2HB6A

Structure of caenorhabditis elegans leucine aminopeptidase (lap1)
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
489
structure length
489
Chain Sequence
TQVLVRNGIQAVGDGLTSLIIVGKKSVLKNVTFEGKFKEVAQKFVTDGDSWNSMISRIPASGRHPLHYELAHLITVPDASSRGNTPTNAHSIYKELKPINYPEDTKNVHFVLFAEYPDVLSHVAAIARTFCKFSMKTSGIRELNVNIDVVCDKLTNEDAVFLTDLSESVRETARLIDTPANILTTDALVDEAVKVGNATGSKITVIRGEELLKAGFGGIYHVGKAGPTPPAFVVLSHEVPGSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLCIVENNVSPIANKPDDIIKMLSGKTVEINNTDAEGRLILADGVFYAKETLKATTIFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKASGDLVAPMLFAPDLFFGDLKSSIADMKNSNLGKMDGPPSAVAGLLIGAHIGFGEGLRWLHLDIAAPAEVGDRGTGYGPALFSTLLGKYTSVPMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine aminopeptidase 1
publication title Crystal Structure of Caenorhabditis Elegans Leucine Aminopeptidase
rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
total genus 174
structure length 489
sequence length 489
chains with identical sequence B
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF18295 Pdase_M17_N2 M17 aminopeptidase N-terminal domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10590 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Zn-dependent exopeptidases 2hb6A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2hb6A02
3BI0A 3PBBA 3KHZA 4P45A 2HB6A 3K2KA 2XEFA 3D68A 3NH4A 5ELYA 5HXDA 1ZLHA 1Q7LA 3PBEA 4P6YA 2PE3A 4NJQA 3LWUA 3FF3A 1FT7A 4PQAA 3PB9X 1QQ9A 2IQ6A 2ZEMA 4A38A 4NGMA 2JBJA 4OC0A 1HDQA 5HVHA 2ZEHA 1TKFA 4W9YA 2PJ2A 1CPSA 1ARLA 2AFMA 4BD9A 4FBEA 3CPAA 3ISXA 1XJOA 1AYEA 4MCPA 2AFZA 4R76A 5LYLA 4R7MA 2NYQA 4PXBA 1IY7A 3PB8X 3KHXA 1Z8LA 4PXCA 4ZI6A 3WC7A 2CF4A 3B3SA 4X3RA 4NJRA 3KGQA 2ZOGA 4EMEA 1TKJA 1CX8A 2ABZA 5F09A 3WABA 3PFOA 4OC3A 2ZENA 2ZOFA 5LRGA 5HVGA 4F9VA 4F9UA 4KSIA 2AFSA 3HLPA 2RFHA 2BCOA 2PCUA 3T8WA 3PRTA 5THWA 7CPAA 3FEEA 4ONWA 4P4EA 4UIBA 5D8NA 3B3CA 5J1QA 4Z65A 1PCAA 4UEZA 4OKOA 4ZY0A 4UIAA 3VARA 1JQGA 2C6CA 5JGFA 2XEJA 2BOAA 4YWYA 1M4LA 3BXMA 4FWUA 1EE3P 4P10A 3SJEA 4OC5A 2Q4ZA 4NGTA 4EWTA 3GB0A 2RB7A 4H2KA 3KQZA 4MCRA 1R3NA 2PJCA 3KR4A 1F2OA 1F2PA 2Q43A 1XBUA 4NGRA 4NGNA 4P4JA 4G1PA 2JEWA 3V7ZA 1ELLP 5LRJA 2ZEDA 4A94A 5K8NA 3N5FA 4LQGA 2Q51A 1ZG7A 3TX8A 3RZAA 1HDUA 3KI9A 1YLOA 4OC1A 5JM6A 1YMEA 2ZEEA 4K3NA 1XFOA 4UEFA 2O4HA 2PJ3A 2PJBA 3QNVA 1KWMA 2PIZA 3IO1A 4JZ0A 1LCPA 1CP6A 1FNOA 2PVVA 3SI1A 2CTCA 4MHNA 2J9AA 1YSJA 5D29A 4X8IA 4OC4A 4MMOA 2F7VA 5LRKA 3MRUA 1CP7A 1R43A 4DUKA 3LMSA 2GLJA 3B3VA 5K8MA 3JRUA 2V8VA 3GLJA 3H8GA 2AFWA 3MN8A 4UEEA 3D7GA 3V38A 1YW4A 2PJ9A 3DLJA 3BHXA 1DE4C 2PJ1A 2ZEPA 3BI1A 2ZEGA 5LYFA 1GYTA 4P44A 1LAPA 3PB6X 3FVLA 5K8PA 2F8HA 4IAVA 3B7IA 1Y0RA 1BAVA 4DYOA 3WC6A 3FEDA 3FMCA 2PJ8A 2JBKA 3IFEA 1LANA 2V8GA 1ZG9A 5IB9A 5K8OA 1Z2LA 3B2YA 2NSMA 3D66A 4ZY2A 3H8FA 2EK8A 3NH5A 2CTBA 4OC2A 1TF8A 2PRQA 4NGSA 2IMOA 3D7DA 2OOTA 3KQXA 2DEAA 2AFOA 2XEIA 1NSAA 2ZEFA 1VHEA 5HVFA 4MHZA 3NFZA 4A37A 2PJ4A 4JYWA 2HC9A 2AFUA 5LYIA 3FH4A 1BPNA 1LAMA 2PJ6A 2C1CA 3WC5A 1F57A 2BO9A 3IEHA 3IWWA 3PB4X 1LOKA 3H8EA 3S9NA 3HUVA 1VGYA 2GLFA 3L2NA 3SI2A 3RBUA 4OMEA 3B3TA 5JH9A 1ELMP 4TNUA 4ZX8A 2WYRA 4FUUA 3B35A 3CPXA 3I1UA 3PFEA 4OIDA 2WZNA 2GU2A 1UWYA 3CT9A 3IIBA 4R8FA 4WWVA 1Y0YA 4P4FA 2AFXA 1Y7EA 3KZWA 2QVPA 3IJ3A 4PXDA 4P4IA 4A39A 4MCSA 1CG2A 4ZX9A 1Z5RA 3IC1A 1VHOA 4F8ZA 2G9DA 1BPMA 2PJ0A 4B6ZA 2PVWA 3VH9A 1IGBA 4PXEA 2CIJA 4DJLA 2PJAA 2POKA 1XMBA 3FECA 1TF9A 2PIYA 3PEIA 4OIWA 4IK2A 3PB7X 1ZG8A 3S9LA 2V77A 2C6GA 2ANPA 1VIXA 1CBXA 3FX6A 3CDXA 4P4BA 2ZELA 5I4MA 4MRIA 3SI0A 4MXUA 2FVGA 1PYTB 4P4DA 4UF4A 2OR4A 5CBMA 3SJGA 3FJUA 2C6PA 4MHPA 1CPXA 2V8HA 1ZLIA 3K9TA 3DGVA 1DTDA 4YU9A 3D7HA 3WT4A 4ZY1A 3SJXA 2EK9A 3TC8A 1QMUA 4X2TA 4RUHA 1RTQA 4MHYA 1YW6A 2EWBA 2QYVA 3D67A 4MCQA 3GUXA 1ARMA 3SJFA 5DS0A 3KASA 2GREA 2I3CA 4EFDA 1HEEA 4NGQA 3D4UA 2V8DA 1TXRA 3VATA 1OBRA 4WJBA 6CPAA 3NH8A 2O53A 4OP4A 4R6TA 5LYDA 2XEGA 2VL1A 2PJ7A 3KL9A 1TKHA 5CPAA 4PPZA 1H8LA 3ISZA 2IJZA 4FAIA 3KR5A 3D7FA 4IHMA 4CPAA 4Q7AA 4O23A 4NFRA 1XRYA 2QJ8A 8CPAA 3S9MA 4NGPA 2ZEOA 2PJ5A 4GM5A 4AXVA 4ZYQA 1AMPA 1BLLE 4TWEA 3NA6A 3B3WA 3RAMA 1LFWA
chains in the Genus database with same CATH superfamily
4BWGA 3OP1A 4LYGA 4OGKA 2W42A 4TKVA 1RABA 3A28A 4BQEA 1NFRA 1K7SN 5KQMA 1GA4A 5AJWA 3U3DA 3P9NA 3VH4A 2H0RA 5K8VA 2Z8YA 1Q16A 2J0VA 2RK4A 3DEKA 4FSHA 2QQEA 2P69A 3VO2A 4PIVA 4UCPA 1R4NA 5GVSA 4KL8S 3V9PA 4MO9A 4ID9A 1QG2A 2BEKA 3A1TA 5CLGA 2B94A 3IUPA 3PJGA 4ORFA 2MSDB 3OFVA 1EWKA 2DBQA 1KU6A 3CPHA 3DW1X 3QKTA 9MHTA 1EVYA 1WULS 4AL4A 4I50F 1G7TA 4CUZA 4BMVA 5JFOA 5HRAA 4C2UA 4AFNA 5HK9A 4Q82A 3CRVA 3H11B 1NWCA 2J3DA 2G0AA 3AFGA 3HI4A 3QF4B 4Q48A 1J8DA 5SZKB 4HNXB 4DM4A 1A96A 2J4CA 4MVJI 4UBLA 4BGIA 3IT2A 1DL5A 2YWEA 4NJOA 3N8DA 1UOEA 3RSLA 5AVZA 2RHRA 1WIWA 5DHSA 4E32A 1NP6A 2IRWA 2WKSA 2ZDGA 1X10A 6REQA 2O8FA 4W9YA 3VOSA 3QVMA 1JI0A 1WXHA 3E8SA 1W30A 4WCFB 4ZCSA 4QPCA 1KAGA 3OX1A 3BF7A 3P2IA 4ENTA 1QTIA 3QXJA 4CEHA 1IJFA 1XVAA 5EMHA 1AUGA 2DLDA 1AQIA 3D7KA 3FBWA 5LQKA 4WKBA 4K30A 4N03A 4B3JA 4LHXA 4E22A 3OQHA 2LPMA 2JEOA 4IPTA 3KHXA 2CZGA 1JFLA 1O95C 2Q9CA 4HZGA 4Q7EA 4QOHA 2P9FA 3I1JA 5DSZA 2BHLA 4JYBA 5AJYA 1XMSA 4L5AA 1GNVA 4ZOLF 2GBIA 3TNYA 4EHHA 2ZOGA 3NVMB 4NH4A 4HDAA 3ORQA 1LCIA 3BTVA 3N8HA 2XZLA 4UZSA 1U65A 1ZESA 3EDQA 3ZHTA 4QHTA 1H3EA 4LJ5A 2XMQA 4G1MB 1E63A 1YDGA 4P7KA 3TUJC 3VPAA 3HS3A 4NDNE 2D54A 1V1RA 3LOUA 1PCXA 2FKNA 4K9SA 1E3WB 1ESCA 1U0JA 2G4CA 4TXMA 1ZICA 2YWHA 3FN4A 2Y77A 4RIEA 3DVAB 4WESB 2PCUA 4J43A 1MNAA 2G8LA 2DWQA 1GL3A 2X6QA 4K9MA 1J9GA 4BIIA 3CSUA 3RS0A 2CEKA 2WE7A 3QLTA 5CFMA 4YAUA 1M4DA 4PYIA 4PSVA 2BN4A 2MOKA 4MRAA 5K0CA 4JXJA 4L3OA 2IVZA 2YDXA 5EWMB 1TC2A 1UF9A 4M76B 3AFMA 3BXPA 3T7SA 2ZZMA 4OYYA 3MYYA 5F3WB 1RXCA 1NQAO 1WXGA 1KMHA 2NUAA 2I9KA 4OMCA 5BVGA 2VHUA 4US2R 3RVSA 3ZWOA 3LLUA 3T5TA 1IB0A 1ULHA 5DH9A 1RBZA 4BX8A 4N7BA 1V16B 1VL0A 1NZDA 1NNSA 1VE7A 3KU1A 5FA5A 4DMKA 1HORA 3QUTA 4RUKA 2BGLA 2XB2A 2NG1A 2EDAA 3QG5A 4B43A 3O1IC 1Y3BE 4NHEA 1FDSA 3EUWA 4DY6A 1ISGA 2D0PB 3CRMA 1L9XA 3SC4A 4YNBA 1A7JA 5BQXA 2BELA 4QJBA 1FEZA 4MRRA 3GB0A 3SYKA 3C3EA 4DYOA 2DCMA 2GUWA 2QG6A 3UK1A 4BCDA 2CLOB 2JGIA 2ACEA 1KNXA 1VE1A 2PGOA 3O9VA 2A1UB 3SLRA 2X3YA 2Q4ZA 4G1PA 5IW8A 4IOMA 2CNSA 5JS8A 1RLMA 3JRXA 1AZWA 3WIDA 3QBDA 2XT9A 2ZEDA 3G59A 3GZNA 4BNLA 4GRDA 3UK6A 1A9SA 1RWBA 2H5EA 4TKVB 3TAUA 3MWKA 1WB9A 4LQGA 3AESA 2WIGA 1U2DA 1G60A 1EFVB 2QMHA 3PC4A 1NOIA 3EDRA 5ALHA 2OV3A 3VH3A 3WRWA 4KVOE 3ELBA 4J9UE 4WFJA 8LDHA 1GKLA 1Z8FA 3WYCA 5L4LA 1E3MA 3GT0A 3LS2A 1DEXA 1TRHA 3DOUA 4TVOA 3SSNA 1L8QA 1VOTA 2GD2A 2GZ2A 1LTHR 5BV8A 5KDOA 2C4VA 2GX6A 2LP4Y 4KFCA 1ZEJA 3SJ7A 3WADA 2HLDA 3GVIA 1TUBB 1GR1A 3IVRA 4ODIA 4MV8A 2QVBA 3BSWA 3O94A 4QBGB 1P2VA 2YHIA 5MFPA 1RM3A 3I4LA 3JAWB 3KM0A 3B3QA 3O21A 2IEGA 1W46A 2BY4A 2C9MA 5LMNB 4FOSA 1BFDA 1GGKA 5HIMA 3WTBA 1YK3A 2Q5CA 1K66A 2AEMA 3K4QA 3KS9A 5CFOA 1HZZC 1B73A 5ARDA 4Z4IA 4UJ5A 1A97A 1IVNA 1QAMA 5FI1B 2WHRA 1GA1A 5FNVF 2O7VA 1T25A 3TPCA 2CV1A 1GQYA 3IODA 4F4CA 5DGDA 1I14A 2K7ZA 4IR7A 4C22A 2I80A 1X8KA 1NJ8A 1Z4MA 2H2GA 5DSTA 3OM1A 4ZIRB 5B4VA 4B1FA 2FEPA 8ABPA 1I0LA 4KX3A 3NKFA 5ETJA 4YPOA 3VMFA 4E08A 2PSFA 2CNTA 1R5OA 2HLHA 3ETEA 4TVSA 1N5LA 3T34A 1P0HA 3G5UA 4R1TA 2MMCA 4LXGA 1KTIA 3RUPA 3SP1A 2ZUUA 3LPDA 5CCDA 3AEQB 4GS5A 2GFQA 4RTNA 4C01A 2XOXA 4XCVA 2DMRA 3ZDRA 4LGCA 3B1XA 5AK6A 2HT6A 3U19A 1Q1EA 3CFYA 4Y6RA 3RWMB 4DJDC 2BTEA 2VA9A 3QY0A 1Q44A 3BI1A 3P94A 4EENA 3O8CA 5K8IA 3L9XA 1KYYA 3R3HA 2E5WA 3ZCTA 4KVXA 4JSTA 4PSXA 1ID1A 1AN0A 3OHSX 4XD7A 3TCXB 2F8HA 2AN9A 3ELUA 3VRHA 4BO2A 2SICE 4LNHA 3WICA 4MA5A 5DTQA 4TUYA 2XHEA 2BR5A 2EERA 2Q4RA 4UOZA 1W36D 4AKEA 3TNFA 2D1YA 3MB5A 1NFFA 3OPVA 4JBIA 4ZYWA 1TIKA 3L01A 2ASVA 4NPCA 1JSRA 1KBOA 2IZ0A 2XUAA 5KJ6A 3TTXA 4N0QA 4H1HA 1HYBA 1FF9A 3PQ8A 3RS5A 2GDJA 3L7JA 5C9ZA 3V34A 4EG5A 4PRYA 1J49A 3IFSA 1P2UA 4HDCA 2OLEA 1Y1LA 4KN5A 2FSIA 3TS1A 1TLTA 2OWDA 5DP2A 1E3SA 3LHIA 3V00A 4EGQA 1LANA 4ZCPA 1T1JA 5IB9A 4WTOA 1GAWA 2P79A 1W5AA 2Z5FA 1J2JA 4TRMA 3RW9A 2HPHA 2QR2A 4QBTA 1KI1A 2PM8A 3B38A 4PX9A 3T7DA 4IMRA 3PITA 1BVYF 4YJ3B 3WYGA 5K8CA 3ZR4B 2IFTA 1QM5A 3EC7A 4KZTA 4GXQA 2WNHA 2VF8A 2XIJA 1T0UA 1HPLA 4P84A 3M3DA 3C16C 4KV9A 4AXBA 5JD4A 4MVJF 4HV4A 4NGSA 4OCZA 3EQ9A 1T0HB 1Z73A 3KQXA 7AT1A 2FEXA 1NQOA 3GQVA 1Y8RA 3RYHB 4BDTA 1QRSA 1OH6A 4KORA 1C4XA 4Q01A 4WCVA 2J6IA 3DEYX 1JX6A 3CLSD 4OATA 4XCQA 2KWIA 2AF4C 1V5FA 1AO0A 4XLLA 4LHWA 4D25A 1ML3A 3U16A 3EAFA 3WMFA 5LOVF 3JQGA 4U63A 1N2CE 4NECA 1QWSA 5E1DA 1RHUA 4BFZA 4ENVA 1Q84A 1WW2A 2D13A 4BYMA 3PV0A 1E4VA 5DWDA 3DV0A 3VHXB 2WKQA 1JU9A 4KI7A 4MR8A 4CODB 5A06A 3V4RA 1GGMA 2JLQA 2OXIA 5CG2A 1MEOA 5FBHA 1Y8ZA 4OVKA 4EG6A 3GLGB 5CD1A 3FB3A 1NY6A 1QFZA 4FMCB 4UM9D 2AZTA 4LE2A 1YRQA 4D45A 1JTFA 2WABA 3PEVA 2BSAA 4BGUA 4H7KA 2GZRA 5TY0A 4M1TA 1Q7GA 2WF6A 2ZRLA 3IYLW 3N2EA 3P71T 4UTOA 3W2IA 5JNLA 4MPPA 2XVYA 5T7BA 2Z3PA 1Z4PX 3GJRA 2F67A 3HG7A 3QVGA 4JXRA 3BWBA 4GPTA 4MWEA 3GQBA 2QQ5A 3N7AA 3EK2A 2Y67A 3AHGA 3WBBA 1FXSA 3PDJA 5I9SA 1OIWA 1P3DA 1NC3A 3T7AA 5ILQA 1G64A 1CUEA 3TTHA 4B85A 4F1KA 3RVJA 3DBRA 1KI9A 1I5OA 3FYDA 1EVQA 3AF2A 3SNKA 4AJLA 2HQOA 1CLUA 1UZAA 1NKSA 4RD0A 5J43A 1OY1A 1FP7A 1P39A 1P0PA 1SVMA 2AOUB 1RJEA 2XYPA 1H66A 4MKFA 4XD2A 5LXTA 2NP6A 4J7CA 1P2BA 5A28A 3JTMA 1LRJA 1YIDA 2Q6TA 3OQPA 1IAQA 4CZ2A 1XTIA 5JY1A 5CJ2A 5ED4A 4BMCA 3HYSA 1E2LA 1JEQB 2GNOA 2I99A 3H97A 3MCTA 3OQIA 3BJEA 1YQUA 1D2HA 4LJ9A 3V7NA 3VZCA 4I2VA 2FEMA 3KKQA 2ADMA 5DWVA 4QUKA 4PRZA 1PNVA 4Q24A 2FPWA 3I53A 3DNMA 4XIGS 2FCAA 2JLZA 2CLEB 4JXZA 2F8MA 4NOMA 3RBAA 4CKYA 2R5NA 4AD8A 4DREA 3PCXA 3PEFA 5EZSA 5F64A 3RVOA 2K2QB 3WV5A 3C26A 4KLVA 1IQRA 4D9NA 3E3LA 1V8BA 3DZIA 3P9IA 1R6AA 4WERA 1F9EA 4O4HF 2JIDA 5KNDH 3SNHA 2QT1A 3O8NA 2G9DA 1N2IA 4I7EA 4M86A 1HT3A 4MW5A 4XIYA 1ZK4A 2ZBGA 3SX4A 2J48A 4F9TA 1XZFA 2RHTA 4GOXA 1U2GA 4QOGA 1DELA 4QQFA 4X3PA 3K6KA 4UEWA 2IY7A 4C06A 3IMKA 2YASA 4EAAA 5HX7A 3NOOA 3OOJA 5FPPA 1E62A 2WB2A 2AMJA 1J06A 1LK7A 1DAPA 3NGXA 4PZAA 2GYWA 5ER6A 5JWRA 3ZJUA 2OFOA 3M89A 1NR5A 3RWBA 2DOKA 3D6JA 5AHXA 5BT9A 4UHCA 2EX0A 2XH8A 2CF5A 4M0DA 4RHXA 3Q3EA 5JXJA 1XZMA 1UANA 4IX9A 1OFHA 3FG9A 3GBVA 3HP7A 3KEOA 3M7IA 3PZRA 4L0MA 4BLSA 4EG0A 4MI4A 2JCXA 3H5OA 1AKMA 1V7PC 2VWHA 4URWR 3ZOZA 4DIKA 1PT5A 5CU7A 2ZW4A 2OBXA 2FPIB 3M5WA 3O4IA 1G55A 3NXKA 5C0OE 3WL4A 2RAUA 3RSSA 4ZK6A 5KNBH 4QUSA 3BGWA 3FDIA 1FMLA 1T1RA 4BC0A 1M7GA 5EMNA 1MQSA 1YDMA 2VL7A 2Z2JA 5D8DA 4EY3A 1CBXA 2WYIA 2WAXA 4LV8B 1HE4A 2XCQA 4TVKA 4BXOA 3K09C 5C8YB 4CRZB 1FYVA 1VLVA 1WSWA 3ESBA 5KC8A 5IC5A 1N9KA 3SOPA 4Y2SA 3PDCA 1ST2A 2PX2A 4EELA 2OXFA 3DM9B 4B9AA 2JHPA 1TZKA 5I7EA 3I9LA 3ROKA 5FTLA 3QELB 4RH0A 1QRAA 1GA6A 2A7QA 1ZM2A 2P9EA 1C3JA 1T3HA 4WA7A 5FP0A 1S5KA 3K8YA 3UK2A 1ZLIA 1M9NA 4U3JA 3ORRA 4YREA 1YZTA 3TD9A 1W36B 2EYQA 1Z12A 2K5UA 3QHAA 3CW9A 4MGIR 3O6VA 3R6GA 4AZ3A 5KYWB 3UAYA 4TLEA 4DILA 1CQXA 3A3OA 2B8NA 5EZYA 3A1SA 2CDCA 4C4RA 4E2ZA 4M2LA 3KETA 1LPPA 3LA8A 1KQOA 3MG9A 4DT1B 4RPGA 2OCAA 3MXTA 3P5SA 4N0MA 1AH2A 2D4PA 3D8RA 2DC1A 1HEEA 1Q3KA 2W6JD 1QKIA 2I1WA 4GVPA 1RR6A 1E1YA 1WU7A 2GN2A 3HN6A 1YASA 3VKVA 1UXOA 1Y8AA 4L0QA 2ZS7A 1DAIA 4WMLA 6CPAA 1A04A 2VJNA 5JAQA 2Q2WA 4OKIA 5IHXA 4DC9A 1F3OA 3THSA 4DLBA 1E6UA 4IIDA 4X1IA 5AI6A 1N1GA 2KS6A 2P1ZA 2MYTA 5A9SB 3M82A 3MLBA 1CUZA 4HQ6A 1ZY2A 3GY9A 1M2NA 3GRKA 3QSYA 1PWEA 1H2RS 1QH8B 2B1QA 3EQ7A 4HB4A 3H2IA 5A71A 4CGYA 4EA8A 3AEXA 2QE6A 1KQFA 2D4OA 3AUAA 1M2EA 1LZKA 2HOQA 2OFXA 4UAVA 5E4FA 1BJRE 2Z08A 4B31A 1TKAA 2GWHA 2ZKIA 4QU9A 3W5JA 3ICEA 2WT9A 1PT8A 4CPAA 4ZO6A 5IZCA 1V8ZA 3PHIA 4BNWA 4E15A 2JI7A 4R8KA 1F2UB 2FW7A 1E9DA 3AKDA 4CMHA 1NQVA 2HFKA 4XSHA 1U1IA 4Y30A 3KR1A 1AXGA 4JK3A 1DE0A 4KMRA 4NPHA 5TQ2B 3I2KA 2J9ZB 3IAEA 2I66A 2NUBA 1BLLE 2O5CA 3PC6A 1PBNA 2O2DA 3T9DA 3TSAA 5EXTA 3CVXA 5EJ5A 3PLNA 3EEQA 1VHWA 3A6PC 1CR2A 1V95A 1Y3AA 1NLUA 2H1RA 2R65A 2WJWA 2WSIA 3OZRA 4OK5A 4EJ6A 1VHSA 4MKZA 1Z22A 2R86A 4RV9A 4R2HA 3MWFA 4C68A 1MJGA 3H0CA 5D1NA 4JP3A 4ETNA 1LFWA 3QI2A 1DQPA 4OXKA 5I7OA 2F3TA 2YIVX 3HCEA 2FRXA 4KO8A 5MN5A 3IWGA 4YIHA 3RHTA 1ZOIA 5JYCA 4IDOA 2Q4DA 2H7CA 4FB5A 1HC7A 4IUBS 4EBFA 5E1OA 5GGXA 1QYDA 5JRJA 2FWMX 2AOWA 1RKQA 2FE1A 2JB9A 1E5TA 4S12A 4RNDB 5E3JA 5D87A 5M29A 4M0UA 2VBQA 2B4QA 4MV7A 2BJVA 3LIPA 2BFWA 3A04A 1RHRA 2AD5A 1XTBA 1TJYA 4MUKA 3IR5A 3ABOB 4RD2A 2M6LA 4Y3UA 4MHOA 3WLEA 1OH5A 4I4CA 1AHHA 4YGOA 1N7IA 1Z07A 4YCBA 4YQYA 1P60A 3V2GA 4ZEVA 3SGLA 3FSEA 4OQEA 1U6JA 2X0FA 2GJ8A 1XZPA 2O59A 4QC6A 1TO6A 4C7MA 5AW4A 2H4ZA 1Y3CE 3UNXA 5YASA 5ILGA 5IP5A 3HCCA 4C9BA 4XW2A 4QGSA 5I47A 3PUVA 3AEUA 2BGNA 3RYTC 1V4BA 2PJZA 3T94A 2V6IA 2D0IA 2C8KA 5AD1A 3C4JA 1RQXA 3WB2A 5B1YA 1GZ6A 1IZYA 3EG9A 1YJQA 1R00A 1MG5A 1C8VB 2E18A 4J0HA 4AJOA 3O7MA 4RZ3A 4TTPA 3WLAA 4F04A 2KBFA 3Q5EA 5ICEA 4X65B 3FSRA 2NMVA 3CC8A 2H1LA 3MGGA 4F46A 5F9FA 4ROTA 1AYEA 1I1QB 2N0SA 2XZDA 3QXGA 4JQCA 4L4RA 3PFKA 5JNSA 1JQJC 1I10A 4B3IA 5A4MS 2G71A 4R7MA 1H8HD 1E2QA 3G2NA 4PXBA 4HLCA 2XMRA 2YL2A 2KHZA 4U3JB 5KWIA 2O1SA 3PB8X 3DMFA 4XTCS 1FPMA 3CB4A 3DWFA 4CTJA 4KV7A 3JW8A 2JG3A 1U3VA 3K0FA 2BSQA 3EEYA 5CMLA 2PBRA 4BLPA 1FYWA 3PPXA 3AO0B 3ZKWB 5CXUA 1NM5A 4PIMA 1TKJA 1M73E 1HURA 3AF4A 1J2UA 1DU4A 1G3RA 3DH0A 3HH8A 1Z56C 1C0IA 3M83A 2G9VA 3NFYA 5EMJA 2X5XA 4DDHA 3R3UA 4RSGA 1C1DA 4IJ6A 4ZVPA 2ZENA 1EX1A 2OHVA 4OA5A 1QG6A 4S24A 4HY3A 3LGXA 1S3GA 3N3BC 2XY4A 3BH7A 1O0BA 1MW8X 2BI4A 4FR0A 4H3HB 3ZDZB 1HLPA 3U37A 4X66B 4QBJA 3TLMA 5EHIA 2QV7A 3GMSA 4DUYB 4WIAA 3ZHRA 4TZ0A 1P3JA 3JSAA 5GADl 1N71A 3JD1A 1AB5A 1P7YA 4PTZA 3HADA 2Q49A 1IU9A 1I1DA 1YVDA 1ZUIA 2I8CA 2R8ZA 5ALFA 2AN5A 1G21A 3AONB 5JSYA 3NHBA 5CXXA 5AHOA 1RPZA 1PCAA 5JXWA 2AJDA 5HF5A 3Q3GE 3MF4A 4HI0E 4CGLA 3GI1A 3GGCA 2BFDA 1JHUA 4U9HS 3GEPA 3W7VA 3N2KB 5ED0A 4DCOA 2NN3C 3AC0A 2NU8B 1D2AA 4ZK2A 1GTG1 4KHZA 2IE0A 3R9GA 4F1WA 1PQPA 1Z9UA 4BO9A 1JPNA 3IBCA 2PUEA 1EFPB 3LA6A 4P4GA 4M99A 2CNDA 4E7PA 5CLJA 2IVFA 5AUQA 2Q9UA 2ZRPA 1YE8A 4M7PA 1YKSA 1QCYA 2IK8A 3VHLB 3ZZUA 1KSJA 5AHWA 5T41A 4R01A 4P32A 2CBGA 3H1BA 4UVEA 1NQWA 5EJ8A 2R97A 5JFTA 3ZTWA 5KKAA 1RKBA 1US8A 1SPXA 2FGJA 4EY7A 4MCRA 2PGXA 1PF7E 4P82A 4GO1A 4H6WA 1XBUA 4IBOA 1BXGA 2IF0A 3HMKA 4FOPA 1LFAA 3PRYA 4RLHA 4I1VA 2JHGA 1ODSA 1N2SA 4KFTA 1WUJS 4S04A 2V6JA 1I0ZA 1NQ5A 3VVBA 2R6HA 3MNFA 2DXQA 3U09A 3FFBA 2HUZA 3HBFA 2JK1A 1OR8A 2Q4EA 5IXSA 5P21A 1NLYA 5C5CA 2YIJA 2AW5A 2A92A 3Q9UA 4AO8A 4A0QA 4C2BA 2ZE6A 4E6PA 2RC4A 4A0SA 5B7NA 3P9KA 1TB4A 4OX9Y 2BP7B 5F4ZA 5FUYA 3D3JA 1IN1A 1E1CB 4UJ3A 1TJNA 3AF0A 3CXRA 3STTA 4EB3A 5C4IA 4HH3C 4DLKA 4FC7A 4Z4HA 1J0AA 2Z8ZA 4EQZA 4B35A 4YFJA 4H7FA 1JYEA 1A9ZA 2YNDA 4V2UA 3EPJA 1QK5A 2YJZA 4HMOA 3NBUA 4U8GA 5AYVA 1K08A 4EYQA 5FLEX 1QNFA 1A8HA 4P4UA 2JLAA 3S6JA 1ZJYA 3N0XA 2Q1WA 2CNNA 2VXOA 1ONOA 3A6GA 5FBKA 2QQFA 5DGXA 4MQ4A 2QR3A 2HKIA 2WTBA 4Y2RA 4E6EA 1X19A 1I7PA 5GTDA 1P7WA 3PUWA 4FZVA 2BUBA 4ZV9A 3A1CA 1PFGA 1PBTA 1T9KA 2ZUSA 1DIRA 1C14A 3DWGA 2VUIB 1FZQA 3H9BA 1FP4B 4P6VF 3AEYA 5JZBA 3TIGA 4RPHA 5AK0A 1LPAB 3UC9A 1H5NA 3OIYA 1CQIB 4KGXA 5L53A 4WN3A 2MJLA 3WP0A 1ZM9A 9ABPA 2OPHA 4NJMA 4QXMA 3K20A 1M34E 3GCZA 1PDVA 1ZJWA 3HBLA 1G17A 1M0EA 1JEAA 1TVKB 1QHEA 2VHZA 3SC2A 2SKCA 3CZAA 4RDXA 4DOMA 3ZQKA 3IAHA 2VP6A 3KD2A 2JLCA 1Z0DA 3GLHE 2OO5C 4X7BA 3PFEA 2QMQA 1ZU5A 3RAPR 3ND9A 4AP6A 1AKVA 1OIXA 5JCZA 2CD7A 2IEIA 3K0CC 4LXQA 3G2PA 3HHPA 5H9VA 4D6PA 4H4DA 3HB7A 1XQWA 2V7XA 3QKWA 5BT8A 4O4JB 2OQ2A 1FRQA 3BILA 3GN2A 4QUDA 1IY1A 4K9NA 5HJEA 2C7QA 2LXNA 1Q0ZA 4TL6A 3IWEA 4JOSA 4QECA 1M75A 1C3OB 3M1IA 4UU1A 4K8RB 4DM3A 3PHHA 2I2CA 4CGNA 3UJ7A 1JILA 1RWVA 4FEEA 3SF8A 4MEBA 5BNIA 1SKYE 4QX6A 3SYNA 4EMUA 1LW6E 1U5BA 1WUHS 4MYUA 4HDOB 2QUHA 4Z3OA 5J4LA 3WOHA 3WTCA 2PKRA 2PJ8A 3PC7A 2C9YA 5AH0A 3JCZA 2Z6UA 3B9PA 3AM3A 2WINI 4LRQA 1PQWA 1OX6A 3DLCA 4CFYA 2D74A 4QXAA 3R3ZA 1I1OA 1GU1A 4KSYA 4N48A 3FTNA 3IAAA 4YWHA 4ZEWA 3UENA 4CQMB 2XD9A 4HZIA 1Q77A 3H8FA 3NHAA 4LHEA 5ESDA 1CB7A 1H2AS 1RRMA 2JZNA 4CIAA 1KK0A 1ZMRA 2JAQA 3S55A 5CXQA 3QWHA 4IHAA 1W36C 1SJ9A 2HY7A 4UULA 1W0KA 4UPDA 1JA9A 1LWNA 3ZV5A 4LHVA 1PUXA 1EWTA 3QKRB 4LIPD 5DB4A 4NG5A 4B82A 1IIBA 5JD6A 2ZEFA 3DTNA 1L4YA 5A05A 2VP9A 1UJ5A 3AG5A 4IX1A 4DSUA 2Z5GA 2OZUA 4J0KA 2Z3NA 4MHZA 4UCXA 4Y9UA 1BCRA 4GICA 1OHHD 5J2TA 2ZUCA 3A9CA 3WHLA 4UTNA 2W8BB 3Q41A 2J0EA 1RSZA 2PA3A 2QAIA 3A6JA 1AO3A 4MQBA 3VMMA 4AMYA 4F5DA 1TK2A 2WR8A 2JBWA 3HU1A 1QIKA 4HWOA 3E7PA 2G1JA 4YO8A 3UJDA 1OPXA 1N5DA 3QH4A 2VVTA 2NPIA 3T1VA 1ZNZA 3PJDA 3WMWA 1GN8A 4F0JA 1L9KA 4PE5B 2P5UA 4Q18A 1ODTC 4D46A 3CKKA 1UJMA 3RUHA 1X38A 4UE3S 3IKLA 1P0CA 3DVRX 3QITA 4B3MB 2I4LA 1PVDA 1F17A 3COPA 2MDTA 2X3FA 5AVXA 4HQFA 3IEHA 3ER8A 3NEYA 4R0MA 3IWWA 2Q29A 4IYJA 5F1OA 3IHKA 4I4LA 3IXQA 4DR1B 4G97A 1J4AA 4G5SA 1E2EA 1EGAA 1Y6QA 4KPUB 1MB2A 2PAFA 3CF6R 3C15C 1A69A 2W4QA 5BW6B 2XZPA 2OHXA 2B5GB 3ADOA 3HB9A 5JJ5A 2I6FA 1QP0A 4I08A 3B3TA 3KHSA 2OWEA 5EPOA 3GMDA 5TQJA 2AEFA 2J6CA 4HQLA 4EHDA 2EDCA 1G3IA 2XI4A 5GGYA 1QB7A 1GFWA 2BGMA 3DMTA 5BOVA 2RB4A 4OO3A 4LV6A 3QJ5A 4DC1A 4Z7NB 2PDOA 4TM8A 3DAGA 1OLUA 4UATA 3U6KA 1Z6GA 4F21A 4OQDA 3QBJA 2WFZA 4OHPA 3ELYA 1EFVA 3E2MA 1ZM7A 3PHJA 4J6FA 3DMYA 4BHTA 1NG9A 4IVQA 1R8QA 1FP1D 2NACA 5LLTA 4E0BA 4O4IF 3L0ZA 3NG1A 4IHJF 1X42A 4WKPA 3TO6A 2VNIA 4N54A 2QGNA 5DVZA 3UKDA 4LSZA 3WLLA 2C2GA 4JL5A 3N2NA 5H70A 1TU0A 1A8QA 3SIXA 3DNSA 1E20A 1W88A 4GGPA 4JT4A 4AW9A 3OQMA 4WACA 3IEMA 1J70A 3ANXA 3UJNA 2PD3A 4LZJA 4F60A 5CX1A 3PPWA 4CM7A 1J8YF 2WM3A 4UNPA 1DKUA 3PNMA 5FQOA 1GYQA 4CYOA 1ETHA 1Y89A 3LCMA 3OOHA 4GR9A 4I9UA 5F7XA 3TCNA 3AIKA 3LT5A 1DIAA 5ESXA 3HCOA 1MMFB 4AULA 4ZJYA 4AKGA 3WWOA 2C97A 1XNHA 1YOBA 4Q4AB 5FV4A 1GPH1 1QHSA 2ZAYA 1K6IA 3H99A 3MMSA 1PL0A 4DG8A 5HP4A 4YDHB 3DDCA 2I3DA 5KTDA 2Z9BA 4BPRA 2PPLA 3OPQA 1PO7A 3RAEC 1XRJA 3NP7A 3V8BA 5E7JA 3ICPA 5B4TA 3E9EA 4BTEA 1XT6A 5GINE 1TO1E 5CDFA 3GIUA 1P4RA 1AGYA 1NQUA 1O9HA 2R8EA 4WLUA 1H65A 3W5IA 1ILEA 3URMA 5DHQA 2BE7A 4JP5A 4OD0A 4GBED 1I12A 5F12A 4NMWA 1Z16A 1FLAA 2E82A 5IJ9B 2QVGA 1NVBA 2Y8EA 2WJAA 4NBTA 2XIQA 2IEYA 3R3SA 5DHTA 3KEMA 1EZZA 3NKLA 1X0XA 4G2TA 3VTFA 2ANPA 3WHIA 1MXHA 2JFYA 3KTAA 3SXUA 4EWLA 1P77A 3I3OA 3A1FA 1QKKA 1PI3A 4OHCA 2Q2OA 4QU5A 2CLSA 3TIFA 4E5YA 3U5ZB 3ZHSA 2VPQA 4E46A 3AVXA 1L7VC 1QIHA 3I01M 3OJOA 2ORVA 2PY6A 1UZLA 3ER6A 1FFGA 2FVGA 4QA9A 1Z33A 4YRDA 1PYTB 5H82A 2AX3A 1JR4A 3LT4A 3OTGA 4ZT4A 1UUFA 2OO3A 3CHYA 3CPJB 2C2OA 3BXHA 3CZ5A 4MKRA 4CI0B 4NCZA 1N2EA 2JGKA 5D1HA 4BKMA 3MGAA 5CVVA 2DPSA 1RXTA 5GZ1A 2RC6A 3B5JA 3HCPA 4WQMA 1X7XA 2D1FA 5JJKA 2QTHA 3L8GA 3NBQA 4WNYA 1UFRA 3IJ5A 3AP1A 3VPBA 3L46A 1E7WA 2HCBA 4FYYA 3PQ3A 4ID3A 5KYKA 1NBME 4B6GA 4UVGA 4YAKA 2PWZA 5C81A 3IOBA 1QOQB 2AH5A 2FSSA 3AVTA 4MCQA 2PZFA 2QW0X 3ZU4A 1Z5GA 5BV0A 4UBMA 3WXMA 1ZKMA 3H84A 1PJ8A 5BNWA 2HXYA 3PC8C 3QNVA 1O6GA 4GP9A 4YONB 2QN6A 3UJ9A 4JUDX 5DBIA 2VRCD 3JQ6A 4MAAA 3LFUA 1UJ4A 3QG1A 4TMTA 4EVQA 3G6WA 2ZRJA 2GA9A 2PC1A 2DAPA 3R9FA 3I6QA 5FWYB 3ZU2A 4BRZA 1QSGA 4K2HA 4LFAB 4WJBA 3GVHA 3QKSB 2VJBA 4R6TA 2FWIA 3SHPA 4M88A 4B40A 3O0DA 4ESOA 2ZIUB 3SJZA 2YVAA 3CH7A 2ZEJA 1TADA 3X2EA 1WTAA 4LHYA 1K8RA 4LAFA 3WGGA 1KIMA 3GRUA 4FD4A 3R9XB 2CC2A 2AUMA 1NVVR 1CM0A 1VGQA 3Q8XB 3JYNA 4H7EA 2R5FA 6AT1A 1U0BB 2JAWA 3BG5A 4CLXA 3H9EO 4BL5A 4II7A 3TK1A 5C1IA 1IRIA 4PWYA 3CJRA 3O83A 1KF0A 5GVRA 3AR9A 4D9CA 2I3ZA 2XYHA 3O4GA 1RI1A 2A67A 4IFEA 3KKOA 1HG0A 2OHIA 1MW9X 3PA6A 2G3TA 4M53A 4WLEA 2OK7A 4IDHA 6NULA 5C52B 2J1LA 2FUG1 3S68A 5B7GA 3FCCA 1FYEA 3F3SA 3LV8A 2ZOFA 1WU8A 2PRSA 2NU7A 2C96A 2X4LA 1Q7EA 3UBMA 3WJ7A 3LWDA 5J23A 5AG6A 1UBRS 1VTKA 2WPDD 4I5IA 1O54A 3S2SA 4RY8A 5AVVA 3JVEA 4U9UA 5KHAA 4ECEA 2VT3A 4Q1AA 1PFUA 3RAMA 1V6SA 3A9UA 1E89A 5AOCA 3IKTA 3GEMA 1GGHA 1P4SA 3OFJA 4L8YA 1K92A 2IA5A 3GH3A 4BNJA 4C76A 3MOGA 3EGDA 2CXNA 1PV1A 3R0ZA 1TCCA 4PG7A 3L7AA 4HDNA 1Z5UA 3S70A 4C0WA 5HM6A 1UH5A 2HB6A 3R8CA 4RJJA 1RHJA 4XWTA 3U39A 1RRCA 1AA9A 1QSMA 4YJKA 3OFND 2YR0A 5BRNA 2R1VB 4LRUA 4WZ6A 5F7ZA 1GNTA 5D5QA 1DKPA 4RMGA 4HHEA 2JJ2A 2CB0A 4NCIA 4DQKA 3GEDA 2EWWA 3NR2A 1HFJA 3UZUA 3GFTA 1Q2UA 1B16A 4KLRA 3ASZA 3P9PA 1LU9A 5BPHA 4Z1MA 3KZKA 3FBUA 1P1CA 4AKIA 5B30A 1ICIA 1NPTO 4HH0A 4QL3A 2F43A 2QZPA 5FADA 3VR4D 1JLLA 4BLTA 4EYGA 5K8UA 2WT4A 4Z3DA 1KO4A 1Q95A 3JAKB 2E4VA 4RL6A 1N78A 3CWCA 3CT6A 5F49A 1UZMA 1FUIA 4DMGA 2H4YA 2UVDA 2X2PA 3A3YA 1VHTA 1QR6A 3A3KA 1T8TA 1VZ2A 1IY8A 4M1ZA 3V1TC 1QQ9A 3ZZIA 1USIA 4OEHA 3WKBA 1GRNA 2OOKA 5B3KA 1M5RA 4H77A 2AE1A 2P2DA 1CJTC 4NGMA 1AKQA 4LXUA 2Z6AA 2ZEHA 3F1LA 1VXRA 2FV8A 3ZNOA 4QQRA 1OAOA 2BYTA 3Q88A 2XMZA 4Q3OA 5AHKA 5HHTA 1OFTA 2UXBB 2XGOA 3BCHA 1Q0LA 1VJRA 2BE9A 1SC1A 2ZXEA 4OQZA 4LYDA 4C78A 2RGGA 5CA1A 3ROTA 5LYLA 2XDWA 3R09A 4QGAA 1MJHA 1XMXA 3IOYA 1ADYA 4MUGA 3EPHA 4BTLA 3V1YA 1XB2A 2E4YA 3R6TA 2H3EA 1FY7A 5C37A 2QG4A 3ML1A 4L7VA 5U4QA 5IULC 1GQSA 2EBJA 2PT9A 3WKEA 5T3YA 1R8SA 3FR7A 4RJKA 3M6VA 1R66A 2BOVA 2LWIA 3K16A 4YACA 4D44A 2WHQA 3IBYA 2X5JO 5DI9A 2ABZA 1PVOA 3ZTTA 3HBAA 3JASB 1XV5A 2B8WA 3ZGVA 4E2YA 3C7DB 1DIGA 4ESEA 4KUBA 3G8YA 2R44A 3H4VA 4KLZA 3PB3A 2A2ZA 2V7QD 2J9GA 1MO3A 2BMEA 2BM8A 3K0FB 4LY9A 1X9GA 3O3OB 4UXIA 2RFHA 3HEBA 4PSDA 4RA6B 4DV3B 5KYYB 3KSDO 2Q04A 1SZPA 1QZUA 5H80A 3G02A 4I4IA 3BXEA 3C1AA 6ADHA 5EE9A 1O03A 4J0CA 5HQ3A 4ONWA 1Q6YA 1CULC 4P53A 3LCVB 2ZB2A 5IAEA 1N2GA 3LPNA 4DB4A 1XEXB 3GEBA 1GKUB 2IF2A 2FU5C 1CS4C 1SM4A 2QTGA 2YW2A 3LL7A 3VYRB 2RMKA 1PG5A 2BH9A 1JQGA 1ZISA 3BPSA 2ZE7A 1KFBB 3NB0A 1M1ZA 4J0QA 1GPMA 1W581 1CZRA 4BNXA 4G01B 2WJVA 3ORSA 1KZFA 1VMIA 1FJGB 3RBZA 4ZHSA 4RVHA 1EUCB 1U8EA 2FRVA 1ULBA 5BR1A 1M4LA 1AIPA 3FMVA 3PBKA 3TNLA 3RWOA 1Q3TA 3UTDA 1VJCA 2YHSA 1NVKA 1ZW1A 1C1XA 2R6ZA 5IVDA 3T15A 4BQIA 3IIMA 3ADBA 1G291 1EK1A 1QHXA 4Q34A 4KQEA 2AHOA 5J2TF 3RFUA 2B61A 4QTUB 3K0SA 1FMTA 2AGVA 2YC2C 3HZHA 3WVNA 4ALMA 2E5LB 4RY2A 1E1MA 2EJTA 1ZSNA 3WK8A 5KU1A 2WWXA 5CDHA 1L8OA 4MI9A 1V1MA 3U1BA 1UKYA 1Z5ZA 2OGWA 2ZYDA 1NHGA 4MHSA 3UOWA 3KR4A 1TKRA 2YCBA 1OREA 5DMXA 4BGVA 1X14A 4KWHA 1YRHA 4QD3A 4TYYA 2JLRA 3KAQA 5DULA 5KQRA 1MB9A 1TVCA 3CURA 4KH1A 1Z6XA 4ND1A 3OZBA 1VL6A 4OGLA 3ESZA 5BNFA 1A9OA 2VR1A 4M83A 4UKDA 4EI8A 2G88A 5EUMA 4ZVLA 5IDYA 3DGFC 1KE1A 3H5LA 5KUTA 5ARCA 2WU0A 3DQPA 3RASA 1OX4A 5B58C 5KTTA 1OB5A 3HY6A 4OB7A 1D7OA 4UWIA 2WMDA 5AW5A 1GR0A 1IBCA 5B3JC 1ZVQA 4RK6A 3O75A 4MNTA 3EXFB 4J0DA 3OCJA 4G5RA 4C03A 4DCSA 4ITUA 1X2EA 1XEWX 3G1TA 1BJKA 2QMUA 3OE7D 5CGZA 1FU8A 3MGDA 3KE9A 2PRJA 3KTAB 4AMZA 1KFCB 4D02A 1BDMA 1NJSA 4EKYA 4K0KB 1WK4A 1Y9DA 4U8HA 2YS7A 1YMEA 4OQLA 5U1PA 1VGRA 3BK2A 3K2EA 2VQEB 4JR2A 1ZO8A 4MUNA 1CF9A 1SPBS 2WSAA 5E6SB 4M1YA 4MLPA 4BJ5A 1O94C 3U3XA 2L69A 1V8FA 1WMSA 5CDFE 2EFEB 3HJUA 1ZFNA 3U4GA 3L3BA 4CM5A 1CF2O 3EZ2A 5K6AC 2VSXA 4QB9A 4HFMA 3QFFA 4A4DA 2ECKA 3CM0A 4QZVA 2L19A 1OWNA 2O0MA 3BBPA 2AKAB 4P8RA 4RMHA 2ZBQA 2PE5A 4JDUA 3TRFA 1YCFA 3BICA 3H0EA 4Y0VA 4OM7A 2EKQA 3WRYA 3FSGA 2Q21A 3QXSA 5HMLA 3HJBA 4LUAA 4PXAA 4GI1A 2O8DA 4ISCA 10MHA 1E2KA 1F14A 1RWXA 4PY2A 1QCZA 2ERXA 4ZAXA 4CMIB 1YO6A 3ABRB 2QV0A 4JI3B 1MVNA 1S8AA 2JJYA 2ZK7A 4QOEA 5HZMA 3CQ9A 2D1RA 4EW3A 2LTAA 1Z18A 1QIDA 1D6NA 4WNIA 2Z98A 5JZMA 3GPLA 2G0BA 5CA0B 4MUHA 2FTKE 1THGA 4X54A 3QTLA 1YW4A 3DLJA 2Z30A 3PP9A 3PXEA 1XZHA 1IICA 1JT9A 3MRSA 3WZ2A 5FHRA 1P9OA 2QRHA 3GGOA 4Z7OB 4J90A 1SC9A 3EVAA 3OTQA 4B2LA 3IUMA 3NAQA 4G0PA 5FBZA 3RHSA 2VDQB 1Q12A 3REQB 4HVCA 2DTXA 2ISQA 2EC5A 2PDAA 1VSQA 3D3EA 4Q1EA 5JAHA 3K4HA 4HJXA 1XLTA 2PEZA 3F90A 4Y6PA 4TPKA 5J63A 3WLOA 5HR5A 3LBFA 4XH9B 5DIZA 1T3TA 2A1TR 5G20A 3AHHA 3D8PA 3T4XA 2JDIA 2VJMB 3BOSA 3IO3A 4IDFA 3D8BA 4LZWA 4NOJA 3SY8A 3CSDA 4BQRA 4EHBA 2PR8A 5GV7A 5KEIA 1EE2A 4J29A 2OXTA 4B6QA 3N76A 3P0JA 4RZXA 4ZC8A 5J40A 3TLGB 4C3VA 2VBIA 1H0KA 2IYFA 2QD5A 2C7VA 4Q3BA 3EDMA 3OO0A 4I5FA 4I0WB 2ZKLA 5DNAA 2J45A 3JUWA 3GY0A 3NUQA 1MV8A 2Q1UA 1JDUA 2WG1A 3WV4A 2O8BB 2PSWA 3DTVA 2WPXA 2O7SA 3TBHA 6CHYA 3HDYA 4IG9A 4EG1A 4OTZA 3D5TA 4PZLA 1UQRA 1QO9A 1N8SA 1KAHA 3JR7A 3UAOA 3UJBA 2Z10A 3ONFA 4DFDA 4BNHA 3M4YA 3WBKA 4D9MA 4ZI2A 5CYGA 3DZCA 5J47A 1YJAA 5PGMA 1UBSB 4N0EA 4FYHA 4AXXA 1F7UA 4OC2A 4M1KA 2PRQA 4G85A 2BW0A 1UFQA 2ZBEA 3B3AA 3DL4A 4DUPA 4B5OA 3IEIA 1U2QA 1S0UA 3L5KA 3OE1A 1XZJA 1DIOB 3QPCA 3EZGA 1FRFS 1IULA 5GOZA 3VR2A 3Q5GA 2C1EA 3JWIA 2C03A 3DOOA 1FS5A 2BMWA 2P9QA 1R27A 1QG4A 5G0VA 3ZWXA 4QDXA 3THYA 3PCRB 1H6BA 3KX2A 4JJEA 1MG0A 2J0UB 3D7LA 1FP6A 3Q1KA 3JVIA 4JYWA 4Q4JB 3L8FA 3MS7A 3STWA 4ZI7F 5EJMA 3Q7RA 1NXVA 4RGBA 3EMDA 5G0UA 5TPZA 1RCUA 1FFWA 3NC1C 3ZWPA 1DKNA 2AB0A 1Y3DE 1Y4UA 3U4AA 5DXFA 4A8PA 3T1TA 3BCRA 2ZJBA 4CMIA 1MABB 1L5WA 3JWJA 2P4HX 5SV2A 2IIBA 4DR7B 3EY5A 1K6MA 1T5BA 4I55A 4N4AA 4IDBA 3FLMA 1NJ2A 3G0CA 1QO7A 3DOFA 1IC6A 4LE1A 4MWSA 4URZR 4D0GA 2Q3BA 2H2DA 2Y0BA 2Z5VA 1XZAA 2CEAA 3DAYA 3CA8A 3H9UA 3L05A 4BNYA 1H23A 3L6DA 3LODA 3W04A 3BAZA 3AVOA 4MH0R 2P5TB 1LOKA 2JZCA 1BQ3A 2GCNA 1V8PA 2IUFA 4IIBA 3VR5A 3SMQA 1UBLS 2VOJA 4QGHA 4K1XA 1N3IA 1OVMA 3UHPA 3VZQA 3L82B 1EJ2A 2GVZC 4MMXB 2HBZA 4PU0A 4PZ9A 4Q6WA 3U9SA 5ABPA 5KO2A 5IS2A 4FBMA 2I8AA 1T0JB 5FI5A 1IBMB 1CRPA 1SKQA 4LVCA 2JW5A 3SZGA 2X6TA 4DVGA 1YH3A 5KJCA 1N2CA 1JTEA 3SG0A 1K7YA 3UCFA 1IJEA 2BM1A 5BP7A 4RZQA 3FWKA 3UAZA 3L49A 1XGKA 1SNYA 3WJ1A 2H31A 4KVZA 2RI6A 3LKZA 1ORRA 3UGKA 1GITA 3MQ4A 3OT4A 4TV9F 4V03A 2EZ8A 2GILA 2PBLA 3PD1A 1E9EA 2AC2A 1DX9A 3PGXA 4GKVA 4WZAA 4YROA 1L4UA 5F4BA 4QG3A 3CPXA 5LYJB 3IAXA 1QIFA 2IYUA 2ZDHA 2HWKA 2EQ5A 1A7AA 1VJ1A 1UEIA 2DHRA 1Y8QB 1YS7A 2O2GA 3SBDA 1OX4B 3E15A 2WZNA 1N5IA 4H7DA 1RC8A 4KYVA 3EIWA 4MCHA 4HLDA 4R1PA 4GRAA 2NUTA 1CDDA 4MI1A 2QVLA 4J4HA 4TS3A 3P1JA 4Q3NA 1XQ6A 1JR3D 4NWIA 4A6DA 4NBWA 4PXYA 4C5CA 4FNOA 4XWKA 3KEGA 5T4EA 2EBHX 3IJ3A 2JJQA 5BN5B 1F3LA 2C8JA 1EFDN 4G5GA 1ZYUA 1IBRA 1Q7CA 1QIIA 3OUTA 3NV9A 1GPBA 1ZW6A 2X8AA 3VZBA 1AY0A 2R79A 4JT9A 3KVRA 3QKRA 4Q4HB 4NX2A 2ZIVB 1SKMA 3P2FA 2CUNA 3ESCA 1SG9A 3HHEA 3OHPA 3V6MA 3B1WA 2LUOA 2BZ0A 2X4DA 4LDRA 3NQ41 3BE8A 4UBKA 4HQOA 1GNQA 4U0KA 3S1AA 3ISJA 1PN3A 3M6AA 1TAUA 2G9NA 3JWGA 5TT1A 2Y1CA 1H93A 4OFXA 1I2BA 2IOFA 1NI4A 1G41A 4MRPA 1KJJA 3TFOA 1OV6A 1CEEA 4AMUA 2IHUA 3NFRA 3O2QB 3L7KA 1Q1BA 4QNNA 5AKYA 1P6XA 1JIXA 1RTTA 2HSZA 2F3UA 3CVJA 3HKDA 3P4XA 2PXHA 4IQGA 4KAFA 3SS9X 3UAGA 2FUCA 2XMCA 2GUGA 4CKEB 5DGTA 1TKCA 1PZEA 4I1IA 2CFTA 3KKZA 3UOGA 2C9DA 3OLQA 3STHA 3HYCA 3STUA 4M9QA 3TMAA 5HQTA 3W79A 4V24A 2GN4A 4KJZA 1E6EA 4OHUA 3LACA 4EEZA 2QLFA 1X1CA 4H27A 4KMOA 5K01A 2ZVJA 3WJAA 5I3ZA 1QQ7A 1V1RB 1NDUA 4JL6A 2VLIA 3FX6A 1RC1A 2OE2A 2IY8A 2QI9F 4H3VA 1IRXA 1MJFA 1KJ8A 1G6HA 1YBAA 2GM5A 4PAWA 4XQEA 3A9LA 2P0YA 1JPUA 3SSAA 3B7PA 1DXOA 2Q5QA 4KACA 4OU5A 5JNRA 5I7HA 5DTRA 1II8A 1MZPA 1JEYA 2GBGA 3GT4A 1XD8A 1H85A 3P26A 1KZHA 3F7TA 2ZB7A 5DEIA 4L27A 1R7RA 2X40A 1UPAA 4MS3A 3UKOA 3KQWA 3ZLJA 1WZCA 2V6GA 1IIRA 3T1OA 1O95D 3D3NA 3EDYA 4ZQCB 1U6MA 2GPWA 1KMHB 5B5SA 2CYBA 3B5IA 5EIAA 3Q9LA 4KR6A 3S40A 4S35A 1XRSB 1BQ4A 1KDZA 3THOA 4D6XA 5AQ1A 3IERA 4RUHA 1G2PA 3I3GA 3BK7A 1W4BA 2K87A 3P9YA 4UBJA 4YRTA 3AUUA 3R3XA 3D8TA 4B81A 2FPRA 1HA3A 4UHFA 3ZYZA 1O8CA 3FIXA 3H4QA 1M2VB 2G7ZA 3CZQA 1GXSB 3LUPA 4C5AA 1OASA 3HJRA 1YA8A 5JDCA 4RO0A 2J8ZA 3LW7A 4A15A 1GGEA 4R71A 3WRVA 4R2XA 2X0RA 4PC3A 4PO9A 1OBRA 2DF8A 4X85A 2P27A 4ACBA 4NTZA 4DBLC 3ND7A 1QTQA 4V0KA 2QGFA 4D3SA 2VPXA 3K0HA 3PI7A 2PWAA 4LJAA 3PX3A 2ZR8A 4DIBA 2Q7SA 5LQNA 4A0FA 4N47A 1G6KA 2I3AA 3D0KA 3HRIA 1QLHA 2R5WA 5L3SA 2EJVA 1QLWA 3AV0B 4YRSA 1YR0A 2PJ7A 4IJMA 4RHUA 3H83A 4RHYA 4WK4B 3VR5H 2QGZA 4R2KA 4CKWA 2B34A 1U94A 3WGLA 1N2BA 3C3CA 4BNFA 2HQYA 2XDQA 3JV7A 1KDRA 5FUWA 3OSUA 3SHQA 4PYLA 3TIVA 1GJRA 1MFPA 3TMYA 3QV2A 4H7IA 3VVCA 4ND5A 2BEWB 4AG7A 1C30B 1OBOA 5I9TA 1NN0A 5AVKA 3PQ6A 4ZHQB 3GLUA 1UBEA 1LLQA 2Q07A 1CCWA 1JIJA 3PUZA 1QUEA 4K88A 4N65A 4ZVRA 4CKCA 4REOA 3IR6A 4HUJA 5FYDA 5HIIA 5K8LA 3O8OB 4MIOA 1ND5A 2BD0A 3TBKA 3QLUC 1E6KA 4BKUA 1QPZA 4E13A 1B8OA 1KEEA 3EODA 1OC4A 4LCBA 4XFKA 1MAUA 4ZT5A 2A1IA 5TS2A 1MQAA 2PRYA 3KPWA 4X6LA 1JQ5A 1YS4A 3R75A 1Q0PA 4TWZA 1Z2DA 1E0DA 1YDEA 1FUKA 1HE3A 3BD9A 3BCSA 3PL1A 4ALJA 4ETWA 3EHEA 5K0SA 2DQSA 1SA0B 2GZDA 3B1FA 3P96A 4R1OA 3L1IA 1U3UA 4U7GA 5LL6P 2I71A 3RF6A 4B13A 1G5IA 1OFUA 4PLPA 3QF7A 2YMPA 2GK6A 2IBMA 5FQNA 3JAMA 2AZXA 3D9QX 4EA6A 4C2TA 4TWIA 2DT8A 3W9UA 2WEKA 1I7LA 1YR7A 1EIWA 4BLWA 4L57A 3OIDA 1K9SA 1Q91A 3F6SA 1P5FA 1Y9JA 3LBAA 1WB4A 1T6YA 4WVLA 1DKLA 3IIJA 3IUQA 3PPVA 3J81k 2R751 3FHLA 4IVRA 3EVTA 3HBJA 4PEVA 3ZE8A 4B6JA 3LQ2A 3MSCA 1ZLHA 1VPVA 2XDYA 5I9MA 2QB5A 4DYVA 3UMMA 1S2MA 3GPCA 4DEVA 1ZSVA 2O8VA 3GRRA 3LCJA 2EX1A 3T4UA 1TEZA 3NDJA 4QAQA 1MK4A 1M8GA 4JN6B 1T6NA 2O2YA 1LPOA 3GT7A 3QRWA 3R0VA 1RD4A 4RVNA 4G0UA 2PD4A 4X8LA 3ADKA 2YZ7A 3I6YA 4TX1A 4XPLA 1DBSA 2D4HA 5LMUB 2XE7A 1TRKA 4G56A 2X76A 2OV8A 4TS9A 4EHIA 3KKNA 1QOZA 5K4HA 4H6ZA 3QE4A 4RMJA 4M9UA 5A1JA 5J4VA 5H02A 4OC0A 2PVSA 3G8WA 1H42A 1UK6A 3TSYA 2WMOB 3RC9A 2DULA 2WM2A 4YA6A 5E7QA 4E4RA 4EG4A 4ZDKA 3ZVMA 2J46A 1Z2EA 1YSJA 2IPAB 1EGQA 1JKJA 2ECOA 3FTPA 5EXXA 1MBZA 3BRWD 2VPTA 4KQIA 4EM6A 2W48A 1UBJS 1U99A 2F3RA 4KXUA 3CNNA 2UUBB 2PMEA 1VL2A 2FZ4A 4Y6QA 3UK7A 2PL5A 1ECPA 4OLJA 4AECA 3LQ1A 4GI2A 5KSWB 2YXNA 2FXVA 3K1TA 5DTMA 3UEOA 5LP6A 3QWIA 3S1LA 3RRMA 5BR4A 2JA1A 4JLDA 3QK7A 4OQMA 3SZRA 3Q8WA 5CYFA 4I3HA 4LDZA 1QB8A 5EJIA 1JEYB 1L7RA 1MQ8B 1P5RA 2NYRA 4JEHA 4HGNA 5BY2A 5JXHA 4MOWA 4D56A 3CTMA 2A9OA 2ABWA 2F64A 4RF3A 4LOLA 3PQ7A 3SAJA 3EVNA 1B8NA 1UODA 2PGNA 1GTVA 1NBIA 3HXTA 4G2NA 1IJBA 4QBHA 1ONNA 5T8KC 3O92A 1UPCA 2OZPA 1Y7RA 3C85A 2HWUA 3GXOA 3L6BA 3P9QA 2Q9AA 1FFCA 3MINB 2C4TA 4RLQA 2I79A 4M6WB 1RQ7A 4OAOA 3HVHA 3OZUA 3R0QA 4LYEA 3E7XA 3L8HA 4X6YA 3LSTA 1P19A 5F3RA 3RRZA 3OBIA 4XFDA 4B4VA 4NZNA 1MCZA 5JT1A 4CNBA 1XD9A 5JHGB 4JV5B 1J0XO 4YMWA 2ARHA 2CLLB 3FFWA 3PF8A 1ZUNB 1M1YE 5FA8A 3M33A 1DAKA 3RCBA 2YNMA 1H5UA 1IVYA 3KB1A 4X44A 4PX3A 3HLTA 3NTRA 4RDHA 3PXGA 4OHYA 5CYOA 4WBNF 3CBQA 1XQ9A 3U44B 1UDRA 4P10A 5L45A 1XWIA 2QUKA 1SXJE 3A6DA 3OZIA 3UFBA 1J07A 4UCNA 2DPMA 2FPLA 3UMJA 5BV7A 2WM8A 3VTZA 1KAEA 1YBVA 1JR3A 5J9FA 2B1JA 4CIWA 3X1MA 1ZGHA 4KJXA 1SY7A 2FUEA 2J3JA 2ZUBA 3VR6A 1YHNA 1TTQB 2C9BA 1RZVA 1SUBA 2AXPA 2GJ4A 2YJ3A 4C0KA 2VTBA 2ODTX 2QD2A 4H2KA 1JHYA 1G63A 1GV0A 3O8BA 2W6MA 3HR4A 3B6EA 3Q2IA 2VP3A 3IP5A 4JVOA 1YZKA 1HH4A 4I66A 1D3AA 2ALJA 1NJ1A 2YQ5A 3JS5A 2EXXA 3WL7A 2JFBA 3NMUF 2ISCA 3P2YA 3WWEA 1Y6FA 3V7ZA 1P0MA 2FNAA 3J7TA 3G5AA 1ZGGA 2O3UA 4DABA 3JSXA 2BMAA 2D0OB 2IEZA 1XEBA 2EZUA 5B37A 4ZICA 4C88A 3I39X 1C7EA 2XAUA 4P08A 2JLXA 3KQSA 3O2JA 4QVGA 2KCWA 4HDMB 1WVGA 1AK2A 5AIAA 4UQPA 1HDUA 1WLSA 3R7WB 1EJ6A 1G3QA 3K8OE 1F0KA 1OLOA 2F4NA 3TNDA 1I9GA 1HSOA 1QK4A 4BZXA 1UK7A 5GJVC 1YK1A 3UHOA 4FX5A 4NAVA 3CX7A 1XU9A 2PIZA 2ZT6A 4DLSA 2AFIE 3RC2A 4QGFA 3FFTA 1F5SA 1P6QA 3M6LA 1OZAA 5F3DA 8ADHA 4JJ8A 4GM1A 2CTCA 1UBOS 2CFIA 3I6IA 1RRPA 5DHRA 3KE8A 1SIOA 3H9GA 4IOKA 3U61B 4MTCA 3A9SA 4G4IA 4DA9A 5D29A 2CW5A 4IHJA 2PGAA 1S2OA 1D8TA 2R48A 4IJVA 3MRUA 1ZRSA 1B42A 3CUWA 3M9LA 2UUPA 3A1WA 5DU2A 4JASB 4G09A 3IJPA 2M6SA 4PFQA 1HDEA 1MAHA 2E1RA 1DFGA 1RYEA 1RZUA 1U2EA 3GLTA 4TUYF 3U7JA 1QV6A 2FUNB 4B33A 4M9ZA 4CMEC 4F91B 2HBRA 1B3RA 1LRKA 2ZI5A 4FE4A 1J90A 1MH9A 4L6CA 5L8VA 3B3VA 5JEDA 1LQUA 3L84A 1K4JA 4X62B 2H0QA 1L5NA 2VQYA 1WXIA 1NTOA 3IP7A 3GBSA 3OETA 3KLBA 3HXKA 4FCTA 2CHEA 2COUA 1YCGA 3U81A 3R74A 3AUXA 1CR0A 1V8OA 1S2NA 3I5MA 3ILSA 2AK2A 3QWBA 2YDYA 2GBCA 1FFEA 2IKQA 2PBFA 4QTYA 2JHFA 4L5YA 1Y4DE 1ECLA 2AFVA 3NHWA 2A5LA 3EY9A 5JAIA 4C6HA 3O0TA 1U9CA 1XI2A 3D64A 1ACJA 7ADHA 2AX4A 3NIFB 1GGFA 4NPAA 3KDPA 4RJLA 1KI3A 1RKXA 4L6IA 4OHBA 2VNHA 1LKZA 4PYQA 1KR2A 3A4IA 4FK8A 4AMGA 1XX6A 5KTMA 3SS8A 3D0OA 4KPGA 2NSJA 5ICSA 3M1LA 3GFPA 4DR4B 1RAAA 2C3YA 5HQJA 3WC6A 1E4YA 4REQB 1OZHA 3BXOA 5IVKA 3FFXA 3LWUA 1WE2A 3I76A 2OAEA 4N40A 1A5AB 3HYTA 4UOQA 2ZRBA 1TZBA 2WYHA 3FMCA 3TSWA 1E66A 1Z83A 3D5QA 3IUNA 2ZWOA 1RKUA 1HL3A 1LH0A 1EZ1A 2D2VA 2I03A 1M2JA 2BPOA 3O73A 4OMDA 4Q4AA 4XM1A 4KLNA 1XCBA 3GDHA 4N76A 2LKCA 3VDNB 3NUGA 4LJLA 5CNKA 4MITA 4U5XA 3VHXA 5CB4A 4GOMD 3EBPA 5EYPA 2Z4TA 4X1IB 4MJ7A 1FIUA 1MF7A 5CX4A 1JR3E 2N42A 2GM3A 2IYSA 1ZRNA 4FQ7A 5TEWA 4TN5A 4FOTA 2PSHA 5CH3A 1JB1A 4D0NA 3DBIA 4RVGA 3BSFA 4O4LB 2ETVA 4A03A 2VYNA 4S2UA 1EE1A 2C88A 2OOTA 5ITZB 1NZJA 3OZXA 1KZGB 5LOVB 3HWX1 5BW5A 1T4CB 1A95A 4D5GA 5FEUA 4FU0A 2B3UA 1NUQA 1PG2A 2GQ0A 3A6FA 3ETNA 4WBXC 3TR5A 3W8NA 4M0MA 4G0ZA 4S1PA 4X93A 1S4QA 3WX0A 3LBHA 4E33A 4E5MA 1E0AA 5BXQC 4A37A 2IHTA 2KI5A 3BQ9A 1XMQB 3CE9A 3B70A 1XXHB 2WILA 4MQMA 3H6GA 2O4UX 2K4MA 3AIOA 3LNTA 3MCZA 1I1HA 3AX6A 3OZSA 1E1RD 3A1VA 3ZVLA 3IJRA 2HRQA 5KYUA 4FOOA 1JFRA 1CK4A 2JFGA 1UMDB 2TMKA 2ZE5A 2A88A 1WUKS 3K6SA 1T4CA 2PJ4A 2IEAA 4FXPA 2C4NA 4R87A 4WUTA 2I34A 4CIDA 3BMOB 1FU7A 5A5DA 4TQGA 1L4FA 3LBIA 4C3UA 3QYAA 1ZIDA 5B6PA 1HFKA 2HTFA 2HHAA 2OLJA 2JC3A 3GHYA 3CVVA 1QAQA 1TA4A 2CXUA 1FLVA 1NULA 3OEED 1KE2A 3AU8A 4JBXA 3AVWA 3RBUA 2ORWA 4EGSA 4MB6A 4ERXA 1ZL2A 1Q0RA 1RLTA 3VR5D 4CM4B 1TLFA 4R8LA 2HJGA 2EFGA 3KJQA 1YZHA 1O08A 4L8VA 3ZX4A 1SC3A 3HCDA 1G20A 4O4HA 1WG8A 1D4AA 1Z7WA 3DFMA 4MR8B 1WHSB 4UUBA 5G3ZA 4C0BA 5AVTA 3MTJA 4U6NA 4IV5A 5FO0A 4DLZA 2EKPA 1I5RA 2REOA 1X74A 1EFLA 1WM1A 2IYZA 1T2FA 2BGUA 4RZ2A 5KVSA 2H3HA 2VYND 2QUAA 3ZEIA 4DL9A 5JAUA 2JEVA 2GF9A 3K30A 3BMXA 1R9JA 2G1AA 2GLTA 3IE2A 3D2AA 4I9NA 1Z88A 2Z09A 2ZGVA 1V2HE 3A2LA 5LCXA 3U7HB 5D6NA 3NVKI 4D9BA 1W48A 2HEGA 3AY0A 4GNKA 4EATA 1FSPA 4HDKB 2WI8A 1IATA 1PJ4A 2DPTA 4RN7A 2NYUA 5EHGA 2QX7A 1S2LA 1F48A 5HILA 1JS1X 4Q66C 3AB7A 1GT91 1PTJC 2MYPA 3EW7A 3OMLA 4DLUA 3L5OA 3GELA 2XEGA 4ETIA 3KZWA 3BC1A 2XWJI 3TRJA 2ZUVA 4NYIQ 4RH1A 5KCZA 4YB8A 5BYKA 4ZEMA 4PGFA 4MCSA 4ZX9A 2IUTA 3RH0A 1VPTA 1Z13A 2FG5A 3RS3A 4MVJP 4V3CA 3UJHA 3SFZA 5LLDA 4IQ4A 1TI7A 1SFRA 1O6FA 2VH2A 4TL7A 1RPNA 4HMQA 2QZZA 1KXJA 3T7KA 3LZCA 3TFWA 5EJEA 1NSYA 3OUUA 5LDHA 4JYZA 1QF9A 3R41A 3DXYA 4M60A 4AWAA 4B34A 1FFBA 1Z8XA 4EUKA 1GZVA 3UJCA 1VCHA 5B53A 1U0FA 3DFFA 1X87A 2I9PA 3OTOB 3HEAA 3L6OO 4GQAA 3STXA 1YZGA 1AUQA 1BA2A 3TWOA 4IFIA 3TZQA 4NBSA 4N3AA 1PW5A 4G1EB 2GJAA 4YDSA 4FFBA 5J59A 4M9CA 2ARKA 2ZWVA 4BFWA 1OAOC 3QVJA 3RM3A 1A9XA 3KOUA 1JKXA 1NE7A 5JD3A 4CL3A 1LDNA 1WNTA 3FCUB 2IPLA 4A32A 1ZN9A 4AMBA 1ECFA 1ZCZA 2Y71A 3A37A 3GB9A 3T7IA 1XQ1A 3M2TA 5EP4A 3FOEC 5JMPA 3UTCA 4C4OA 1ISRA 2A0UA 3TEJA 3H16A 4OLBA 5F98A 2KMLA 3A1EA 2XXBA 1YKGA 2G76A 5CLFA 3V8NA 3C3XA 1UC5B 4A27A 1H6DA 4E5NA 2VZ0A 3JZIA 5AJHA 2AS0A 3ZDYB 3LC2O 3DB2A 5C88A 4PNPA 4TGLA 2GZSA 4FMDB 5DTEA 1QRTA 1NW5A 3N0TA 1KJNA 1QJCA 1VIAA 4H89A 4LK2A 1CUDA 2Q2QA 3HI6A 4BU1A 2ZSEA 3IQWA 4R8SA 3K71B 4KVGA 3D7HA 4ZY1A 1GDHA 5T67A 2EX4A 3OLWA 2GPSA 4RF5A 3W5CA 3C1OA 3FOFC 1UC9A 2EK9A 5G1NA 3F3MA 4ON9A 4NEQA 3AL2A 4NYIR 5KB3A 3F5QA 2B4TO 1UR5A 4XM0A 3MTQA 5FKJA 4YT2A 3UUGA 5A5FA 2EWBA 2WIDA 3KSZO 4A6PA 4PCUA 2GCPA 4AWBA 1JWAB 1QSRA 3LVQE 3GFRA 4FHDA 1U3TA 5IKEA 1ARMA 3GLIB 3R6DA 5EHNA 2OG1A 1XRNA 1N1MA 3PTLA 3JALB 3NIGB 4RANA 4NGQA 2H4FA 3LQRA 5G0WA 3C6YA 9ATCA 3HEMA 3IU1A 4MVJD 3AZQA 5EE1A 3B6JA 4YQEA 3RVBA 3QVXA 2Q5EA 2XBUA 4V0SA 3QQPA 3D8SA 2PXCA 1IK6A 2QPLA 5CJPA 3ZCXA 4CM9A 5CD9A 1ZN7A 1SZJG 4Q37A 4JI7B 1VYTA 2JBAB 2HA5A 1NF3A 4N18A 5LWHA 3WGIA 4X8OA 4F0YA 2QJOA 3LRPA 1ZUNA 1BJTA 1DEKA 2OU2A 5EWLA 3K0BA 2XVXA 3W4KA 3ZBPA 4N0DA 2H17A 1JPVA 1RLUA 4UAJA 4LBYA 4Q36A 4ED9A 2AG8A 2QS9A 4FOLA 3MJRA 3NJ4A 4A5OA 2ETXA 4TKLA 4NEXA 1X94A 4HUTA 2EHJA 2HYIC 2WUGA 4KYIB 4Y9RA 2ZW9A 4D1YA 4FWBA 2ZPAA 3OPYA 2NMTA 4BRSA 4MRIA 1Z74A 1EQ2A 3ZD8A 2P65A 2YHBA 5FOUA 5AM4A 3ZIUA 1SIWA 4ME6A 5AKJA 5KOJB 3UQZA 5FULA 3JTKA 3GLSA 1KZ1A 3N58A 1OFIA 3EFOB 4FUQA 3ZC3A 1VCIA 5DLQC 3RGGA 3U3RA 5TLSA 2VJQA 1Y7PA 4UFVA 1SOWA 5AKZA 3QEMB 4L9AA 2DECA 5DASA 5KREA 3H87A 4NGPA 3EQ6A 3FZEA 3ITKA 4YH1A 1PNRA 5T4FA 1F4VA 2PJRA 2OZGA 3TRDA 1DX4A 1YSCA 2O14A 3L9WA 2OXRA 3PNOA 4JJGA 4ZOLA 4QGGA 5FO1A 3G8AA 2J7PA 2KLHA 5K6AA 4DARA 1U7HA 4DR2B 1YRLA 2WPDA 3T0FA 4K28A 3PFFA 1WCWA 3V6LA 2IYNA 1NWHA 3V42A 5AUPB 3MWEA 5JH7B 1NDHA 4QRIA 2C4WA 2QTLA 1JHXA 4LVNA 1AQJA 2BFCB 1EFRD 1QYCA 3L8EA 2W4MA 4QXRA 2AMVA 2HF7A 3CLTC 5KDLA 2P90A 2JVKA 2IV3A 4YRZA 3PBBA 1O4VA 8ATCA 4ZCQA 3JTEA 1QFSA 3A36A 2ZAIA 4Z0TA 2XEFA 2QN3A 2D3TA 1X80B 2L17A 5G1ZA 2UYGA 3HCRA 5KWVA 4FILA 4ZODA 4R4JA 2H1OA 3MD0A 2XQFA 3DUFA 4P86A 4BFXA 3TFYA 3MS2A 4YCCA 1VC2A 4ZU6X 2VS1A 2F3QA 3W6XA 2WWHA 3EXG1 1DXQA 1NNLA 2OV4A 2HWYA 4WK6A 1CUVA 4XPDC 3IXLA 4PHFA 2WQZA 3VJRA 1HE5A 3IP9A 1Q57A 2V0CA 4N8SA 3T5BA 2Y0DA 4XA8A 3S2EA 1PZHA 4EMTA 3H2HA 2NWQA 1HXHA 3H2BA 4AZSA 1LD3A 3ENVA 4L7QA 5ILOA 5KNDA 1G8YA 1T1IA 3GNSA 4FFRA 4LSWA 1KZYC 5AW9A 1VG1A 2Q1XA 1LC0A 1S3FA 4RVFA 1XE4A 2P78A 4KGZA 1ULZA 4XIJA 1QO0A 5EE0A 2XWPA 3B60A 3WL5A 3DO8A 4CFZA 2G1KA 5KNBD 1C7RA 5THKA 2DM6A 5LIRA 3FMIA 2DFDA 4YCSA 3A3PA 4L5JA 4C0SA 1NAIA 2GYUA 5CM2Z 3I28A 3TJZA 3HJNA 4HATA 5K3OA 5CNIA 1XQYA 5TPWB 2WUEA 3CNOA 1K7CA 1F51E 5HRUA 5T8KA 4AUNA 3MXOA 2DQ4A 1E3TA 3KAJA 3UWKA 4BB9A 4ZDJA 4CMAA 2HK8A 2A59A 3KELA 5DW0A 1JG7A 2MSKA 1OWPA 5K8JB 2ZBDA 4JD5A 2ANBA 3G0OA 1SCKA 1RI5A 4NF2A 1HYGA 4ZPXA 1AKWA 3TM4A 1ON0A 4EMEA 4QBFA 3TW4A 3WWYA 3B8HA 3UN1A 2O8FB 1JECA 3SE7A 3IRUA 1S7NA 5GM1A 2C78A 4EW2A 1K1EA 1X7DA 5C7LO 2A5JA 2R6CA 5IYZA 2PKXA 4F9VA 2IZ1A 2XQJA 2ROQA 2YMMA 2W2OA 1WXXA 3ASUA 3BX1A 2GZ3A 1IFXA 2AQIA 3O4HA 3AERB 3OC6A 1R4NB 3F5DA 3HWWA 1T2AA 1A5TA 3E5HA 5C34B 4UC0A 3DSBA 4O4LF 1RVV1 4ZMRA 3IGFA 3E03A 5IMSA 4RTKA 2RDMA 2GNAA 2YVKA 4XYMA 5JMWA 2HM7A 3LPAA 4EVIA 4ZVSA 4OV6B 1IHXA 1P3Y1 1Z5PA 4OK3A 5KQSA 3P52A 3N8GA 1B26A 2QNBA 1EESA 1CWUA 4FLMA 1U5AA 4JB3A 4W9NC 1IQUA 3QE9Y 1USGA 5AVJA 3X1DA 2IKSA 2WWVD 2RJNA 1CRLA 4ZAZA 1EK2A 1KP9A 3HYRA 3A26A 3DPUA 4I5GA 3VKFA 2BOAA 2WUUA 4MFPA 1WSBA 2IT1A 1T3ZA 2WU4A 2J5KA 3EF0A 3W4IA 2SNIE 1E9FA 1UP4A 3CKYA 4US1R 2XVMA 1DAOA 3QLVC 1TZCA 5EKXA 1XVLA 5IC6A 2VAXA 1OFVA 3PGA1 2XF8A 4LW8A 4NEHB 1SC6A 4BBPA 1HM5A 2QUJA 2RI0A 3HO8A 3PDWA 3PYLA 2B1RA 3KZCA 3NH6A 3QV1A 521PA 4B71A 4ER6A 4EYEA 2VWGA 5IJZA 2XKAA 3ZH9B 4FJ1A 2DFPA 2IJGX 1JR2A 2VPYA 3PQCA 4GX0A 5FFFA 1XAJA 5AVWA 2WF9A 4MUIA 3DZDA 4MYSA 1YBHA 4LHZA 5IMBA 3ZD7A 3I2IA 4NGNA 1LVUA 1NYTA 3D54D 4EUFA 4KOAA 5J2UA 2V9PA 1KNQA 1T8WA 3BORA 2ACVA 4H0NA 1UJNA 1I36A 4NAUA 4ALNA 1YB4A 1FTQA 1XN4A 2W7TA 3HDQA 1W0CA 4BV9A 1R15A 3TUIC 1NRIA 3H8VA 3EVEA 1NW4A 3QHQA 4P4LA 2FIWA 2KB0A 1K6JA 3K9UA 3L93A 2Q51A 1SUAA 2ZVDA 4UTXA 3M9XA 3LUJA 2FLKA 4DLTA 2OAGA 2WM9B 1HZJA 2IV2X 3MRXA 4BP1A 2AOUA 3D7NA 5FH9A 4IG4A 5MF6A 1KFJB 3I9FA 2O2IA 5NLLA 1LPNA 2JFWA 2X9VA 4HS4A 4YRAA 3PGJA 3ZWNA 2RGNC 2EAUA 3RTAA 1YQ9A 2Z58A 3O2NA 5TB5A 2CLKB 4DSAA 1M5TA 2CLHB 3D4LA 5CG1A 3L06A 3FVTA 3C6QA 4BMNA 3OURA 4MHNA 4EZIA 5HGXA 4AUKA 1T4MA 3PGVA 1EM8A 5MGNA 4ZQEA 1S60A 3Q98A 1PGQA 1XRQA 1XIXA 2MMGA 1SCNE 3PHBE 1DLIA 2C92A 3BIXA 3MCVA 1QHFA 4Q9DA 1BTOA 2XEXA 2Y1EA 1WJGA 2H51A 4G4GA 3HE3A 5LZ2A 2VTEA 3G8CA 3LE8A 3OIUA 4E5UA 2VZYA 1AQYA 1VI2A 1NW6A 4EFLA 4R1QA 3PK0A 4KQFA 3GH1A 5CDTA 4CF7A 2ODWA 2QRNA 4B3RB 1ZHHA 3PUIA 1I2MA 2HLNA 3E4CA 1P18A 4KPYA 3O74A 4UHHA 3L7BA 4E30A 1UMKA 4TT8A 3GBPA 2V8VA 2H48A 5FLYA 3GJ3A 3GLJA 2GO7A 3S2IA 1XZQA 2PNFA 2X2OA 4NNPA 4PAGA 3RHFA 1EKXA 4EGJA 4QDJA 1R12A 1RZ3A 1Q0HA 4ZAWA 2YZ2A 4ZAYA 1BCRB 2WOOA 4ZOLB 4MI6A 4BFTA 3BWEA 5J2TB 5E9WA 1BYUA 1KOGA 1QPGA 2P6UA 5LLSA 1HTWA 1CUYA 1XHEA 3PFHA 5K3DA 1XNRB 1L5OA 4EB6A 4LMBA 1M83A 4DLRA 5KINB 3QWFA 3FDFA 1JH8A 3UIEA 1Z68A 2R6JA 2MT9A 1ZHFA 3F8WA 2ZETA 2QTVA 4KZKA 2ZIFA 4FGUA 4P35A 4PZPA 3O03A 1O77A 5CTAA 3A7EA 1UJBA 3PQ2A 1PJLA 4ZVNA 1JKMA 3ZZ0A 2IXAA 2AN3A 2OO5A 4XQCA 1CY6A 3EXEB 3MAJA 3OHMA 1HMYA 3E3AA 3EYWA 1YTLA 1BEUB 2H8KA 3L02A 3Q6MA 4A92A 4EYKA 2F8TA 3OPYB 2P30A 3ROMA 5JO9A 2JGJA 3MTGA 3HXLA 4MLDA 2HK9A 4YX9A 1ISPA 4MFQA 3O82A 2DHCA 4E21A 3RIYA 2WUWE 3CVOA 4TTVA 1BU8A 5LFAA 1GRQA 5K8TA 1ODIA 1MO5A 1SN7A 2QTFA 1Z39A 3EJ6A 3O38A 4GX5A 4UFNA 1JQ3A 1X7ZA 5HF6A 3KKEA 4CCYA 4QM7A 3H1TA 1URPA 4FS3A 5GAJA 3ZXUB 2HA6A 4OP2A 2G5CA 3DMHA 1IONA 3QFCA 2E5FA 1OPRA 2W2LD 3AZPA 5H3CA 4EUNA 1W85B 4YUAA 4ZY2A 1E1QA 2PUVA 1OOEA 4IV8A 2V7PA 3MBOA 5HFAA 4AUEA 2EK8A 3OF5A 3G85A 2CJYA 2JJMA 3DE6X 2YFKA 4MQUA 2VJPA 3TTSA 4X90A 3DMRA 4AROA 5J3JA 4J3GA 1UADA 4TMZA 1BYIA 4TZ6A 3VPHA 4OLAA 1OYYA 3P8ZA 1IPEA 3SKXA 1L7AA 2GXSA 1OVGA 4BJ3A 1KBZA 1RZRD 2W2PA 4BFVA 4R69A 1G20E 1J33A 1X13A 3C5VA 1YGYA 1L8LA 3H8WA 4U7TB 5K0EA 1WV0A 2GERA 2P6FA 1BXRA 4AVYA 5HKOA 4RBNA 1AV7A 5D84A 3EASA 2GK7A 4KEAA 4QAJA 2GXUA 5B1IA 1J2TA 1JYSA 4U9IS 3GJYA 3MJEA 1FVFA 2E49A 2FRDA 2QVYX 3W1VA 5I5EA 4KNVA 1H0RA 1Z26A 2JAHA 3OX4A 4NZ9A 2HC9A 2PS0A 3IA2A 3U4DA 4LRTB 1XL1A 3TQHA 3UOAB 4B6RA 1EK0A 2QBYB 1KRWA 5F77A 4E1VA 5JS7A 3TQIA 5EUQB 2VAMA 2IUSA 3V32A 2WWTA 4AN0A 1OFUX 4EHFA 3FMOB 2PGLA 4DDUA 4EUEA 4I1RA 2Z56A 3FCAA 2PR2A 1BMQA 3HPQA 3ZY2A 2PH7A 3RNZA 3ZW7A 1CHNA 1MA0A 3HVUA 4J4BA 4FBGA 1T4BA 5JSQA 4AN1A 4ND7A 3UATA 2GETA 2Y0MA 2F9MA 4FZJA 2OQIA 2VJKA 4LPKA 1JWQA 4PN3A 2KJQA 1JLKA 1WMFA 3CX3A 1T2UA 4AJIA 4Q4CA 4YR7A 2PR1A 1Q7TA 1TU4A 2G63A 4MB0A 5EEGA 3U3JA 2PKQO 3V2IA 2FJ0A 3P2JA 3KJXA 1KL7A 3RARA 5T6BA 3TCVA 3N2YA 4R3KA 1O0SA 4ESVA 3ZJ0A 4L0CA 1EGHA 5DYIA 1B76A 4F6RA 2HA4A 5JH9A 2BGTA 1DCMA 2VCHA 3OZCA 2FOLA 4QFMA 5GOTA 4B3BA 1Y6ZA 2DFLA 2F1OA 3ZCPA 4H16A 4BUCA 2JJ2D 4LZLA 2VEOA 4XUDA 5JSUA 3RRXA 3TI9A 3FAZA 4YP5A 3WIBA 2ZTVA 1IM8A 1HNXB 1TTTA 1V3UA 1ZH6A 3KJFA 5JDIC 5CK5A 3I1UA 5GONF 1EFKA 1DAFA 1V9SA 2GPYA 3IXMA 4I6EA 3ADDA 4OIWA 4KWIA 2P2CA 2VNKA 3EQZA 3P0RA 5EIBD 4J0IA 3EUFA 1UM9A 1Z08A 2PWYA 3T9EA 4BU0A 3CCCA 4MA0A 3KOMA 3BZUA 4UHJA 5K3FA 4G3XA 1JJFA 5FYQA 1E2BA 2HQRA 2JJ1D 3GD7A 4JUFA 1C4OA 4PBSA 5KNCH 4V1CA 1G16A 1ESZA 4WJKB 4W63A 4HWPA 2H65A 2VH1A 3KEQA 3LDAA 3PT5A 4Z8XA 5CHEA 5A9TA 1HF3A 1KC3A 1NT4A 4MW9A 1T8YA 3O1HB 4CQLA 2V9ZA 4OUDA 1AA6A 3X1WA 4I1OA 3FAKA 3RQIA 3LPLA 5CPFA 2VC2B 1SQGA