD1A 2Q9AA 4UJ5A 3EC2A 4A92A 1JBKA 3I3SR 3NBZC 3IUYA 2W6JD 1XBTA 4M8NE 2YINC 4PAQA 4A2QA 1UDWA 4A0HA 4AG6A 2GCNA 1N3BA 1Z8FA 3U61B 3QF7A 3RVBA 1E3MA 1G9XA 4DDVA 2YVUA 1KZ7B 3OEED 2XNSA 5FOVA 2IS1A 5L8VA 3OFND 2GCOA 3V00A 1X8KA 4GRAA 2HDNB 5JS7A 4Q4LA 5L3QB 2GBLC 2WKPA 1VCNA 1GKUB 1X86B 5CM8B 4IDPA 1E2FA 5KSZA 3VTKA 1SXJE 3BXZA 3C14C 4DXAA 3PUVA 2DR3A 2K5UA 1RC8A 2JLWA 1N6HA 1E9CA 1OFTA 5JWOA 1RRFA 1NRJB 1R8SA 2Q6TA 3AVTA 3K0CA 1N5LA 2AXNA 4KVGA 1TQ2A 2OEPA 2D4HA 1D9XA 1N6LA 2BM1A 4FMCF 1E2EA 2LKCA 4KVAA 1UBCA 1I2MA 1KK2A 1WF3A 3IBYA 3MFYA 1E79D 2OM2A 1O87A 1DADA 2FG5A 1QVAA 4KFUA 4A0RA 3UG6A 2UZIR 5CJPA 5DE3A 2ECKA 5GJWC 3T5DA 1CEEA 4HLUA 4JVNA 4NZYA 2IEYA 1COWD 2FN4A 1KAOA 1YHNA 1G1MA 2CL0X 2RGEA 3IHLA 1VG8A 2Z0MA 2ZRMA 1VG1A 2G77B 3T1VA 2WWFA 4B32A 1WB9A 3EAQA 2J87A 2OLJA 3QKSA 4KXFB
chains in the Genus database with same CATH superfamily
4WOCA 1J0DA 4MH0R 2C5HA 3GT7A 3PG5A 1VQ4S 3F71A 4QIEA 3SQLA 3W4IA 1MVOA 2B2XA 4YP6A 2ZOGA 4NYMQ 4KR7A 3DJFA 4C4WA 3ISZA 1RSCA 1WVIA 3OE4A 4FD3A 1NW5A 2H92A 3WC0A 3FVVA 1FVXA 1E4YA 1U0EA 5JPDA 1XVTA 5ALLA 3BQ9A 2G70A 3V80A 2ZU6A 2FJWA 3G5AA 2H4YA 2OPRB 2JIZD 1SUSA 4ED4A 4NMWA 2EL9A 3JQQA 4GFDA 1I5RA 1H2ZA 3GXOA 1XR7A 3A2KA 1N6OA 4X4OA 1O6XA 3NCHA 2CJBA 4RMJA 2VJDA 3CH5A 1UPFA 3AV0B 3DMHA 3TQEA 4Q1AA 4HQKA 3ME5A 4XWKA 2ZIVB 4AWXA 2AD5A 1RADA 2WTNA 2ZVPX 1AHNA 1X7XB 5BYSA 1J39A 1RT5A 4OJKA 3FNEA 4LISA 3W5DA 4FPIA 1W1UA 5AIBA 4D96A 1G7SA 4UJ3A 4NDAA 1P1TA 1STOA 3NIGB 4LAFA 2H5IB 3UGQA 4NLLA 5G0WA 2Q8PA 2FD2A 2Z3VA 3WHKA 3KQWA 3QXHA 3A4NA 4IYJA 1Y10A 3RH0A 2P7HA 1RT7A 3OCCA 4CG0A 2F8TA 4WZBB 5DIFA 2DE0X 1ISSA 2PD6A 4YMGA 4LI3X 1UKUA 3NOXA 5JAPA 1XZBA 2FX2A 2BHTA 2XECA 5A4FS 2JLZA 2J08A 4K0RA 1XF9A 4MDYA 1M90T 4M1ZA 1JV2B 1PZHA 5JMNA 2Y0BB 1WKCA 4RU1A 1LFAA 5C35A 3BMCA 3CZRA 2C3MA 1B00A 4RH0A 3T6JA 2VHCA 1NLYA 3EGZA 3EUFA 1NQVA 5I9BA 3CZPA 1MRSA 4JI1J 1N5OX 4UTRA 4P72A 4M1YA 3NTLA 3HP4A 1S89A 3C6XA 1IL0A 5HBMA 1VCMA 2DBZA 1VQKS 2QW8A 1AVTA 2UUWA 3W6UA 4BUZA 3SNKA 3X1JA 1I1HA 1ZK2A 1K5PA 4BO9A 3WIVA 5GZ3A 2Y76A 4MQ6A 4MKRA 1NJ2A 2X9VA 3AHHA 1T0UA 4F3RA 3EEBA 3SQMA 4WRRA 1XTBA 2Q3MA 1H38A 2R86A 4U00A 4GX5A 2XGQA 4I50A 1F2HA 5H16A 2O14A 2GCEA 1B3TA 1N33B 1JDBC 4GI7A 1PWZA 3ZIUA 4RX1A 1RCOB 4PGMA 4RF5A 5DGAA 3A05A 2RJNA 2JCSA 1G3QA 1E6MA 3DDSA 4FYDA 3U4QB 3H1EA 3ZDYB 2J0VA 2FHSA 5I6DA 1K9VF 2JGDA 1HH4A 4OA8A 2FP4B 2HHHB 5ICFA 4NLPA 1EPUA 1JFFA 1O94C 2Q3DA 4NLTA 3DNCA 1K4YA 4NLWA 5KC9A 3K0HA 4HB2A 5JU6A 1SXPA 2CNOB 4KGZB 2IRXA 2V7TA 3C74A 4K9OA 5JS8A 1VIYA 5HMLA 1K9SA 1IEVA 1YSJA 1A9OA 3Q87B 3DR5A 4WL0A 3QUAA 1QG4A 3HEBA 3LHKA 3F46A 4B9MA 3OCZA 2AZTA 2WRMA 5TV2A 4INPA 3M2PA 1E4EB 5CA0B 4KE9A 2QLBA 3EXHC 4IF4A 2BFDB 2VRCA 2BC9A 3A8JA 2ZFHA 1I4OA 5EUQB 2DTJA 1GUAA 3D6NB 1NSTA 2UYGA 3WLNA 2YV5A 1T4CB 4NESA 2EP8A 2IV7A 3D7RA 3MWKA 2Z08A 4IBOA 3BSYA 1UODA 3NUGA 1CE8A 3ZD7A 4ALMA 3MM4A 3C6KA 4C3LA 1EXVA 1NBAA 3RODA 2B5OA 3EDRA 4JFAA 2RKIB 5KFLA 3QVGB 3VAMA 2WB4A 5AXBA 3TNVA 1DAFA 1X74A 3HYLA 3WRXC 4CQMB 3ITHA 2XOXA 4MTPA 2I2XB 1RHRB 4H15A 1A0OA 4JJ7A 3H19A 5K6RA 3B3AA 3GWZA 2Z5VA 1D2CA 4L8LA 1TV6A 3FPFA 5DLGA 4RULA 5EP2A 1A6LA 2HN9A 3K9CA 3SQOA 4ICLB 1L0BA 3V6LA 1ZUNB 2GN6A 3JVUA 4A46A 1I2CA 1W73A 3GRRA 1YB5A 4I6YA 3ZN2A 4DIUA 3CQ9A 3J7TA 4E46A 2SXLA 5A4AA 4TKZA 2HR1A 4JOUA 4EMTA 2D5AA 5KPJA 2HM7A 5KHAA 1GSOA 4CWAA 2DCUA 3N59A 4BMZA 4X4TA 2AA3A 2REOA 1PK8A 4B81A 1TQHA 4P93A 2IM1A 3T38A 1LBEA 2CXOA 4B3MF 5LSRA 2P5SA 3KLFA 5KFHA 4ZVRA 3L09A 1F8GA 1R8BA 5ADVA 3NOQA 1YDGA 3G2PA 3EFOA 1O95D 1Q6YA 1O6BA 3DDUA 3N6MA 2ZIXA 1BLUA 2QGFB 2QTGA 3QMQA 3MMPA 4ZO7A 4Q47A 3BFVA 3QT8A 3TAPA 2GEBA 5SY6A 5BSKA 3SBEA 5DJBA 1WI8A 4OPMA 2M6KA 2P2SA 4BNGA 1EDOA 3IIMA 2HSJA 3O8NA 5CHEA 5HMXA 5J3JA 3A58B 3DLCA 4AECA 5KCMA 3TQSA 3O6VA 5TPZA 4Z3KA 2V7XA 3EGIA 2XWYA 4D2IA 2ZW9A 3DEAA 1MGOA 3WG9A 4FYWB 1QIGA 1SK8A 3GRYA 4MRAA 4RA9A 3ISNC 1NQOA 2HF7A 3UAGA 4AXJA 4J1NA 2FVPA 3V4IA 1Y6ZA 2WE7A 5BR8B 1XPRA 1PT8A 3MS4A 3JSYA 2O57A 2VHTA 4A6EA 3IQGX 2WILA 2Y68A 1DBWA 2V0CA 4DQLA 3CCUS 5JPIA 2TMKA 4UBLA 4ZP7A 4FMCB 5DRYA 1GRVA 1U2PA 2ZSDA 4B48A 1UC8A 3CLKA 3L7AA 1GNRA 1ZG3A 1ONOA 1W2BR 3QO9B 1PCXA 3KXKA 4C03A 5ALGA 5AHOA 4YMVA 3ZXXA 2ZB2A 4TYYA 1UAAA 4RZIA 3JQAD 2BFBA 5K3EA 4W98A 1WX1A 4MARA 4ITSA 3HBMA 4X54A 4X90A 3KLVA 3I23A 5B0AA 1UVJA 4EL0A 5KPDA 1I0LA 5IAEA 3PT9A 3EWSA 4GQBA 3CZQA 4QICA 3LV8A 3D0GE 2IU6A 3KOOA 1P2UA 5F4ZA 1XN4A 3GIJA 1CNFA 4TS1A 4JASB 5F73A 2RGXA 5B3JC 2JB9A 1KQGB 4FYVB 1P1FA 3LF1A 5TDHA 3H11A 2OBXA 1B7YB 5J2UA 4DLGA 4EGCB 4KYIB 3D59A 4A47A 4TU7A 2XD4A 3A10A 3B9PA 3RUDA 2M70A 1JXLA 5LJIA 2PMKA 4MLZA 2BI8A 4B3TB 2IGTA 2VPTA 3FCCA 1K7EB 2WONA 1L5KA 3L0BA 2O2XA 2DXEA 5B53A 5L45A 5LSLA 4GNRA 2C0QA 4YAJA 3W6ZA 1Z4QA 4WBFA 1KYWA 4Y6IA 3H8WA 4U7JA 1VBMA 2C3OA 4C30A 3VAIA 3BYPA 5DQIA 1KC3A 1TVKB 2G8LA 5LD2B 2BAGA 5F9FA 4RZUA 1T5HX 2Y3IA 3PXXA 2RMKA 1A1VA 3I9NA 3GFHA 2SBTA 2XF2A 1BE6A 4IF6A 2ZRPA 2YKQA 1GO2A 5F8LA 4OGFA 4QAQA 2GETA 3EXFA 4NC9A 3F78A 1YQTA 4AKEA 4JWTA 2KQUA 1BCSA 1BH6A 4Y98A 2H54A 3PBKA 3R5GA 4FUQA 1L5FA 3GPIA 2XW6A 3H2KA 1EX8A 1QHXA 4D1YA 4KR9A 4JOSA 5KFWA 3JRNA 1N1EA 2YNMD 5A0TA 4OP3A 2RH5A 2P6TA 5BSMA 4HZUA 2MMGA 4K6HA 2XO6A 3T5KA 4RF3A 4J9UE 4JBYA 4MW9A 3W61A 3HHLD 5BMVF 5JS6A 2IEGA 1MJGA 3DWGA 4DQQA 3RW7A 2BGIA 2IM3A 4ND8B 2Q2OA 5AVSA 4L8WB 2ASVA 1G64A 3K94A 1D7AA 3HI6A 3R0JA 4Q24A 1KOOA 5TRTA 3KAKA 4XRGA 3VAAA 1ZDMA 3ELHA 3LDGA 2ZYRA 1ZN7A 4RANA 2IVYA 1U0JA 2JHPA 1O51A 3HD1A 3NIWA 3CH4B 4WZAA 1NF9A 4Z7OB 1X1RA 1W88B 3GG9A 4Y67A 4QYIA 5C81A 3JQJA 4EWLA 1L4NA 3RAQA 1EVKA 2WWXA 4G0NA 1ACJA 2ZANA 3RIYA 4IFIA 4LJYA 3KPJA 2NPIA 4XLZA 4PPNA 1R9GA 1E61A 3CLTC 3MZ0A 1X5SA 1N5QA 1E1QA 5MGBA 4ARAA 2J0UA 1YJNS 2QTRA 3ETCA 3ZVNA 2IU3A 4IVPA 5AKHA 3EIXA 4KPUB 2JC3A 2GHIA 5ES3A 5EWMA 2QR3A 1YVFA 3PGA1 2Q8QA 2Z3ZA 3WNVA 2EDAA 4BFUA 3KYDA 1LLQA 2BGLA 5KZMB 1NN0A 1ZJ5A 3BHMA 4PXBA 1QVGR 5I7OA 4HH0A 4KWCA 4F9GA 3EISA 2P6MA 1ZCBA 4WIAA 6ABPA 5KOHB 1UXJA 3VSBA 1Z16A 4C06A 1QV6A 2CXHA 3I34X 2CDAA 4I1UA 2QLFA 3ZD6A 2RHGB 4N54A 5K4AA 4Q4HA 1V26A 3M6AA 4GZLA 1F9EA 3JQFC 3NBPB 3AF3A 1RYYA 4QYXA 5K7SA 1YA6A 4HWGA 3LKZA 4NLRA 3TCXB 4O6VA 3QZ8A 3R9XB 4OGWA 3IKJA 5FRDA 3QFRA 2B1RA 4A0SA 5TGTA 5IKXA 2DBQA 3GB0A 1UMJA 3A37A 3N75A 4RMHA 5KVSA 4F0MA 1RIFA 5E7IA 5JDIA 2FEXA 4DQUA 3U49A 2DRAA 2E9TA 2CNBA 4O2BA 4GP7A 4ERXA 3B1WA 3IDFA 2GPWA 1XVVA 2IC3A 2J0XA 5ICMA 2ECFA 5LUBA 3EW9A 4QO8A 1FFEA 4HAXA 4A8TA 3CWZA 3QVJA 1QTRA 1NSKL 1U6ZA 3KDPA 4L8YA 3NYWA 3H40A 1G21A 4J9PA 2XLCA 3TEFA 2XLJA 3W5UA 3WDLA 2B25A 1PVOA 1PR5A 3CXCR 1W0JD 1GGKA 1KQFA 4P38A 3VHRA 1BGWA 1FRXA 2BKOA 2GFIA 1V16B 2A14A 4OH7A 4DM7A 4E32A 4MVJI 4P3KA 5IABA 1W49A 2FR8A 2P9JA 2DUUA 3NHBA 2BOAA 4K4UA 1L1RA 2J46A 2FUG1 1X9SA 4WBSA 4B33A 1X7HA 1TU0B 3BQ2A 5FTWA 1CG2A 1QGOA 4KG7A 2FMFA 4BB9A 4RVUA 1K8XB 3LOPA 3TE7A 1Q1EA 4V39A 1H3DA 1MW8X 3DEIA 2IIQA 1XV5A 2EFVA 5LBIA 1XJQA 3WWDA 2ZJ5A 1XCMA 4ER7A 1YBMA 2RKBA 4KPFC 4UW2A 1KZ9A 4LFAJ 4DLXA 1NJ5A 3FZNA 4GGMX 1KZHA 2RBEA 4BKQA 4FJ0A 1R4AA 3HMJG 2EKQA 2EFGA 2I2CA 4EMBA 4M3NA 2FRVA 3G17A 1JLLB 4EFLA 1PJ5A 4ZDIA 1R0BA 2P9EA 2XO7A 4LRCA 1Z0AA 4JL6A 1X4HA 5EESA 1ODIA 5ETMA 3MT0A 3WYNA 3NGTA 1ZH6A 1N5MA 1EWVA 2XWXA 1NC3A 4NZ0A 3DL4A 3P9QA 1BWPA 3GBSA 1QH9A 3E48A 4LVOA 3THTA 3NNNA 4JI7B 1JKJB 3JZAA 2OAQ1 5SUHA 4YRCA 3DLEB 4GC5A 5ALYA 1BCRA 1KMNA 2Z8YM 1A82A 3MF4A 2GAHC 2F63A 3KQQA 2Z6AA 3VHXB 4K2XA 1VL5A 5TJ9A 2ZRBA 2V7QA 3NEJA 1MO5A 2DGSA 3O8OA 4UEWA 1B1AA 2JLYA 2Z2YB 5KOYA 3BE8A 4EDHA 5ALRA 4BFWA 5FO1A 3W2WA 2VAVA 4FGWA 3H6GA 3LP5A 1G2PA 4CNZA 5A8WB 3JVDA 3I6YA 1WEKA 1H6AA 3PPVA 4Y3CA 4MUEA 3LPYA 3E05A 1E77A 1IU9A 2NG1A 1YVDA 1YQEA 5AP9A 3WK9A 1A9XA 4YCSA 2CE7A 1SVSA 1JZSA 2FPIB 5FI3A 2P2CB 1KO8A 4H35A 4UNQA 1KAMA 3HU2A 1Z3IX 3A11A 2A9FA 4OHZA 4MLPA 4WVFA 3LY5A 3SJCA 1HYHA 2P1ZA 1E59A 2VOPA 3SQDA 1S57A 1TJ4A 2RGRA 1OI7A 4DLBA 5LKRA 1IN5A 1I3NA 3VPHA 4Q4JA 2B34A 1HLGA 4UREA 1EBFA 2FLWA 4U5XA 1YIAA 2DU8A 4GXTA 2WSEC 3FVQA 1MMDA 4LFBB 4FHEA 4DFMA 3OR2B 2D7DA 4RNHA 4N0MA 1TK3A 2Q3FA 4Q7LA 2EF1A 2IQIA 3EEYA 5KG6A 5CIQA 1NJWA 3R3JA 2W2XA 3JZIA 1RHQB 3FJ2A 1RWVB 5C4GB 1KQKA 2AC2A 3SC2B 2GJKA 3VYRB 3MUVP 4NRTA 2Y1EA 4DV2B 4RXTA 1YUNA 1Q2XA 3PPYA 4KACA 4TPKA 1Q53A 2GAJA 5HKLA 1WOMA 5M3BA 3KPWA 2NT3A 3PWKA 7FD1A 1CUZA 1NUHA 1T35A 5KG4A 2V1XA 2Z98A 4G56A 2AMLA 1XQIA 1V1RA 1Z39A 1FU4A 1S9HA 2JLEA 3DM5A 4DCCA 3AC0A 2VC1A 5M2UA 4ZA2A 4I2VA 5JROA 3GEIA 4KMSA 1H0KA 5AUNB 1NZ8A 4A2CA 1FKOB 2Z8ZA 1C1BA 1RJGA 1KGSA 5EZYF 2ZJ3A 4IUYA 4IXTA 2B4YA 4IRXA 4FEAA 3CNLA 3UB2A 4ND6A 4I8IA 4RIHA 3VV3A 4CO5A 4C3UA 4MK8A 1Q1KA 1EGAA 3QRQA 4C22A 1M83A 4N5IX 1A76A 1KQPA 1JB9A 2LIVA 4TKVB 4UEKA 3K70B 2HOQA 4K1XA 2FN9A 2DGWA 3C8YA 2X76A 5BSHA 4XD7D 1B74A 2J6TA 2EW1A 4RFVA 4OV6A 4D57A 1KI7A 1VGVA 2DR8A 3OUZA 2VN8A 1IK4A 2BE2A 4O2LA 1SHZA 2X4DA 4FZ5A 2YWCA 2BVZA 5EJIA 3UAYA 2I4OA 3L8YA 1GX6A 2PSFA 3EIHA 1CJUA 5FWXB 1Z7GA 4D4KA 2H1LA 1JMYA 3I5XA 3ZVMA 1ZVJA 4F4XA 5A6PA 5FYQA 2BR0A 3AQPA 3LX5A 3SZMA 1RT7B 2XQVA 5JCOC 4BDPA 2C1EA 1IZZA 4UM9B 2EC0A 2NU8A 3BMCB 1HMYA 2W2MA 1TNDA 2LRHA 4LS3A 4MQMA 3E84A 2EP5A 4NJOA 1EJ2A 5IN5A 3OHSX 4J9RA 1SKYB 2RHWA 5F8HA 3ZTYA 2UYOA 3CBQA 1O4WA 4L0DA 2EG2A 3EZYA 4BX8A 3AFMA 5ALDA 4IEFB 2WJWA 2OPHA 2EFYA 3ZLVA 3ZWQA 2VKRA 3KKQA 4D26A 3T5CA 4NBVA 1ULUA 4EY4A 3TZLA 5JRZA 4C4TA 4WESA 2VTKA 5E7OB 1ISIA 2DFLA 3K70D 1KNXA 1YL5A 2VV5A 2KB0A 1JPUA 1MPTA 1YJRA 2C5SA 2MZRA 4NZ9A 4C7KA 4RPGA 2MDAA 3D6AA 2UV8A 4P54A 4JROA 1GZ6A 4EVIA 4WWSA 1XK8A 1UAGA 4JAVC 1N9GB 1SKUB 2V54A 2LIPA 1MAWA 2YVSA 1ZETA 5E2IA 4MGYR 3UUFA 1CJCA 2CVEA 3HB7A 4P4TA 1S0NA 3BXFA 4WFAQ 5BVHA 3MYRA 2G4CA 3GFQA 3DEYX 1KKMA 5HPYB 2IOHA 1E1QD 4DV7F 5CCXA 4F3OA 4IZOA 1NVDA 1U2EA 221PA 1C41A 2ZB7A 1FRLA 3QF4B 2J9FB 4WQMA 5IDWA 2RJOA 3E82A 4ZVQA 3D4LA 3IP3A 1JLLA 4U3JA 1R0CB 3OR1B 3GLGE 4WXWA 1LBIA 2ON6A 4PZVA 4PLZA 1PT5A 4U4AA 1XXHB 2MSSA 4O4JF 2FK7A 3JSBA 2A92A 3AY7A 2AE2A 2D5BA 4FZ3A 1BJRE 3KQHA 5J2NA 4KGMA 5ICSA 3MAHA 4PPDA 2DBVO 1CEXA 4UDOA 1MJNA 4JI4B 1ZICA 4DDVA 5AVUA 1KZ7B 3U17A 3V00A 2GWRA 3I39X 1VJ5A 2V74B 1ETHA 2XGGA 2QWXA 3PLRA 2H65B 4RQBA 4MV6A 2DR9A 5INTA 3EMTA 2QQFA 5HUJA 4R0JA 4G26A 1MX5A 1YDLA 3W8EA 2IDMA 3OTQA 3I9OA 1E79D 2PJDA 3D43A 5CU7A 4BQIA 2ZSKA 2JG3A 1G42A 3KEOA 4BJHB 5FDLB 4YJ3F 3PNMA 5JJKA 3LBYA 2IHKA 4NBRA 4NLXA 4V2IA 4PRYA 4MI6A 3BMQA 4QW8A 3DHVA 4QU9A 1ZBQA 1JEYB 2UVDA 2CZCA 3AEQB 4DLNA 1GTHA 2WT4A 1JI3A 1IM2A 2P30A 2WU4A 2D06A 4GBMA 1OPZA 2V7UA 5FR2A 3QE0A 3VVMA 4TGLA 1P6UA 3KUKA 4ARVA 1SKSA 1GU0A 3GGOA 4EYHB 4CKBB 4PSVA 5FLYA 2IS2A 1RM4A 2ZIXB 4Q4DA 4AZSA 4MR7B 1QE0A 4RPFA 2BGJA 5CVEA 4F4KA 1Z2AA 1DHMA 3F6BX 3GMDA 3P2EA 3IC5A 2IZZA 3KFVA 2ZHBA 1NMEB 4DR3B 1P91A 1U1PA 1BXRA 4ACAA 3AXSA 4ZI5A 3LUGA 2EC2A 1YZQA 2DNRA 3C3CA 4N0DA 3SVZA 4QDZA 1SC9A 3AM1A 4TXNA 3UJDA 1RU3A 4O33A 2GJFA 3LUYA 4DHVA 4YS6A 3CNQP 3OL6A 4R6XA 4KJZA 2V5HG 2PZGA 2O7NA 1V7QA 5EOVA 4TQRA 1SXJC 4K88A 5IC4A 5CFLA 4AT1B 3VDNB 1U0OC 4J0DA 4C3KA 4IGFA 2L69A 2BGUA 4HNTA 3BIWA 4H7HA 4ZHQB 3B85A 1I4EB 4XVHA 2HK6A 1PYTA 3L49A 2JFUA 4JT2A 3DG9A 3QKTA 1SD5A 1UFKA 3RVDA 1U2ZA 2WJ4A 2ZH2A 4JN6B 3P9SA 1XJWB 4CM1A 1EETB 5L7YA 4W6QA 2DQ4A 3M6FA 1KI9A 4GF5A 2XHCA 2OKGA 2OAGA 2R6JA 2BM0A 2G1HA 4L5CA 1S49A 1RNLA 5LC1A 3IP7A 3W78A 1FWLA 3L6DA 5KNDA 5HWSA 4X4NA 2AHOB 4MIAA 3THWB 4ZVEA 1YJBA 3KQOA 2XCRB 2Q3CA 1NZDA 1O95C 3KYDB 8MHTA 4QU8A 2C2EA 4NYJQ 2G9OA 1U3DA 1Z7BA 1C1HA 1XAJA 4JWKA 4M54A 5H83A 5ALSA 1UDCA 5EINA 4CO3A 2JIBA 4V03A 4C89A 1RYRA 2IOQA 2VSXA 5HMZA 3D6HA 4U7WA 4UFNA 1P9WA 4R1SA 4BVBA 3FMWA 521PA 5IJ9A 3DOOA 3I6IA 1FC0A 3KQKA 3D8BA 2LGJA 1W46A 3N5BA 2AXQA 3IBSA 4EHFA 3N7UA 1JE0A 3PCRB 4EYQA 5DN9A 5HMMA 4E7OA 1GTEA 4IICA 1PYOB 4B3JA 2F9JA 3VO1A 1T3OA 5TT1A 4FXVA 1OREA 1AQUA 2QLMA 2QV6A 1KVSA 4E33A 2FQQA 1EUQA 4XWWA 3IO5A 2NN3C 3CCES 4LIRA 4WZZA 3DKIA 1GUZA 1Z4PX 2OBMA 4J4BA 3OL8A 4BCBA 2HQ1A 2VP2A 5K0CA 1NQXA 3GG2A 4NCJA 3D3CJ 4FGLA 3BTSA 3PXGA 2QD3A 1DPFA 3KUUA 2OQ2A 5F9HA 3CCFA 3AFGA 1QS0A 2AE1A 1N88A 4C4OA 1ZIYA 1QIMA 2HWIA 1GGEA 4YMHA 2WNIA 3OOWA 5I7FA 1S1XA 3AEXA 3RYIB 1JLEB 1KYVA 2W43A 1EG7A 5IK2A 4NZZA 4D99A 2VPYA 1EM8A 4MP3A 1NMXA 3O5TB 2MINB 5FQNA 4ED5A 3EPHA 3GLJA 3R1IA 3AHDA 1MMNA 4JC4A 4DLRA 5LP6A 3DL0A 5B1SA 2XM3A 3LLSA 1HFJA 2O50A 5M04A 1IATA 3ANTA 2RCNA 1YBUA 1XO1A 5H68A 4X9XA 1LSOA 4YREA 1C3XA 4RIEA 3LT5A 4HYKA 2JF0A 3HSZA 1LNZA 2IZ1A 2NM0A 1HW9A 2EBUA 1ZD4A 3T5LA 5FAKA 3ZJUA 1G6OA 4FFPA 4H4MA 4NG5A 1JAHA 4E13A 3OFJA 3UN5A 2C95A 1L7OA 2IH2A 4S0ZA 3MWDA 3LW8A 5C25A 4H3SA 2PVPA 4M0DA 2ACMA 4YRPA 2QP9X 2HWXA 2QIOA 1PG5A 4C88A 5KNDD 4J9OA 2GA8A 3E3MA 4AX8A 4EAAA 5IXJA 3DEJA 4G8DA 4IWYA 2IS4A 1MBZA 4UMVA 3AVWA 4F9FA 3SZ3A 4R4JA 1LA2A 3N6NA 4L7VA 5JR3A 1EFUA 2ZUUA 1F3FA 3ROGA 4AD8A 3ZV6A 5GONF 5H3CA 5G0SA 3IEVA 1PLLA 4IQGA 4WXRA 4JI0F 4QA9A 4USWA 3K1YA 2VDNB 4YB7A 1ZY2A 3BN4A 4MIOA 4WMLA 3VXKA 1TYEB 5IUKC 1P8AA 1RP5A 2HUNA 4PGGA 1RZRA 3FI0A 1Y1RA 4U2BA 3M3PA 2QX9A 4QGBA 5P8WA 4PQAA 1SXHA 2OBLA 2VJMB 2HW3A 4M36A 3WISA 4PLGA 4ZK6A 5L3QA 4QWMA 4WEQA 2H9IA 2FG7C 2P65A 3ZHRA 2QA4G 1GYPA 3BA6A 4YCCA 4HO1X 2VDRB 2J7KA 1O89A 4FCWA 3G87A 4FM9A 1QPBA 3G4SS 1RM0A 2OECA 1RAFB 5JAMA 4GZ3A 1E9AA 3I82A 1FQJA 1AA6A 3NYQA 4WDRA 1S7CA 2HJHA 4IJWA 3RSCA 4YI3A 9LDBA 4JI3F 4Q4HB 1OSCA 4UM8B 1ZOPA 1WDWB 2VDPB 1ZGGA 2CUNA 3FTDA 3OKCA 4BQOA 1U7LA 1VLHA 1LBQA 4WY5A 2XEDA 1PR1A 4D4GA 3T9FA 4ED0A 3I8XA 4KEAA 4D9IA 5FI0B 5K0LA 3I6MA 1RLJA 3MJEA 1RJWA 1A95A 1WPGA 4PXCA 3ZTQA 1XTJA 1O58A 4TLCA 2BW2A 2EX0A 4NBUA 4OQ4A 2HVZA 4OLJA 4RABA 1FDVA 1YFKA 4BQQA 4M1MA 2CVHA 5DHUA 3JS9A 2EYQA 3GR6A 3MECB 2KL8A 1UWVA 4AM8A 2FE4A 4D0RA 1TUBB 3O2IA 2ZI4A 3SHQA 1U3CA 1F5SA 5AHKA 4X7MA 4I69A 3BICA 3UMJA 4UARA 4BO8A 2LKZA 2IC3B 3RJ5A 3BG5A 4M8KA 4EG0A 4HDAA 1WSWA 1U9YA 4UATA 2AU0A 5AHXA 4KGDA 1CBKA 5HS6A 2OP0A 2RHLA 4CUKA 2WTAA 3ZNQA 1YCGA 4B82A 4JI0B 2B92A 2ZD1A 1Y3JA 4HT3B 5EJ4A 5CDSA 3D6FB 1BEEA 4HZUB 5HMWA 4EM6A 1IY9A 3T3FA 3EGDA 2JEFA 2JLUA 3GLSA 2YNHB 5GAHI 2QRLA 2EBGA 5H59A 4QWAA 1HI0P 1WPXA 4LPSA 2JFGA 4CIAA 3NTQA 3VKUA 2RD2A 1Q44A 2ZVDA 4M83A 2HRYA 1EGMB 2I67A 1NN5A 2ZI7A 1SJ3P 2X2OA 4AJPA 5HFAA 2VBZA 3Q0IA 1K2WA 3QXSA 3REGA 1T1GA 4B9EA 3CW2C 1O54A 2AWNA 4JCCA 3WMGA 2O3TA 2E66A 3FTNA 1IM5A 3KKPA 4ZXFA 4RZ3A 4MT1A 3ZTTA 1F14A 2O7QA 5EUBA 4QVKA 3NC0C 1AXQA 2VKQA 5MGNA 2BRLA 3NHZA 3BAZA 4H1HA 3KLGB 2IAJB 4ZEOA 2B56A 3T9AA 3C46A 4CT9A 4EK9A 3LRPA 2IYYA 5IUJC 4KAFA 1K8YB 5HMYA 4BVFA 3R3WA 4I4LA 2WTXA 1PZEA 3HVTA 1AYEA 3BJYA 1VE7A 1TPZA 1AZSB 3FLAA 1N6KA 5D5PA 3MN1A 4QUBA 4GMKA 1JKJA 3EIFA 5FV7A 3LYAA 4XAKA 3S1AB 3GGJA 3VALA 1OFHA 4HD8A 3D1LA 1CQXA 2UUAJ 4X44A 3SI7A 1KVTA 3NLLA 4J4TA 2DGQA 1MROA 2E0IA 1GGFA 4ODIA 4UHJA 1CSEE 2K1RB 3U4HA 2BR5A 4DABA 2LDYA 2ZXUA 1U09A 3CB2A 2B1IA 2OO3A 5HQ8A 1EI9A 2O48X 2BUBA 3GP8A 1DAHA 3YASA 1AE1A 3LY8A 2PIIA 2ZUVA 1TJ5A 3U09A 5A03A 3L2OB 1Q8KA 4R8UB 3R0QA 1I01A 5K8JB 1CJKB 3JZDA 2X40A 3ZTWA 3RIMA 2C4NA 4HQ6A 1PYSB 5GAEI 3LTEA 3Q0EA 2FR1A 3UB3A 1AK9A 2DY1A 4CV1A 2G6TA 4BDSA 1VLQA 1NI4A 3L04A 3GJZA 3TQCA 1XCLA 4KQGA 1KY3A 4DARA 3AR9A 3RUEA 2HQSA 2VP5A 3Q7RA 2ZAGA 1SUQA 1CJUC 3R7SB 2VNKA 2DETA 5ICCA 3PE4A 1FMTA 3UA3A 3R5TA 3S1SA 4GX0A 4M87A 1YB4A 1UPPA 3QWAA 2ONKA 2LYVA 2AOUB 2GJAA 4YQEA 1S9GB 4QZVA 5FPSA 3HADA 1P44A 4GSYA 3PFWO 2JJ2D 5FTKA 2C9OA 3QLJA 3ORFA 4IVRA 3JPWA 1GT91 4LJ8A 4I5GA 1ZJ6A 1UEUA 2Q29A 1P81A 4F21A 2GUWA 4Z7JA 5DG9A 4YNBA 3WLKX 1E1CA 1TM7E 2I4IA 4IYQA 3FSEA 4ZQIA 3LKVA 2PH5A 5DNCA 4QGGA 4G5YA 4KTTE 5L1KA 1FP2A 2PS3A 4QDUA 2Z3WA 5LNK6 1VC6A 3LQYA 2JHFA 3NP9A 4OGLA 1CUIA 5CH3A 1XNRF 2FLLA 5DHPA 3WGOA 4PX2A 4DV0B 4F2WA 5CXUA 2ANCA 4AICA 4Q43A 1GTJ1 4JKOA 2PWBA 3R0IA 5KU7A 1GMVA 5TARA 3DVQX 2C42A 1T6BY 1C1XA 2WD7A 3TIVA 3ICOA 1KDTA 2CSUA 5D00A 1N2CB 3WYBA 4QIGA 4QOJA 4ZMMA 5GONB 3MT7A 1IVNA 2A6MA 2VXYA 1UBJS 5C1PA 3KZNA 3ZI0A 3TAUA 2IRYA 1ZONA 4FDUA 1Y1SA 2X23A 1T9AA 1N2BA 1FYFA 3FAKA 1TUGA 4RW8B 5IASA 4FB5A 3EIUA 3QU4A 3OQ2A 2Y1IA 1BWQA 2DFTA 2OAEA 4M53A 3U39A 1USGA 3ZD8A 3M1YA 1YX2A 1Q7TA 2ID8A 4HNVA 1QYCA 5BR8F 3U4IA 2QUZA 1P7YA 2VZ8A 3CUVA 3A3OB 2PSDA 3GZNB 1FO1A 4BKUA 2VFRA 2GNOA 2OPSA 3AO0B 3R5CA 4DB4A 2E44A 4PZDA 3WMWA 4FC6A 1KAGA 4WCFC 4OSPA 2UVPB 2C7OA 4XUEA 1U1LA 3PACA 1U0NA 4D5EA 2DK2A 2GCIA 4KMRA 1JDNA 4N47A 4JI3J 4ZVSA 5IYZF 1L5ZA 5T4BA 3H5RA 2JLBA 1XCJA 4LYEA 3LQ4A 1WBDA 3SICE 2B4RO 4KYTA 4TWIA 3DZJA 2YXNA 4I1RA 1IXKA 1HPLA 2YVAA 3M82A 4LN1A 2O4CA 1RYEA 5G1PA 2CYCA 5JI2E 1DJLA 3QPCA 1ICIA 2HKEA 4B9SA 3NWBA 3PS9A 4FGUA 3R7LA 1JR6A 3TJ9A 3HCPA 4IMRA 3MECA 2G07A 4JLWA 2KS6A 4L74A 3G9UA 3TYTA 4PZPA 3SMZA 1W34A 4AJ1A 1RYZA 3RK4A 1KI2A 2JNJA 2QMYA 3DBIA 1Q20A 4JP1A 3AM5A 4IHAA 4YRQA 5DX8A 3OZRA 4DMKA 3KG2A 4JIMA 2BHNA 1NBME 1RWXA 4O4IA 4M5GA 2JEZA 1RE1B 3W2FA 2HEGA 3NHKA 4NWIA 1LW2B 2YPYA 3QX3A 3MIZA 3AJEA 3MOIA 3ILYA 2ZUEA 4CFYA 2Q3BA 2W4PA 2GOYA 1VIOA 2H00A 3WBBA 4EA7A 5ICGA 2WKQA 2VG7A 3P20A 3GFOA 4P7VA 4LT6A 5CNJA 3OAAD 2WFZA 2R8XA 4PUOA 1P75A 3NRBA 4BAZA 3A9UA 3WLRA 2GMLA 2BEUB 4G07A 2H2HA 4KE8A 2IA5A 5KO2A 3OD2A 1U2DA 4C8NA 1UPBA 4AG5A 1TEXA 5CX1A 1RFGE 1S3FA 2EFQA 4JP2A 5IOLA 1Z6YA 2ZCUA 1PT6A 1HBUB 4Y6LA 2HIAA 2DVIA 4CG3A 1NNDA 3KDSE 4ED3A 3DXXA 2OMOA 1VQ6S 2GS9A 2VPXB 1DRUA 4J07A 2NVUB 2ZSFA 2WYOA 1UP1A 3ZV4A 4NYPA 1MXFA 4QJ3A 4KGKA 2A1IA 1Q95A 2NZ2A 4GP9A 3G2IA 1B3RA 3BGOS 5ALQA 2H48B 3N6XA 5DXAA 1SOAA 4KK3A 2C9MA 1W96A 2CD7A 4K9SA 4DG5A 3VNSA 3OC6A 1HL3A 5EJ2A 3T15A 3B7PA 3NMRA 1XAHA 1E6UA 2ACKA 2FZGA 1VOMA 1MHPA 3I0SA 4B3SB 3DXBA 3AVXA 3I2JA 3G2XA 3TLJA 4V0NA 1TKBA 4RHTA 4NK4A 1OZ0A 4YJFA 1CXZA 2YWBA 2E37A 3GJYA 3EVWA 3BMNA 2GV1A 1XMPA 5I48A 4B9TA 3E70C 3EDOA 1G0NA 3AW8A 2BRUC 3WRYA 3IFSA 1Y1PA 1UW4A 3GLKA 4ETWA 1HA3A 1R5JA 2ZWVA 1ENZA 1FNSA 1P1HA 3RRBA 2E9RX 4UOZA 1CJTA 2YVKA 4P7KA 5CHCB 3H20A 3VYSB 2HG4A 2V69A 1QIIA 4AZVA 4X1KA 3F9IA 1TRKA 2VTDA 2VXCA 4MS4B 3E9NA 3QSGA 1IULA 4V3BA 4OV1A 4G5RA 2PWPA 4CO2A 1WBBA 4N5DA 2EJUA 4RHFA 2FSIA 5EIEA 3BJRA 4IOJA 2AK3A 3QU2A 2A58A 5F7JA 3FTFA 2C98A 3LHIA 3W8GA 4PG7A 4V19J 1XKTA 3ZDZB 4ES2A 3Q3IA 4S05A 3PR1A 3D3QA 1JSLA 2CXSA 2RNEA 1AS3A 1PAEX 3PYEA 2RUGA 3QE9Y 1VQPS 1PL7A 1BHO1 3RV3A 3I2YX 4USTA 4N5LA 3I2FA 1TM3E 1CPYA 2RSLA 5EG5A 2WTUA 3NIBA 1REVB 1TTTA 2CNOA 1QZXA 1DVRA 1G9SA 1JEDA 2V4JB 2PRSA 1ZVMA 4BMCA 1QQ5A 1T9HA 1SV5B 2J5AA 1XRNA 4IZHA 3CZMA 3I61A 2ZR8A 4USJC 1FVHA 3HS3A 4KZKA 4L5JA 5L1JA 1EQUA 5HIAA 3AXKA 1I6KA 1LS6A 4CLZA 2B69A 5B37A 4UQPA 1DRJA 3LCJA 4EOGA 2XB4A 2QYCA 5IVKA 3JQ9C 4EEZA 1MV8A 3MUTP 5J2MA 4HQFA 3W3SA 4DBVO 2FK8A 3TTSA 1VCIA 1MRNA 4IXNA 4GKBA 3PSHA 2EHJA 4ZAGA 3C16B 2VBXA 2J32A 4LSLA 1AU9A 4C0AC 4DJFC 2V6FA 2G5CA 1JALA 3DW3X 4BBJA 1JBEA 3EZOA 4EABA 2WSYB 3TQ1A