2HJGA

The crystal structure of the b. subtilis yphc gtpase in complex with gdp
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
434
structure length
400
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLDNNIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein engA
publication title The essential GTPase YphC displays a major domain rearrangement associated with nucleotide binding.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 120
structure length 400
sequence length 434
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2hjgA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hjgA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hjgA01
4LF6C 1IXRC 4TTRA 1YE8A 3P4YA 4XH9B 3W3ZB 4CYMA 2GWHA 3CZQA 1G4UR 3K0FA 1TX4B 1NBMD 3HR7A 2UVQA 2YHSA 3KZ1E 1BIFA 3ZVRA 4CF7A 5JI3E 3NHBA 4PHTA 4B32A 4P3YA 1G8YA 4ZI2A 1JPJA 1XZQA 3FDIA 1XNJA 5B58C 2QP9X 2CJWB 3ASZA 4URYR 1LS1A 2ECKA 2QMHA 4ITRC 2WZQA 3AM1A 3Q8XB 1J7KA 3R7WA 3R8CA 1ZRHA 1Y3AA 5E7JA 4K0KC 2IXEA 4CW7A 4Q02A 2J0UA 1ZB8A 4PPFA 2IF0A 2W2XA 3KJHA 1DAIA 4TTQA 3HDTA 4LHWA 2R6GA 2F43A 2PLRA 1E9EA 1Q21A 4JKYA 5AJXA 2C98A 1CP2A 1WMSA 2OG2A 4NOZA 1N36C 1KAOA 1SXJA 4KCGA 2BMJA 3T1QA 5KHOC 4FWTA 1KJWA 3THXB 1NVVR 3RSOA 3TIFA 621PA 4DCUA 4YMWA 2WMNB 3CW2A 4CEHB 4MTNA 1CS4C 1G8HA 3CB4A 3K70B 4GOJA 4OI0A 2G0TA 1E2FA 2F55A 1W0JD 2AXPA 2A78A 3F5FA 3OAAD 5JJIA 2OFOA 1C9KA 1GKYA 2ZSFA 2VSXA 2WJJA 4A0FA 4PPNA 3KXKA 5DI9A 1KTVA 2OAQ1 2PZFA 2ZR0A 2ZR7A 4Q4AB 4B73A 1IONA 3B9PA 2UUBC 4BFTA 1IM2A 3Q7QA 2OPLA 4PHGA 1NBME 4LUCA 4X62C 1XZPA 2JASA 3W90A 2JEOA 4OHVA 5KSYA 1U99A 2ZEJA 3C5HA 5K8IA 1FUUA 4DDUA 2KBEA 3FHTA 2L0XA 4BWYA 3SQXA 4B3RC 2O0JA 1SKYE 2O8FA 5FBWB 4IOMA 1RRPA 2ZYUX 3BWDD 1GM5A 1DADA 3TR0A 3FHCB 6Q21A 1AS0A 3JZAA 3R8FA 3UMRA 3EZFA 4LF7C 4LPKA 5G53C 3ND8A 1W36C 2QPAA 4C4PA 2ZAMA 3T1TA 1WQ1R 2H5EA 3H84A 3NVAA 3P32A 2WKRA 2QROA 2FFAA 3PEUA 3I62A 4LV6A 4AC9A 3MAAC 5E3HA 2DHRA 3FKQA 1UF9A 1DAEA 3A1TA 4MGYR 2BM0A 3EC2A 3CM0A 4DLVA 3DL0A 4NBSA 4M1TA 5JRZA 1ZM9A 3WYAA 1MT0A 3AF6A 3AKCA 1ZM7A 1FOEB 2OEPA 2NTYC 1Q1EA 4TYQA 2H92A 5K8LA 1J99A 2ZRGA 4LGMA 4TQUS 5L3SB 2IBMA 1ZNWA 4DT1A 4HAWA 1P6XA 4YMTA 1S0UA 3OIYA 4F4CA 2JLZA 1XBTA 1W7AA 4OK6A 2C5LA 1RJ9A 4C7OA 1A5TA 2ZTSA 4ESVA 4YMUA 4AKEA 3FMOB 1NVVQ 1DO0A 3SBDA 1G4AE 1T9HA 2C9YA 1FQKA 5JEEA 1J2JA 5GVSA 5EXXA 3W6NA 1XPRA 1KO5A 4GOKA 1Q3TA 2JLRA 4PO1A 1NKTA 4DB4A 2ZRHA 2FPMA 2GETA 2HUPA 3MJRA 4FMDF 5FTJA 2EFCB 5AUQA 1OXSC 4M1OA 4QGGA 4A0RA 2XEXA 4BPBA 3T61A 1W47A 4DUYC 4NHOA 1LFDB 2XOKA 3K8YA 4W9MC 2Y8EA 1Q20A 3QXXA 4CEJA 3HPQA 1MOZA 2QTHA 4FCVA 3SE0A 4X8MA 1SZPA 1IN7A 3CKLA 2C77A 4C0SA 1XX6A 1WB9A 3ZIAD 4ZKEA 3EPKA 2JJ2A 3LO5A 2CBZA 3MWKA 2H1LA 1MO5A 2O8CB 4MKIA 4C7OB 2GCOB 4K81B 3LDAA 2MSCB 3B85A 3FWYA 4NCNA 4RZ3A 5DI3B 3TQFA 5SZIA 1HH2P 1SVSA 2DB3A 3LV8A 2E5LC 3O47A 3LVRE 2BC9A 3BH7A 1A1VA 4OJKA 5FOUA 3I5XA 1QZXA 3OE7A 2IHYA 2WIBA 2NMVA 3ZVLA 4LRWA 1R0WA 1FUKA 4DSUA 1ZM3A 3DO6A 4US0R 1G291 1OT3A 4XX2A 3NXSA 3VX4A 4QHYA 1XTIA 1ZNYA 3MLEA 4EPYA 2OAP1 1CR1A 1D5CA 1KK2A 4DR7C 2WWHA 4JLBA 3SYKA 1CBUA 4AIIA 5D3MB 4N3NA 5C4GB 2JAQA 3WBJA 2NO6A 2JLQA 1VHLA 1HNXC 4NXMC 1JI0A 1KZ7B 1QHHB 2GTPA 4JS0A 4V0ME 4A0GA 2NQ2C 2PEZA 5FOXA 3B82A 4W5JA 1KDRA 1KMHA 5BYKA 4B3GA 3FHOA 1RC8A 3OIUA 1DELA 3AF2A 2WOOA 2ODEA 1HA3A 3WRXC 2YJTD 1TQ2A 1N3BA 3J80D 2DYJA 4DSTA 3ZS8A 4D4KA 2UXBC 4GMXA 4LYAA 5CIQA 4LK2A 1ZAKA 4JZKA 4PZZA 4N1AA 4TL8A 4DR6C 5G40A 1SVWA 5DGXA 1XRJA 4IEEA 3WNBA 3HP1A 3GJ5A 2PCLA 4B75A 5FBVB 1TU3A 4Q7KA 5G3ZA 1AGRA 4QFMA 4DIEA 4LJ5A 3V4RA 2GJ8A 2RHDA 2ZRNA 1MH1A 1XEXA 4QHTA 1OKKD 2FA9A 3BRWD 4EAQA 1QHNA 2Q9AA 4MH0R 2GA8A 3B6EA 5FBLB 3KB1A 2QI9C 4I81A 5JWOA 2A5DA 2E8FA 1F2UA 5L3VA 1KI8A 2BDTA 5JHHB 1OF1A 1T5LA 3I8XA 1XNQC 2P65A 2QL6A 3QSYA 1RRFA 4LFBC 1BMFA 1AQUA 3LH5A 4NONA 1RRCA 2QSZA 1AGPA 4MDEA 2F7SA 2BBWA 5JWRA 1L2FA 5TDHA 5BWMA 1HQCA 1QHSA 4FD2A 1ZUNB 3RYTC 3MSXA 1NI3A 4TT3A 3SR0A 1ZD9A 3GFTA 2QENA 2Z83A 2A5GA 1NYEA 4Q18A 1H8EA 3I92A 3V4FA 3GJ0A 2AKYA 4M0LA 4O0MA 2OSBA 3SHWA 2PN2A 2F1HA 5CB6A 1UKEA 5K8UA 1XCGB 2VRWA 4B2PA 3FYHA 3K53A 4D4LA 1W1WA 4HUQA 4M22A 4DRZA 3M1IA 3UANA 1GL7A 1VYUA 2VHUA 1A4RA 4UNQA 1W46A 1MO4A 4MYUA 5CLLA 4CZ2A 1E32A 4RVCA 2WWFA 1PJRA 1HY3A 2V55B 4DV0C 1SVOA 1LS6A 1N5LA 3UG6A 4DDVA 4QHSA 3W6PA 4YDSA 3W6OA 4EPRA 5JS8A 1P60A 3B2EA 4TLAA 3REFA 5FUWA 4RD2A 4JI2C 2ATWA 4QRHA 1XPUA 2IT1A 3F0TA 2EQBA 3AF5A 3L8ZA 3PUZA 3MMPA 2KI5A 3U61B 5SZJA 2PX3A 3TAHA 1UBFA 4HAUA 4LDJA 3QKSA 3SHFA 2PZGA 1FW6A 1SXJD 2ZI5A 4PZYA 4NYIR 3TVTA 4LWZA 3JAMD 4DCSA 1YU9A 4NMMA 3GP8A 4QGHA 2FX3A 5AUNB 3P4XA 2QBYA 4URXR 1RE0A 2W00A 3GLIE 1G21E 2YWFA 1RVDA 3WP0A 3VNVA 4MH4A 3OEHD 1H8ED 2HT1A 1XMQC 5IDVA 2ZRPA 4ZPXA 1KI3A 1JJVA 1OE0A 2A30A 5L3SA 3SFZA 2G0NA 3OESA 3SYNA 1R7RA 3QXCA 3OF5A 4B2LA 5KSOA 1ZU5A 2FV8A 3RRYA 5FTLA 2IUSA 2EWWA 4NE2A 2XJ4A 1SXJC 1E96A 2OBNA 2OBMA 2Z43A 3I72A 1I94C 1N0VC 5JWHA 1U8ZA 4NYJQ 2R9VA 4QG7A 2Q3HA 3SQWA 1G20E 4JVLA 4QBHA 2W6IA 1E9SA 4PQRA 1OXXK 2IYWA 3T15A 4M9SA 1G19A 2FSGA 3FKSD 4R7ZA 2OHFA 4JLNA 1PLLA 4A92A 3GLHA 5FUYA 2CK3A 2BIFA 1KK1A 5FLXD 3EX7C 4E03A 2D7CA 5LB4A 4KYUA 2IF2A 5AK0A 5FOVA 3QQ5A 1E3MA 4Q1AA 2FSHA 1E9AA 4BLRA 4RZUA 3QBVA 2ZJAA 3BERA 3OIWA 3L82B 2O8DA 4UNSA 5LMUC 4UNNA 2EYQA 1HH4A 2Q9BA 1CRQA 2G9NA 1COWA 5EXPA 4TMVA 3BBPA 4HB4A 1WF3A 3W5IA 4E07A 2WM9B 4Z54A 3IPXA 2QAJA 3RS3A 3QVUA 2J3EA 3CWZA 2REBA 1NKSA 1PUJA 5EE1A 1EFRD 1GNPA 3FPAA 4XD7D 4TLCA 2ONKA 3EPLA 3N70A 4YONB 3GLIA 3DMDA 3M4YA 4F93B 3ZIAA 1HNZC 3KJEA 1CIPA 1U9IC 1XD2B 1DO2A 5M04A 3OZXA 3ZH9B 1GZSA 1TQ4A 2OO7A 4AG5A 1SXJB 2GF0A 4BLTA 3U3JA 2V7QD 1S3GA 2HJGA 4DR3C 2IYYA 4JL5A 3TRFA 1TAGA 1YZUA 1YR8A 1JB1A 1XJQA 2PEYA 1VG1A 4HDCA 4JSTA 5F2EA 1T0JB 4PO8A 2WWYA 3K0CC 3K9NA 3D31A 3RC3A 2B21A 4JT4A 3W3AA 3WY9A 2KZFA 1C1YA 1CTQA 1VYTA 2DY1A 3FE2A 4C0KA 4FINA 1H65A 1YZGA 2CJWA 1Q1ZA 1KAGA 5E7IA 2IWRA 5GVRA 5DHAA 4IJMA 1GWNA 2XAUA 3F8TA 1YJ5A 4PAQA 2EFGA 2OFXA 1E2MA 3UKDA 5BN5A 2Z5FA 3B1YA 4JLJA 1F48A 2F6RA 2IXFA 2C99A 4MRPA 1N0WA 1N6KA 4JMPA 1Y63A 3K09A 2YOGA 1TF5A 1W0KD 2FDCA 3KKPA 4I1UA 4YMSA 4JYBA 2B7BA 3LFUA 4DJTA 2GZDA 3KXLA 1QHHA 3BB3A 4XTCS 4TYNA 1TEVA 1Z29A 1XFAA 1CLUA 2GJSA 4JI3C 2A9KA 1DE0A 2R6FA 5LD2C 1R5BA 4Q9LA 4US1R 1KY2A 5FUXA 3RWMB 3WNDA 1QG2A 5J4KA 5JS7A 4TZ0A 4M8NE 3THYB 4PZLA 3PQCA 3CNNA 2F1IA 4LJ7A 1CULC 4DCNA 1DG3A 4NH0A 3RNLA 2F9LA 2GILA 3V00A 4D81A 1SHKA 5E7MA 3WHKA 3IBYA 4Z8XA 4DXAA 2HJVA 1XTJA 1ZU4A 2O8EB 1NRJB 1RYHA 3A8TA 3ASYA 1HQYE 4PX9A 4Q7JB 4WA7A 5IF9A 2H16A 3WMEA 4CDGA 1E1QA 2IHBA 1CJUC 3MG9A 1F2TB 3GFPA 3N5CA 3CUEF 4Z1MA 3UWKA 3IQWA 2EW1A 4I1OA 3TK1A 2GRJA 1UBCA 3LBNA 5J40A 5A5GA 3WMFA 3SJCA 2DWOA 2VSOA 1BO6A 1MRNA 4BRUA 3NWJA 3BC1A 4RCYA 1P4SA 4AKHA 2XNSA 4S35A 3LRPA 2YOHA 1AS3A 3CPHA 1NSTA 2REOA 3BE4A 1G3MA 1XMIA 2W6JA 5HE9A 1SVLA 1EFUA 2BVNA 2NZ8A 2LWIA 4PSAA 2CNWD 4EFLA 4NXNC 3GPLA 1W4AA 4HZUB 1JAHA 2BBOA 2OUKA 1U0HC 1T91A 3PUYA 5IK2A 1AS2A 1E0JA 2D3WA 1NP6A 4FCTA 4WOPA 3P20A 4GNKA 4HATA 2GBLA 3A6PC 3B78A 3T1OA 1DAHA 4DLZA 4EPXA 1AJEA 5F9FA 3MJHA 2CHVA 3ZYCA 5FR1A 2SHKA 1XD2A 2V6IA 2QAGA 2IX3A 3QKTA 1G5TA 2VP9A 2EFHB 3GJ7A 5KDLA 2BMFA 2HF8A 2IA5A 1RKBA 4TSFD 4QM6A 1AN0A 4B74A 2WKPA 1Z0JA 2R6AA 2WPDD 1UAAA 1LF5A 3MWJA 4IDNA 4NP6A 2WWGA 4UKDA 3AF0A 3TNFA 4HAXA 4BSZA 1E1QD 5G41A 4GL2A 2PT7A 3QG5A 4Q1FA 3ZQJA 2BHRA 4A8JC 4PR0A 2ZYTX 5BN4A 3EERA 1T3SA 2AWOA 1ZBDA 5DNYB 2OCPA 1USPB 4OBEA 4D2IA 2E87A 4B3CA 1GKUB 2B7CA 4B3TC 3AF3A 3Q5DA 3R9IA 5DHFA 4LHVA 4DLUA 1UKVY 2RGNA 3U4QA 4HB2A 4ARZB 4K46A 1Q22A 4OI4A 2BKEA 3CO5A 1P9RA 5GADl 2EYUA 1S1MA 3AVYA 1GRQA 2ZRCA 5JSZA 3NH6A 3EC1A 4EIWA 3IKJA 1AIPA 1ZVQA 5CIWA 3A4NA 2WKQA 1GFIA 4DR2C 1D8TA 3K0CA 1IBLC 2VHTA 2PMDA 4GSYA 3LAWA 1FTSA 1GDDA 3GLHE 2GEDA 4TZ6A 3DKPA 1XTSA 3AVWA 2AR7A 2LKDA 4MITA 2XNDD 4JVNA 4WBSA 2ZAOA 4HAYA 4QM7A 4JJZA 4US2R 1M1YE 1XWIA 4E5UA 3FTQA 5AJZA 2OPLB 4HAZA 4ZIRB 2GVZC 4JYCA 1UEIA 1X86B 3A4MA 5UKDA 4AI6A 1IN8A 3C8UA 4ERNA 3U6KA 1G3RA 2OCYC 1LF0A 4QL3A 3OE7D 1FNNA 1LTQA 3U7EB 4FMBB 2O8BA 2D7VA 1DEKA 4M1WA 1JR3E 4BLQA 1R6BX 2YOFA 4K8OA 3SJBA 2XB2A 2C78A 1IOZA 1KO7A 1ZM2A 2ZRDA 2GJ9A 4G5OA 2WWWA 2OV2A 2VL7A 2QAGB 2IUUA 2R2AA 4GRAA 4QOSA 3D7MA 4A8JB 4B3XA 2ZSDA 4TQAA 1COWD 2F3TA 1GRNA 3AP2A 3AQ4A 1KJYA 5L3RA 3KXIA 4GP6A 1W5SA 1KI9A 3CZPA 3VR1A 2JIZD 3BH6A 1S1CA 2WIAA 2IYVA 4XVUA 3B1ZA 5EP3A 1XEFA 3U7HB 1PV4A 1G6OA 2J5XA 2RGGA 3SN6A 5EP4A 3AH8A 1JQLB 3T1HC 1QHGA 3THOA 2A7QA 2RHMA 4KODA 1Z28A 5KOYA 1TL7C 2WJGA 4AKIA 1YRAA 2BEJA 4I4LA 3CH4B 4MRSA 5FTNA 5CYOA 2FG5A 1KNQA 2H7VA 4TLDA 2NPIA 1XEWX 4HB0A 3MD0A 3CX7A 4W5HA 1E2GA 1A7JA 1GUAA 1XXHA 4LBZA 2GBLC 3I3SR 3FVQA 4Q4LA 2W6JD 1KK3A 5FR2A 1J8YF 4Q1DA 2IL1A 3AGQA 3GJ8A 4Q9IA 4F38A 5EJEA 1CEEA 1XJCA 4JJKA 2C9CA 4DWJA 3DVLA 4P4TA 4RFSA 5E95A 4JKIA 4S2EA 1NLYA 2ODNA 3IHLA 3K70C 1N5KA 4M1KA 5CK5A 5BXQC 3KFXA 2UUAC 2DFKB 2IYTA 3MFYA 4Q21A 2AL7A 2GK6A 1XP8A 4F91B 4DV3C 2X8AA 4MGKR 3QPUA 1XMOC 1NJGA 1GITA 3FB4A 4C3ZA 3EZ9A 4OK5A 4PHHA 2RGAA 1Z0FA 4HDQB 4LI0A 2H8KA 4C9BA 2KJQA 1BYUA 1S8FA 3U6BA 1CR0A 2BKUA 3GLFE 4QGAA 1Z6TA 2RGEA 5CDFA 5LDDC 3MWYW 4TMKA 2H18A 1E98A 1NMYA 2ZETA 2ZI3A 4KBFA 2CCJA 4O2LA 4RZ2A 2Q21A 1FQJA 3WHLA 3B8HA 5JSZB 3TQCA 1OLOA 4U5XA 5JEDA 4NZYA 2WJVA 2AN9A 3I73A 4OHZA 2ZS8A 3KDSE 2BBSA 3SJZA 4M9QA 3VHLB 4ON9A 5IWAC 3T1YC 2QSYA 3DZ8A 1NIPA 3QKUA 1OIWA 2NO1A 5LD2B 1L4YA 4GP7A 2BCJQ 5BN3A 1OH5A 4UNPA 1JR3A 1NVXQ 3A4LA 2CXCA 1XMSA 3EARA 1W36B 1VMAA 4LYFA 4TMXA 2DWPA 5HE8A 1D2EA 4OHYA 2JLWA 5C46F 3K9LA 5AWFC 5LB2A 3QPVA 4FMCB 1Z06A 2CE2X 3Q72A 2XNDA 1XXHE 2J9RA 1CJVC 3E1SA 4JLMA 4C0JA 4OHWA 4RSGA 2IYQA 2Z4RA 3RDPA 2IYLD 3LUSA 1Z2AA 3OFNA 4V0MA 3WNCA 2A5FA 1IBMC 2HF9A 3GJ3A 2HYDA 4MUBA 3GJXC 1N6NA 5JHGB 4NPHA 3EIQA 1RIFA 1ESNA 2BJOA 4AYWA 3I1FA 1H8HD 2OE2A 4TL7A 1I4LD 1N6IA 2H57A 1JXMA 2GESA 2QM7A 3EWSA 2CVFA 2FSIA 1OFTA 4IVRA 5KSPA 1SHZA 4LJ6A 2J0UB 1DS6A 1FFHA 2LKCA 3T06B 4AK9A 1TADA 3AKEA 4CT5A 1W0JA 2ZUBA 3BIFA 3C4JA 1Z0KA 1KGDA 4OK3A 1M7BA 4DC9A 1AQYA 2V7QA 3KQLA 1VKJA 5EZ5A 4B35A 4BQSA 4DLRA 5JCZA 1S9DA 2NO7A 2VA8A 1NF3A 4ZV4A 5AJWA 1E4VA 3AVQA 4BLOA 2WVJA 2ZI4A 5FI1B 1YR9A 2O8DB 3C7KA 2JDIA 4BEJA 1E1RA 2AHOA 2X19A 2R44A 1UFQA 3VX3A 4RFVA 4NCIA 1MO3A 5CM8B 1RRGA 3CX8A 2CY1A 3NG1A 3GLFA 1FZQA 1N2FA 3RS5A 4F7WA 4C0HA 3OEED 3LVQE 2IYXA 3NDPA 1SVKA 2CCKA 1MR3F 3RRMA 2ZUCA 5CM9C 1UKKA 1U0LA 1II0A 4CRWB 4NTZA 2VO1A 4KITB 4PQFA 1GNQA 1NN5A 4P4UA 1RJ9B 3B7GA 2ZUDA 3H86A 1OB5A 1ZUHA 1BH2A 4IVPA 2OM2A 3ZJYA 4Q7MB 4MUAA 4G1UC 2AD5A 2JLXA 4NKRA 2JMPA 3C5CA 2DYKA 1I2MA 2ZM6C 4DCVA 1P62B 1BYIA 2GF9A 5A2QD 2WHXA 3KUDA 3TUIC 2O8EA 2JA1A 1ZNZA 5GJVC 3RABA 4WVFA 3TAUA 1C4OA 3IEUA 3H1TA 3BB1A 3WXMA 4Q9JA 1VHTA 4QJ3A 1Z3IX 5F3WB 4JYAC 2J45A 1E69A 2W0SA 4X64C 2AFIE 4LV8B 4U7DA 2FGKA 5J4VA 4D0GA 1KDOA 2JJ1D 5KTYA 2J0SA 2AFHE 2GKSA 1KI6B 3P26A 2W58A 1KIMA 4FCWA 3THYA 2VEDA 3A37A 3EASA 3MUFA 4Y0VA 1F60A 2ZI9A 1XB2A 4QBIA 3KL4A 5J4HA 2J7PD 2QL8A 3NTUA 3X1XA 1GIAA 3S1AA 5C4MA 4LJ8A 2FFHA 1LY1A 1T0HB 1HE8B 1JBKA 2FGJA 1E9DA 821PA 1JR3D 4PSKA 5DO9A 1FL9A 2A5YB 1M74A 2AWNA 3K9HA 4BGDA 4W7SA 4DLTA 4BFSA 2G77B 2WOJA 5FPKA 1XCPA 4RY2A 1YHNA 2KBFA 3A58B 1U8AA 3LXRA 3UXMA 3ZZTA 4RD3A 1AKYA 3ECCA 5KO2A 1DARA 2YWEA 2ZS7A 2ZRIA 2CL6X 3GMTA 1F5NA 4YLGA 5JI2E 2GVDC 2OFWA 4BFYA 4B48A 1O3YA 4IKEA 2HCBA 1J90A 2VH5R 3P1JA 4ZO4A 1P2UA 4DZZA 2A2ZA 3A1UA 1ML8A 1VDZA 4R2IA 4URVR 2C9OA 1G5RA 4UQOA 2ZREA 3PEVA 3PV0A 3QEJA 2ZJZA 4C30A 1JQJC 4KJZA 4LV5B 4B76A 3HPRA 2ZSAA 4Z8YA 1DVRA 5B30A 1OB2A 5KNCA 3CPJB 4CEHA 3G82C 3JVVA 2WWXA 4JVSB 2WTUA 1VTKA 3THXA 4EKDA 4ACAA 4LF4C 2F9MA 3M6AA 3ICQB 2VLIA 4DIDA 2WV9A 4C2TA 3QUSA 1DBSA 2XSZA 1U98A 1FMLA 2B8TA 4B6FA 4UJ3A 1HURA 3LLMA 3RRZA 5F98A 3VKGA 3NC0C 1TU4A 3CF2A 1P5ZB 1P2TA 2RGCA 4LF5C 2J7KA 3NBFA 4LBWA 3HR8A 1XEXB 4JI7C 5EP2A 4B2IA 5JCPA 5TMPA 3DHWC 3DM9B 1L2TA 2P6RA 1N34C 4M1SA 4LJ9A 1XPOA 3S1AB 1ZIPA 4DV7C 3M0EA 1X8LA 3PXGA 3TVDA 4XSHA 5C1BA 1ZCAA 4QNRA 4KV9A 1EFRA 1U94A 2G1JA 4JI6C 2QU8A 2RMKA 4LC1A 1Z6XA 4DUGD 3LQQA 1KY3A 1X8JA 2P3SA 5TB5A 1EG7A 3A1WA 2IEZA 3X1DA 4B43A 2ZRJA 4LF8C 2ERXA 2EU8A 5KDDA 2O8BB 2Q9CA 4MYCA 2ZVQX 2ZPTX 3DDCA 2FWRA 1E9RA 1EFHA 4A2WA 4WW0A 1ZNXA 1JAIA 1N0UA 2QP4A 4JL8A 4TYPA 1NLZA 1K5GA 4GI7A 4EQ6A 4JLAA 4DDTA 5HZHA 4JBYA 5EE3A 3U44A 2XXAB 1PUIA 1NN3A 4FW9A 2Q3FA 3AV0B 2ZJBA 4UJ5A 2ZSEA 4TL9A 3VR6A 1BS1A 2FZ4A 1T3LA 5KUTA 1P61B 1Q12A 1Q57A 4IFBA 3TSWA 4H1VA 3QKSB 4QGFA 1RPZA 2P0EA 1R8QA 1EWRA 4XVQA 5IHPA 3FKSA 2FH5B 3QE0A 5TV2A 4P33A 2VSFA 4DV4C 1ZCBA 4NYIQ 4D4MA 2ZR9A 3IBGA 1VCOA 3MWLA 4QNMA 3X1ZA 2DBYA 3AF4A 2HT6A 1GRRA 1HTWA 1K5DA 1HYQA 3GD7A 1I2DA 2QTFA 1OV4A 2NG1A 4AURA 1LB1B 1YQTA 4N0DA 4GBMA 1NG9A 4G5QA 3QXSA 4TLBA 1HNWC 1EESA 4TLEA 2YZ2A 1S2MA 2FPLA 4F92B 2V4ZA 5HCNA 1N25A 4B3BA 4IDQA 4XWKA 2DWQA 2XGJA 3VAAA 1G8PA 2FEMA 1X8KA 421PA 3EA5A 3WRYC 2WSMA 2BBTA 4MRVA 1QHYA 4TSFA 4DVGA 1OFIA 3PUXA 3CBQA 4HLUC 1W2HA 4DSNA 2RGNC 2NZJA 5EZ6B 3RRNA 3VTKA 2YV5A 3SC3A 1XNRC 1IY1A 2HEIA 3K0AA 1OIXA 2YYZA 2FEOA 4YC7A 1E1RD 1TF7A 4DR4C 4IOJA 4KSBA 3UATA 4Q1EA 4P4SA 3SJAA 1IN5A 2ZITA 1KI1A 1OHHD 1GL9B 1E9CA 3AUXA 5LBIA 1Z63A 1TTTA 2Q3MA 4V02A 1H8HA 4ABYA 4A1FA 3LA6A 1Z0DA 1UDXA 2FNAA 4IOKA 8OHMA 1E79D 1N5IA 4HDOB 3SU8A 1GTVA 3CNLA 5LPNA 2XSZD 3FFBA 1FX0A 5CJ2A 3SZRA 4KYIB 1XCMA 1Z0AA 5FBRB 5JMTA 3AVUA 1B0UA 1ODFA 4BE7B 1YZQA 4YHHC 4XVRA 5B64A 3KQNA 4FN5A 4ASUA 4ZDKA 5DE3A 3X1YA 1D9XA 2ZM5A 4JI1C 1E2EA 1XD9A 1JNYA 1UKZA 2HDNB 5H68A 1IQPA 1P73A 2C2HA 2QT1A 3BFVA 2VQSA 3KQHA 1ZJ6A 3I8SA 2BM1A 3AVTA 4V0KA 2IYZA 4DKXA 2JLSA 3NIBA 2I1QA 3NHAA 3U60B 5SZHB 1NVWQ 2WJHA 3LLUA 1SKQA 3RHFA 4B71A 3IIMA 2RKOA 2UU9C 3SBEA 1K8RA 1G8FA 1QG4A 4CEIB 3EIEA 3CLVA 3EZ6A 4IXNA 1ZIOA 1B23P 5HCIA 2VP2A 3AVXA 4KU4A 5AR1A 1TMKA 5TVKA 4NCHA 3KB2A 1I4TD 3TLXA 1E2NA 2PT7G 2CMKA 3DZDA 3U7GA 4OQNA 2IUTA 1E2HA 1QHIA 2VF7A 3UG7A 4DUGA 2QNRA 1F6BA 3OEHA 3NKVA 1WDTA 2D06A 2YWHA 4IDHA 3KQUA 1WE2A 3P27A 4DEYA 3RS7A 1DAMA 2V54A 4DR5C 2ZJ5A 4X66C 4DBLC 3AVVA 2NGRA 3PEWA 4F4JA 2JLVA 2XTNA 1AZTA 1NNEA 2W2VA 1DAGA 1P75A 1QRAA 4BFUA 1UEJA 2PLFA 3C14C 1KDPA 2GDJA 2ORIA 3CRVA 4KI0A 3NEYA 3GKUA 4IDPA 4NDZA 5B57C 5ELXA 1E0AA 2ODBA 1G6HA 1GP2A 2O8CA 1G5PA 2YKGA 4UXIA 2ZQ5A 2GJKA 1T3HA 4TN1A 2ZE8A 3PJRA 3EZ7A 4JI8C 4EJSB 2IYUA 3AEZA 4LZZA 2FE4A 4NYMQ 5J5CA 4YXWA 2XX3A 1CF4A 1P7CA 4LPSA 1CJMA 4L16A 1W48A 4G5SA 2QMOA 1IJEA 4DLWA 5H1YA 4C2UA 1W2GA 2GZAA 3ND9A 1R5NA 3RAPR 1P2VA 5KNBA 3ZS9A 2RGDA 1YZNA 2XJ9A 5JFGA 2JGNA 2B92A 1KNXA 2IW3A 4IVQA 1HE1C 4OL0A 5CLQA 3VKWA 2H17A 2OZEA 2VHQA 2X77A 1NSFA 3GLGE 3PEYA 2ANBA 5KSZA 5HZKA 3LD9A 2GEUA 4X8LA 3RVBA 4D82A 2WICA 4HAVA 2I1VB 3BH0A 3SFVA 4BECA 721PA 4ZI3A 4GDFA 2QPTA 1KSHA 1OH8A 4CEJB 2IS4A 1IN4A 1WH9A 1DAFA 3L0SA 4XIGS 3AF1A 4JBWA 3B1WA 2DPXA 3TW4A 3EZ2A 3BOSA 1K6MA 4OKSA 1Z6YA 4GMDA 1ZYUA 3CONA 1AKEA 1LW7A 3L2OB 1R0ZA 2FPKA 3WP1B 1NIJA 1KSJA 1V5WA 1VCNA 4TT3D 5K8TA 3BFXA 1N6PA 1S96A 1TQDA 3BAFA 3UIEA 1KHTA 1OKKA 1T5IA 1VG9B 1U9IA 2FZLA 4TTPA 2J0VA 2ZYWX 3C15C 3K70D 2V6JA 5LMNC 1GOTA 3GJ4A 4A8JA 2F1JA 2HXYA 3DM5A 5TXGA 1KI7A 4M9XA 1P72A 5KNDA 5C2JB 2VP5A 2PL3A 2QPOA 4IW3B 3LX8A 4Q4HB 3PIRA 2KE5A 4EJSC 5FPSA 1QWIA 3QIAA 4R9UC 4D0LB 2QE7A 4P32A 4UXJA 1TUEA 2FSFA 3QF4B 3ZQ6A 1M7GA 3TH5A 2KB0A 3OIVA 1G3QA 5FTKA 3FMIA 5BQ5A 3DEFA 4CGZA 4A6PA 4V03A 4QBGB 5DIFA 4JI0C 2X1VA 5H70A 1KMHB 3EAQA 4D80A 2E9SA 2GCPA 2P67A 4PXAA 2V9PA 2G88A 4RKFA 3WBKA 5JLJA 2IYRA 1E94E 2J87A 2QZ4A 3K1JA 221PA 4MQBA 3FFAA 4RD6A 1U90A 2K5UA 5EE9A 1CJKC 2QQ0A 3RC8A 3TSZA 1CKEA 3L0IB 2YINC 4KVAA 1NLFA 3CRRA 1OW3B 2BMDA 4M1YA 3Q85A 5BR8C 4ZCIA 2DFNA 5CDFE 4OQLA 1FP6A 2V3CC 3L8YA 1USPA 3TBKA 3B1XA 1E0SA 4P4SB 2UXDC 4I99A 3TE6A 3LQRA 5H8WA 4D26A 3EPJA 5DN6D 1VYVA 1ZMXA 3K0AB 2OLKA 3AKDA 1Z2CA 4DLYA 1G7CA 4XWOA 2E7GA 3KTAB 4ZKDA 3ETLA 3ZDQA 3TJZA 1OXTA 1UKYA 3SEAA 2AK3A 2ZRFA 1XJ0A 1UBGA 4DHEA 1HEIA 2IWHA 2D62A 2CHGA 1J70A 1FMJA 1R0YA 1WRBA 2I4IA 2ZRMA 3U3MA 1E2LA 3UWOA 4KAXA 4L9SA 1DOAA 1L4UA 1IBRA 5EUQB 2C95A 3VR4A 4GKJC 1Z0IA 3BXZA 4FMCF 3BGWA 1GG2A 1MABA 2ONJA 3UMFA 1N6LA 3U3RA 4KFSA 4OI1A 4QXAA 3OAAA 3F3YA 1JECA 2ATXA 3D3QA 3QY0A 4X8OA 4B47A 4LCBA 2J1LA 4M2LA 2ZVPX 1OIVA 3IIKA 2YCBA 2J59A 1KSGA 3TR5A 4RJLA 3QJYA 1T8TA 2R6CA 3AGPA 4Q00A 1QF9A 3CF0A 3WYGA 1G3IA 1OH7A 2UZIR 5DLQC 1ZINA 2XTZA 1SXJE 4ZCLA 4J0QA 3EG5A 4AD8A 1VPLA 1FP7A 3MCAA 4BLSA 1OFHA 2GJAA 1IN6A 4NCJA 4DV5C 5FTMA 3KQKA 3K0FB 4PTLA 5FOWA 1K0RA 5BW8A 5DN6A 2DCUA 1Q44A 1NMXA 5FOTA 1Q3HA 3QXHA 3QBTA 4URZR 2Z0MA 4H9GA 2BOVA 1U8YA 2QMEA 4JLDA 2PMKA 4ZIRA 1LVGA 4AYTA 1J8MF 1XTRA 1KO1A 2VHCA 1IY2A 1Z6AA 3B1VA 2EWVA 3FOZA 2Z4SA 2IK8A 3CPEA 1E0KA 1KK0A 3GEIA 5FBQB 2QE7D 1XEWY 4M9ZA 4A2PA 2AK2A 4JLPA 5IRCD 1JEEA 4Q9HA 5EUMA 4EQ6B 2GXUA 4BZPA 4OHXA 1AM4D 1GSIA 1OXVA 3EW9A 5A0FA 4EDHA 3T12A 1GVNB 1KO4A 4KO8A 4WZAE 1FNMA 1II8A 1PZNA 4JI4C 4C0AC 1E2PA 3I61A 2IEYA 1QVAA 1W49A 3K09C 5J47A 3O8CA 3QEOA 2W0MA 3LNCA 1Q1BA 4C0LA 4D4JA 1WBDA 3VR2A 3TGPA 1L7VC 5FL3A 3Q7PA 1MO6A 1VIYA 2CNWA 3CRW1 5FPHA 3RSLA 5KDOA 1UJ2A 5AUOB 2ZXUA 2RGBA 5EXSA 2W83A 4Q4JB 3IUYA 4LSGA 4DCTA 1EWQA 3SDZA 1O87A 1SQ5A 1E6CA 1E4YA 1VCMA 2VP6A 3QVVA 1M6NA 4O2RA 3A1VA 4G5GA 4HUQB 3W8RA 1YR7A 4BZXA 5J4LA 4PPGA 1N6OA 4EFMA 1IY0A 5JZVA 4DB2A 2QY9A 2BEKA 1KKGA 1Z6GA 4II7A 3BORA 4A36A 4KFUA 4TMTA 1FX0B 2E8EA 3TSOA 2A3RA 2AX4A 1TUIA 3X1WA 4Q7LA 4HLCA 2P6UA 2R65A 4TQ9A 4URWR 4EFNA 1OHHA 1TNDA 3VR5A 2YNMA 4FWIB 2CE7A 4OQFA 3VR3A 4ACBA 5L3QA 3HU3A 3DKVA 5D3QA 3H4MA 4IDOA 3U5ZB 2G6BA 1OPXA 3HWSA 2PCJA 4FI3C 1DPFA 4JIMA 4AWXA 2LCFA 4KBGA 4L5BA 2NIPA 1NY6A 4Q01A 4LOAA 2E8CA 3LW7A 2AXNA 1G7TA 1TQ6A 3GLIB 4KHZA 1D2MA 1OSNA 5HKKA 5E4FA 1KI4A 4NYMR 5HTKA 5FL7D 3W34A 3KKQA 2VTKA 3TKLA 1VECA 4B3DA 2ZE7A 3EWAA 3CRMA 4G3XA 2CK3D 4PC7A 2CLDX 3CNOA 2VP0A 1D6JA 2ATVA 2OBLA 3QXJA 4FMDB 2GXQA 3RS2A 3K0EA 4BFWA 3A36A 2G83A 2ZI6A 4A9AA 1CRPA 3V9PA 2HCJB 1Z08A 4DV1C 4JT2A 4AQYC 4DDWA 2FOLA 3AVPA 3LY5A 2D2EA 2FFBA 3GLGB 1TPZA 3KFVA 3GEEA 4LC0A 3QF4A 1ONBA 2NO9A 1A2KC 3G0HA 2XZLA 4G0NA 2R62A 2XTMA 2ZE6A 1ANKA 1W4CA 1JJ7A 2J41A 3LBIA 3E5HA 4YXWD 1II8B 2QTVB 3FGNA 4LJ4A 2AKAB 1J5EC 4IRUB 3DMNA 2RH5A 2QAGC 5DYIA 5EE0A 1Q1QA 3T34A 1YR6A 4EPWA 4FIDA 2XITA 4TL6A 1ZUIA 4D0NA 5FL7A 3IQXA 4WZBE 1NN1A 4B3SC 2PZEA 4B44A 1FTNA 4IHQA 1ZC3A 3TMKA 1JALA 3U44B 1Z8FA 2HXSA 1TEXA 2ANCA 2WAYA 2CDNA 5GJBA 2EFEB 4E09A 2O5VA 3AB3A 3ZD7A 4NL4H 2ONFA 2E1RA 1HUQA 1GAJA 1U0JA 2JATA 2UKDA 2PJZA 4M4SA 1Z5ZA 1OYYA 1GKIA 2I3BA 1M8PA 2IC5A 1Q0UA 2ZSBA 3GLFB 1CU1A 4BUJA 3SI7A 4X65C 1EK0A 5FPTA 1N32C 1WBBA 1Z83A 2QGNA 3E70C 3T5DA 4AKGA 3AKYA 3GLGA 4RKEA 1R10A 4X8HA 4YQFA 2QBYB 4JL6A 4R98A 1HV8A 3PENA 2VQFC 2N1BA 2J0QA 5GJWC 1GILA 1DTSA 3C41J 4ZDWA 4KLNA 2YWGA 4R71A 2HLDA 2WJYA 2F1RA 3KKNA 1XDBA 121PA 3DPUA 3GQBA 3H0KA 2ZJOA 4OI2A 5EE5B 4RCZA 3VU9A 1A2BA 1SULA 2MMGA 3U2QA 3B5JA 3N2IA 1M2OB 3H2YA 4L8GA 4Z1MD 1IJFA 1MV5A 1PLKA 1MABB 2IS2A 3L0PA 2GK7A 4HYYA 4EJSA 3O8DA 3OTOC 2JIZA 5A4JA 1EGAA 4KHPC 4Y0AA 1UPTA 2QM8A 2ZANA 4Z51A 4LHZA 5L3QB 2IYSA 4DUZC 2V8OA 4MRNA 1G7SA 3OEEA 1SGWA 4ILEA 3HU1A 3U3OA 4TMWA 3I07A 1ZD1A 4QJ5A 2WWIA 1N6RA 4WIAA 3ADCA 2Z6VA 3QENA 3KTAA 1XU4A 2PH1A 5HKKD 3R20A 3UPUA 4MRRA 4PQYA 2X2FA 4ZDJA 4RD1A 3W5JA 4MA4A 4B33A 2JDID 4AY2A 3T1VA 2RAPA 3ADBA 1YVDA 2O0HA 3X2SA 1IAQA 2B8WA 3KKMA 1YKSA 3HYTA 2G3YA 4CIDA 2QUZA 1KOFA 5L8VA 1KO8A 2GZHA 3I32A 4NCKA 1N2CE 2P5TB 3CR8A 3L0OA 4LJAA 4PSVA 3LXXA 2MSEB 1E2DA 3TUZC 4LFAC 3PUVA 4MDFA 4G5RA 3AP3A 2NO0A 4TYWA 2ZRBA 1QDEA 2EVWX 4MGIR 1S4QA 3FMFA 2F3RA 3Q3JB 4ZDIA 4CEIA 4KLZA 1X1RA 4V0OA 4LF9C 3K9GA 3VNUA 4MGZR 2O8FB 1II9A 1IHUA 3GFOA 1KI2A 2JJ1A 1W0KA 4C0BA 3ZZUA 1PA4A 1LNZA 2YVUA 5JJKA 5C18A 3IDQA 2GNOA 1MRSA 1X6VA 1M34E 2ZU6A 3THWB 2QORA 3U7FB 3QPWA 5DYGA 2WSSD 1KDTA 1M7HA 4BFVA 1E9FA 2ZE5A 5IT9D 2N46A 1VIAA 2YC4C 1S3SA 3BJIC 3ZVNA 4Q4HA 3JZMA 4B3MC 2JJ8A 3IILA 1P2SA 3PVSA 1ZW6A 3GEHA 3ADDA 3B13B 4L9WA 4RZXA 5DI3A 5D3MA 1E2KA 1DG1G 2QRNA 1BOFA 4A6XA 5P21A 3KX2A 4HZIA 2C96A 2ZU0C 4EPVA 1D2NA 1JOSA 3LX5A 2JJ2D 1OFUX 2OCAA 2RB4A 2UZ3A 3D8BA 4OYHA 4AG6A 3VKHA 4HLUA 3CX6A 2ZI7A 4BFZA 3ZD6A 1EX6A 2V1UA 1G1MA 4GOXA 1KKLA 2VP4A 1QBKC 1W4RA 4Q5IA 4LJYA 3OHMA 1L8QA 1OYWA 3D6TB 1XXHB 1FJGC 1KSFX 4LBYA 4XTRA 3AVOA 4M53A 2CLCX 2VHJA 1E2QA 2ORVA 4W5WA 4A82A 1XMVA 5J4YA 4BZQA 4ZCMA 4L15A 4Q48A 2XZOA 3IIJA 1GNRA 2B6HA 4Q66C 4N0EA 2Q0HA 1FPMA 4GT1A 4POAA 4DLXA 4GPTA 4ASUD 2FFQA 2CEAA 5CB8A 5DISB 1G64A 2OXRA 5B2ZA 5IK2D 2FJUA 5JRJA 4GZLA 1YZKA 3RLFA 5FI0B 3I4LA 4JLVA 5FOSA 3QG1A 2HLDD 1CXZA 2UUCC 1IBKC 1Z47A 2EFDB 2XB4A 3LWNA 3CWQA 4LYJA 5FPYA 1QHXA 4HLQB 3UMSA 2OESA 3KUCA 3THWA 2ASEA 1G7RA 4U00A 1W4BA 4JV5C 2OLJA 2N42A 2W6ID 1E2IA 2PBRA 3PG5A 3PITA 4BEBA 4URUR 4A2QA 3O8RA 2OT3B 4OQMA 1F2UB 2CLSA 1DAKA 5FH9A 4DT1B 2ZJYA 5EXTA 4TWZA 3G5UA 4QC2A 2GEVA 1E99A 1GL6A 1YRBA 4Q1BA 4AYXA 2A5JA 4A4DA 3R9WA 3GJ6A 3IGFA 5TY0A 1EX7A 4B6EA 3WYFA 3QNUA 2ZJ8A 3BK7A 4P31A 3J81k 2Q6TA 3U4QB 3CR7A 3PR1A 2VQEC 3I5YA 3ZZ0A 5TARA 3E2IA 4Q1CA 2ZROA 1ELOA 5HR5A 2BJWA 3J81D 2P6NA 1LQLA 3VQTA 1KJZA 2OILA 4PHFA 2WSSA 1XF9A 1LV7A 1EXMA 4PC6A 3ZLJA 4YDHB 3HYRA 2BV3A 4WXPA 4PC3A 4KSCA 2BWJA 4XSGA 4H1UA 3VFDA 1SVIA 3MGCA 2CXXA 3ZVMA 4NU0A 5JJLA 1N5JA 4G01B 4Q47A 1VCIA 2GXAA 4A0HA 4OQXA 1XTKA 1HR0C 1ETUA 1HT2E 1TF2A 3CF6R 4OJQA 3K0SA 4JVMA 1OJLA 3HJNA 3B60A 3KKOA 2QP3A 5AUPB 2DR3A 3LBHA 1UDWA 4O25A 4YMVA 1ZC4A 4EPTA 2RCNA 2VPPA 4DV2C 1IXZA 2YC2C 3EIHA 2FF7A 3PUWA 1T6NA 4U02A 2F43B 2GCNA 2QG6A 2R8RA 4Q4AA 4V0NA 4Q03A 3EXAA 5SZKB 4LFCC 2IXGA 1E79A 4PO9A 1UADA 4BRWA 2ODWA 3VU9B 4TYYA 1RW4A 4JI5C 4M1MA 1JPNA 4OX9C 4CVNA 4TMZA 4B34A 2VIIA 1KYIA 2FN4A 1RYFA 2GCOA 1UBEA 4WAUA 3RWOA 1W5TA 3BD9A 2D4HA 1SKYB 4HEJA 4DSOA 1ZM4A 4QJ4A 4LBVA 1YZLA 1N6HA 4NYJR 4JBXA 4DR1C 1JR6A 4IEIA 3REGA 2QN6A 1I4DD 1X1SA 2PX0A 4I1VA 1JEDA 1IXSB 2REXB 1BKDR 2CCGA 2ERYA 3VMFA 2X2EA 3NBYC 3NBXX 4KFRA 1AA9A 2FU5C 3LW8A 1R4AA 1N33C 4XWAA 4HZUA 2QEQA 1UM8A 4RD4A 2GHIA 3GLHB 3R7WB 5F9HA 2MMCA 3QF7A 4DLSA 1RFLA 3AP1A 4LYHA 4BLPA 2VBCA 5KU1A 4MKGA 4F4IA 2QGZA 3ADKA 3HU2A 1HT1E 2GAAA 4LY6A 5DSZA 3T5GA 4E22A 1G9XA 4PPQA 4PAMA 3RS0A 1EFCA 4M21A 4XOIA 3IO3A 4A15A 2ZS9A 1NMZA 1VG0B 2HV8A 2WJIA 4V0LA 1NVUQ 2DFLA 4QKQA 2QQEA 2KSQA 4JLKA 3SNHA 2WAXA 1F2TA 3BFKA 2ASBA 5CK4A 2HYIC 4I1SA 1NJFA 5BYJA 1S9HA 4L4UA 4Q9KA 5AJYA 1XD8A 2C04A 4HLDA 2NPFA 4PC2A 1R0XA 2GAOA 4ESHA 1WCV1 4C0QC 1P3JA 3L43A 1D9ZA 1NY5A 4KFTA 2BJVA 5EQTA 4DEXA 2XXAA 3NDBB 2KWIA 3SOPA 1Z07A 2PT5A 3AUYA 2BCGY 5FFMA 3RS4A 2CVHA 2OXCA 4MYTA 1P9NA 2ZRKA 3CIOA 3U3KA 3EPHA 2QA5A 1U2RA 1E2JA 3NC1C 2DFTA 3QKRB 4WXRA 3PCRB 1WXQA 2ZRAA 4UXHA 1G16A 5EP1A 2FMXA 2ZRLA 1R2QA 4P0TA 4XD7A 1US8A 2F4VC 4ARZA 1E9BA 1G18A 1CJTC 2NOAA 3BB4A 1T8UA 3JVUA 4HI0E 1U81A 5AJVB 4PC1A 1KMQA 4WZ6A 1NN0A 1NL3A 2ZYVX 2EGTA 1PLJA 3GCGA 1W36D 3FMPB 2W2TA 5KPDA 5CYPA 1ZD8A 3C16C 1MKYA 4XJXA 4Q19A 2WPDA 4IOLA 4JLOA 3WMGA 3DOEA 3OFND 2RGXA 4IFEA 4YY3C 2XOKD 521PA 3QI2A 1XTQA 1YZTA 3BS4A 1KKMA 2D74A 2D2FA 2CL0X 4JSYA 3W9YA 4PAOA 2JLYA 3O8BA 4PFSA 3QOFA 4FXPA 4EUNA 2O0KA 5JBQA 1G17A 2D7DA 3Q9LA 2O52A 1QVRA 2WMOB 2JCSA 2QRZA 2V1XA 2CHQA 1ESMA 2C8VA 4BFXA 1SVMA 3IO5A 2C03A 2GXSA 3UK6A 2XR1A 4UNRA 1PVOA 3IPYA 1KZGB 3CRQA 2UXCC 1W44A 4Q4JA 4CT4B 1AZSC 4D6PA 4GZMA 2QT0A 1R5OA 3KJGA 1BMFD 4MKFA 2R6DA 3NH9A 2VYFA 5GJCA 4LHYA 2ORWA 5FUVA 3TUJC 3VHXA 3NEJA 4BASA 2AD1A 5ANRB 5CJPA 2VF8A 3NBZC 4MYHA 2ZJ2A 2HHHC 4LHXA 2G1KA 1OXUA 1F3OA 3SS8A 4RD0A 3A1SA 1G3UA 3T35A 1OH6A 4QBFA 1Z22A 3Q5EA 2J46A 1X3SA 5IT5A 5HPYB 2PJRA 3CJEA 2BMEA 3KJIA 5KYKA 1JXOA 4DV6C 1ZB9A 1CR4A 1P9WA 4HSEA 3ICEA 2J7PA 2JLUA 1CR2A 4PANA 2XZPA 1T4GA 2QMUA 3DOFA 1G41A 4B3FX 5JECA 5CITA 3RANA 1US8B 2WBLC 1EFTA 1A82A 4LX0A 3R9XA 4GKKC 2CL7X 3B9QA 4KVGA 4HUTA 4D25A 1XMJA 1R8SA 3QKRA 2IS6A 4GFDA 1NG1A 1AK2A 1V43A 3ONWA 5KPJA 3IEVA 5G3YA 2OCBA 2P2LA 1VG8A 4HB3A 1VLAA 4MKHA 3MRSA 3ZGXA 1WP9A 4R2HA 4KXFB 2P5SA 1NBMA 3EA0A 1KI6A 1WA5A 5DH9A 3SYLA 3W8NA 3IHWA 1RZ3A 3PFIA 1G8GA 2IS1A 2TMKA 3TW8B 4O3MA 4IXMA 4RFSB 2ZIAA 1ZP6A 3CH5A 3N2EA 2MSDB
chains in the Genus database with same CATH superfamily
1U3FA 3V7YA 1EFAA 1WW8A 4BJ3A 4C4AA 3GA5A 5CA0F 2I6GA 4HDMA 1SCKA 2GWHA 3CZQA 3R4CA 4KSYA 3T7CA 3LGAA 1Y6JA 3DT9A 3K0FA 1WPXA 2IELA 3ZU5A 5K1ZA 3H4VA 5C1OA 2CVPA 3LCUA 1JIUA 2FPXA 1JVBA 2VCHA 2UVQA 2Q5CA 2YHSA 5K3FA 3KZ1E 2OHJA 3IDSA 5JI3E 3B52X 5KS2A 3ODGA 1CUJA 1T43A 3KZVA 4HCJA 2C84A 5KB3A 4B32A 4AY6A 1XAHA 3H9JA 2M9MA 2PMBA 1XNJA 1D2HA 5B58C 4QPDA 4BO1A 4P8RA 1YQGA 3N75A 3DOUA 4XFKA 4URYR 4KUEA 4KNYA 3OH8A 2OZKA 4NZ9A 5LKAA 3ESXA 4KQ1A 3ZY3A 4WV3A 1JKJA 1Y3AA 4ZVKA 5KKNB 3HBMA 3OWHA 3OZSA 3PHGA 4PPFA 3NAQA 3TCXB 4D56A 1ZJ4A 2PGNA 4I4NA 4EKGA 2RC5A 1J1UA 1J8VA 1Q21A 2G67A 4J76A 2VT6A 4JKYA 2JHPA 4WZBA 4KCGA 1N36C 4F12A 2HQRA 3PBKA 3DAGA 4QYWA 4ZYYA 3UXYA 5LJLA 1SU6A 2V4MA 4X90A 1T36A 4YMWA 3I8OA 3WDMA 2EGHA 1JWAB 3HABA 5AOVA 2REQA 1CS4C 1K66A 1W76A 4OI0A 3B20A 3FUVA 3LIPA 4PNPA 2PXAA 2PTHA 3R2JA 3U09A 2G0TA 2HNKA 4X92A 2XYQA 3PGKA 1WB4A 5C0OE 3FMGA 2OBVA 3E7XA 1IHPA 3PHIA 4LA4A 4RXTA 5FXMA 2VSXA 1A8PA 4A0FA 1JH9A 3IQEA 3SIXA 5DXFA 1GZ6A 4ZO6A 4O2BB 4Q4AB 4B73A 1IONA 4PTYA 2ZATA 4COKA 1G59A 2VXYA 3DJFA 3IVRA 3WK4A 5JT1A 1FTWA 4X62C 1EA7A 1XZPA 2JASA 2WWTA 1P8JA 1CQXA 1H9BA 9GPBA 4OHVA 1WG8A 1BQ3A 3G2PA 1FMTA 4OXYA 3UY4A 3FHTA 3SVZA 1E8DA 4HRVA 3EMKA 3JQBC 4B3RC 5HIMA 2AKEA 1SKYE 1PZFA 2CNNA 5TQVA 4EKIA 5FBWB 5AT1A 1K27A 2HZBA 2ZYUX 4J1QA 4QICA 1DCKA 1I80A 1N92A 2IJGX 4QATA 3W05A 1DADA 2ZP1A 2PA3A 3MJDA 3RHSA 3TR0A 1AS0A 3JZAA 2YWDA 3UMRA 3LTEA 4HAOA 3A70A 4NWIA 3U7JA 3R8FA 4LF7C 2VP3A 3LUBA 4TUYA 1G1AA 1DRVA 3T1TA 1L7AA 1CUHA 2I3GA 2HGZA 2ZAMA 1W36C 5KI6A 2MMAB 1FUEA 1TYEB 2WKRA 3KELA 4FHZA 1QP7A 4O4LB 3PCXA 3QE4A 3HB1A 4FKMA 3O84A 1YKFA 4KXWA 3ZCVA 1B73A 2P35A 4KZKA 5DIZA 4IKPA 1UF9A 4LVNA 3RSFA 1DAEA 2P41A 5I51A 3TAXA 1R50A 2XCLA 2XVXA 5JSHA 4C4XA 1ISIA 2QMQA 3DL0A 3EY4A 4XGIA 4CTKA 5LP1A 5JRZA 4IGIA 4WBXC 1CQPA 5COAA 1XDUA 4YAIA 3AKCA 1UDCA 1NW9B 3EISA 2PS1A 1JEQB 3ZG6A 2P79A 1RWOA 4TYQA 2C1XA 2ZB8A 4O02B 1J99A 5EWMB 3WWCA 5L3SB 4MQUA 1LSOA 2O2IA 3KVNA 3EYWA 3BRSA 4ITVA 5DX8A 3QX3A 3KT0A 1ZNWA 2FAXA 3N1UA 1MUUA 4PPYA 3OIYA 5K99A 5J23A 1Q77A 2RAVA 2JLZA 2FOXA 4OQ4A 3FIJA 5K7SA 1G5HA 2WG0A 1XBTA 3A3NA 3FUWA 3Q15C 1BDJA 2D28C 4I3GA 3KSUA 3DFIA 2CXRA 3MINA 1DEHA 2IP2A 3L0CA 1ND5A 4MI1A 4MKZA 2FUEA 4PROC 2FN8A 1CHDA 4AKEA 3FMOB 1NVVQ 4L8LA 3MS2A 1ZVJA 2C9YA 3DEZA 2XHZA 4HDRA 4L51A 2AR0A 3P9ZA 4KH1A 5JEEA 1KO5A 1XPRA 4NXMB 1Q3TA 5EYPB 1VIDA 3COWA 3WBFA 2FWPA 2JLRA 4F6RA 1I3OA 4DB4A 4P38A 5IEJA 5H3CA 3E6AA 1KQNA 4KX3A 4LMBA 4YJGA 5ALVA 2X13A 3D4PA 1MCZA 4QGGA 1TT5A 4A0RA 1KETA 1Q91A 1W47A 4EVRA 2YZMA 4K2HA 3FH0A 5JQGA 3G3EA 4NHOA 3TTYA 1LFDB 1HYEA 1W85B 2FMFA 2XOKA 3K8YA 3QTLA 3OKAA 2C9MA 1MOZA 4O29A 1IY8A 4C7BA 1J6UA 1GAWA 1TQ8A 1P81A 1P4JA 2O7SA 2PIAA 2C77A 2ONZA 1AQLA 4X8MA 3R7SA 2FQXA 3GD5A 3ZIAD 5L4SA 3CT6A 4ZKEA 1USIA 2X4GA 2DTEA 3LO5A 4GVLA 4N0QA 2H1LA 3QA9A 1CRZA 2LXNA 3BZBA 4MKIA 2O8CB 1XJ5A 4K81B 4GHWA 1UWDA 1EM6A 2MSWA 3LDAA 4PAWA 3B85A 2EX0A 4EO4A 5ILOA 3ACCA 1N9ZA 1QOZA 1WSBA 4BYGA 2KPOA 1LDNA 1MW8X 4YJ3A 4U2KA 4UOEA 2YXLA 3EVBA 1ZI8A 2QLFA 3BH7A 4XUGB 2JIBA 5FOUA 4UREA 3D81A 5I8PA 3EXG2 1EPUA 2JAPA 2WIBA 1OZAA 3ZVLA 3F78A 3JQ6A 3WGQA 4BE9A 3QLVA 3IKLA 2VT2A 3DXXA 5A7FA 3VX4A 4CM1A 1MA0A 4MW4A 2ACVA 4U9UA 1APBA 3EUWA 4FT4A 4Q16A 1XTIA 2BTQB 1EP3B 2OAP1 3MLEA 2Y3IA 1PDVA 3NWPA 3SJ7A 4YYEA 2X8BA 4E08A 3GBSA 2CLMB 3GIWA 4JLBA 1NASA 3SYKA 4BB9A 5D3MB 4KGDA 5EL0A 3FOCA 4ZPJA 2B2CA 3PC8A 5IW8A 4EMTA 1QH8B 4E5VA 3WBJA 3AOGA 1FXWA 2ZULA 3BKWA 4FZ3A 5DLDA 3A9VA 3ESAA 2RGUA 1JI0A 1ULTA 2P1ZA 2Q3LA 5D7NA 4CUKA 2VAVA 4IR7A 3OBIA 4F5EA 5FOXA 3C39A 1VZ3A 2VFAA 1KDRA 1KMHA 1U0RA 3PYMA 5C8DA 5K0ZA 1EEXB 3A7DA 2DHMA 3KEFA 3RC7A 3P94A 2J3KA 2WOOA 1HA3A 3M2PA 4DV0B 3J80D 3QVWA 2DYJA 2I87A 3HYCA 3T99A 4D4KA 4RL6A 3D6HA 5BN3B 5IKXA 3LFTA 5TVGA 1Y33E 1HETA 3PXCX 4JZKA 2RIPA 2Y1FA 3UB4A 4DC1A 5JNSA 3A3YA 3AQIA 5HF5A 3VAYA 5KNDH 4NDNE 5DWDA 2FDXA 5DGXA 5AXBA 2CJPA 4RAOA 1Q84A 4GBJA 2PCLA 1T29A 3V4LA 4RDCA 2AG0A 4JXZA 2ZZNA 5DBGA 2AQKA 3P2IA 2ISCA 1HFWA 1XEXA 4QHTA 4LJKA 1G2PA 1MX1A 2CZGA 3I28A 2W4MA 4FILA 2PZAA 4EAQA 3NUGA 2EJUA 1U2GC 2VF2A 3JPYA 3L7JA 2GA8A 2ZPUA 1E66A 3KB1A 3M6LA 3E81A 2OA0A 1EUDA 4FFPA 4I81A 4BCDA 4BQEA 4LF6B 1AVTA 5L3VA 1HZZA 3VR6H 1KAQA 1WTCA 3TIIA 2M6KA 3VU3A 1T5LA 4FGWA 5BWLA 1UK6A 1AHPA 1T2VA 2QSZA 4MDEA 4MPRA 1CQIA 1TCAA 2NXJA 5DBHX 4CN9A 3UH1A 1NA5A 4MV8A 1HQCA 2GO1A 1GTMA 4AFNA 4QRIA 1P4RA 3I58A 4RLFA 3C8ZA 1ZUNB 4HNGA 7ADHA 1VP3A 1G21A 2WJ6A 3HO6A 5HIJA 4DUPA 4ER7A 2FSUA 4OB8A 5D84A 2OCLA 4Q18A 2RIRA 3V4FA 1HDZA 4INOA 4MRMB 1HBJA 3D4BA 4JJFA 2DGDA 1X7ZA 1AQIA 4M0LA 2W70A 3TM4A 2QTWB 4KOAA 5LU9A 4RK7A 2PN2A 3LDFA 1P33A 4CTJA 4XGRA 5K8UA 5I4IA 3FYHA 3WTBA 4DRZA 2RSLA 4PX3A 3UANA 4CLEA 1L6IA 1ST3A 2AI2A 3HKBA 5DOVA 1LUAA 4MS3B 3VI3B 3AT1A 2C9BA 3VOTA 1XWWA 2HMSA 3OCWA 5LMZA 2D0DA 2WWFA 1L3BA 4XXHA 5C5DA 4RFLA 1SVOA 2ORED 1PWXA 1LS6A 3IMLA 1ZQ1A 2IHVA 3I9KA 3MWGA 1E4EB 4DSZA 2WABA 5I4BA 5ITWA 2AYYA 4KGVA 4OHPA 2EARA 4YDSA 1EBUA 2B20A 4JENA 4EPRA 1YFJA 1J5EB 1H2BA 1Y6QA 2HV9A 4NZOA 3COPA 3I76A 3RAFC 4TLAA 3REFA 3OCYA 4CM4B 4RD2A 4U9IS 2ATWA 4F60A 2R4UA 2EQBA 4OF4A 3PUZA 3U61B 2X5KO 5B6PA 3ITKA 4HFJA 3H8SA 4LZPA 1ZK0A 4HAUA 4UQPA 3TQRA 5ARBA 3QKSA 4MRAA 2ZI5A 4PZYA 3TVTA 1CY1A 4AROA 4NMMA 3PGJA 1WB6A 2P78A 4QGHA 2AQHA 2FX3A 1ZOIA 2QBYA 5E6UB 4TS3A 3GLIE 1G21E 2NTEA 2YWFA 1L5KA 1K7CA 3WP0A 1JDVA 2BGRA 4UAVA 5BWNA 4IICA 3ND7A 1X42A 3ZWCA 1QQTA 2GKGA 4CKXA 4E0BA 4M0CA 3IFSA 1V16B 3B3GA 3JZDA 2EW2A 1K3UB 1H8ED 2IU3A 1V8FA 4XX0A 3WYBA 3ZI4A 1B0PA 2A30A 5I4KA 3ZYZA 1BC5A 2VYND 2G0NA 2FPGB 4YP7A 4PLFA 4ARIA 1C7ZA 4BKQA 2D54A 3RRYA 2IUSA 3OM0A 3MMSA 4NE2A 1NXSA 1YJQA 3MYRA 4RV9A 1A2OA 4EO9A 1U80A 1PF7E 5HSGA 3D6JA 5EQDA 5TNXA 2Z43A 3HB5X 2EXXA 1M2KA 1N0VC 3VUFA 1U8ZA 1QK5A 2PYIA 3OCCA 4PGMA 4RQTA 4XQEA 1JG1A 2PQ6A 1G20E 3IESA 1W52X 4JVLA 3PQ8A 1D04A 4J07A 4OJNA 4A0QA 2QG4A 1UBHS 2Q7DA 3WK5A 1XL1A 2QW0X 4Y18A 2OHFA 1U7OA 4A92A 1HTBA 2O2YA 4QJBA 5K4AA 3EXEA 4BMZA 3DG9A 5BP7A 3E1GA 5LB4A 3X1KA 2IF2A 4L6AA 3G2IA 5FOVA 4AJPA 3QQ5A 1JG4A 4ZEXA 2QXUA 2C54A 2V5VA 1OXKB 2ODAA 2XMZA 2YIDA 1C3EA 3TLZA 2NYUA 2FSHA 1E9AA 2GKOA 2PVPA 1EJ0A 1DIGA 4I8XA 4JBGA 4JHXA 1V4NA 4KQ9A 4RZUA 2Y2VA 4BQIA 3W5VA 4FHGA 1HX7A 4BKOA 1E7MA 2O8DA 2O7QA 1OLSA 1HH4A 2Q9BA 4RHFA 7AT1A 1AMUA 1E6WA 1WR8A 2QLMA 4XAQA 3BBPA 1WF3A 4CLRA 1IZ0A 3EFBA 1YHYA 2FSSA 3PRJA 4DYDA 5IT4A 3IPXA 4MMZB 4NBNA 5JBIA 5LLDA 4WFQA 2EJTA 2C4NA 4BNDB 4DGSA 3HZHA 5EE1A 3B9BA 1YDFA 3UHFA 1WDLA 4RV5A 3ZH2A 2EBUA 3C3EA 1OBFO 5U1PA 4F93B 3ZIAA 1VIVA 1HNZC 3A1CA 1CIPA 3E7FA 1AKWA 1M2VB 3ZH9B 3I52A 1GZSA 3H2GA 3ZHZA 4KN6A 1PQ4A 1TQ4A 5MN6A 3N2LA 2OO7A 4O6VA 5EWJB 2XVAA 2X0RA 3U3JA 1GNTA 3EOZA 4EHHA 1KEKA 3WGVA 2IOFA 4QPPA 2IYYA 2NM0A 3PZRA 4UVDA 5FNVB 2OVFA 4JI5B 1JB1A 2EBFX 5F7ZA 4HDCA 4D9IA 5F2EA 1T0JB 1BWPA 1IRXA 4NMLA 1M83A 4AY3A 5B2FA 5EHIA 4JT4A 2E4ZA 4KR9A 3ZWOA 3K72B 2W6PA 1E6MA 3TOVA 1VE3A 3SOZA 4UOZA 1U31A 1NQOA 2BL4A 2UYGA 3PF9A 4LDNA 5E0KB 3E05A 3KSDO 1Q1ZA 2EX1A 3KEMA 4DM4A 1R8JA 3UENA 3M81A 1GWNA 4BFCA 5H16A 1JAYA 3FSEA 4IQFA 3A4IA 1YKGA 3F8TA 2EZUA 3SHTA 3DDHA 2OFXA 3ESQA 2H2DA 2JCBA 4TS1A 2DMRA 5BN5A 5CTAA 5AKIA 2Z5FA 3LHSA 1T1GA 1F48A 2IXFA 2CL5A 4JMPA 1RZVA 4TKUB 1Y63A 2F64A 3ICPA 5K6RA 3ZDXB 2O3JA 1NT2A 2XRMA 3R6WA 4YMSA 2C9ZA 3H99A 3I12A 4IGEA 1N2CA 2JFBA 4YJ2B 1C1DB 1GFZA 4N3BA 4RH0A 3PC2A 2R6FA 1DE0A 4A91A 5BORA 3P9CA 5LD2C 4Q9LA 5DSTA 1KMCA 2H06A 4US1R 1EEHA 4S2UA 1QB8A 3LA8A 2HRDA 3RW9A 4CUZA 3WFJA 1J5XA 1SKAA 3TL2A 1GDTA 1QX4A 2F1IA 4MW0A 4KLRA 1CULC 2UVPB 4DBVO 4ODJA 1HPLA 1DG3A 2NU7B 4Q9AA 1QH0A 5J59A 4ZHSA 5TR9A 1E7SA 3ZY2A 2GCGA 4WFJA 2YJ4A 1N9KA 3H2JA 4GMHA 1KOLA 1Q1AA 3VNSA 1Z2EA 4QXOA 3WRVA 2HJVA 4AICA 3ZZ1A 4IEFB 4Q7QA 4WPGA 3Q7TA 4HWPA 1KYVA 2COEA 4NHEA 5DTJA 2FX5A 4D45A 5AOBA 2OUIA 4FT2A 2DE0X 3DVAA 3MLBA 4GL4A 1HQYE 2CKDA 2RARA 5K51A 4DV5B 3EMVA 5ESRA 3D6NB 3LO8A 4MW5A 1YGPA 2OCGA 1CJUC 1ZLXA 3MG9A 3N5CA 1LPAB 5DBOA 4JX8A 3PEEA 1FF9A 3O0DA 1Y8RB 4I1OA 4BNXA 4UMDA 3WMFA 1AB6A 3VNBA 5HZGA 5HXAA 2EBWA 1BO6A 1DG9A 3EMDA 4YI3A 4ZJUA 2XNHA 1XI2A 4RCYA 3T7JA 4L8YA 3UC5A 2XNSA 4AKHA 1NUHA 2FPRA 5CRIA 2C20A 1R6TA 3G6KA 4OA8A 2CYCA 1NSTA 3BE4A 3HLYA 4IHAA 2GJ4A 4JY7A 4L2IA 4L74A 4RJ2A 5EKXA 4K6FA 3OUZA 3B53X 3L5OA 5FWXA 4GX2A 1TGVA 4JMLA 2BVNA 2NZ8A 2LWIA 3LLSA 3ZK9A 3WWDA 3GZ4A 1TUGA 5F51A 4YRQA 3GPLA 1W4AA 4BAUA 1C2TA 2QTBA 3EODA 1RAAA 1XVIA 5T6MA 5IK2A 1YOBA 1Y7PA 2F1KA 2IV7A 4QARA 1A8QA 4FDAA 3IULA 4FCTA 3MELA 4HQLA 1RYZA 5AVJA 1WU8A 3C3AA 1BAPA 1KEZA 1WQ3A 3B78A 4MQFA 3FOAA 1NR1A 2DU8A 1NQVA 3KAJA 1M1NA 4MWCA 4RPKA 4RPHA 3T1OA 4KTVA 3DKIA 4EPXA 5K6AC 3W2EA 4GKVA 1AJEA 1L7EA 4XOUA 5FR1A 5AVUA 3LPMA 5AIBA 1XMPA 1BWSA 1F7UA 1ZVKA 1OA1A 2CKMA 2EFHB 1NQTA 2C29D 1ORDA 5KDLA 2BMFA 1J1IA 3PXXA 2HF8A 4YQEA 3P0RA 1MQ9A 3ZDZB 1QANA 2ZBVA 3MOIA 4YUWA 3OX2A 2WKPA 2R6AA 1LF5A 3FKJA 4NP6A 2WWGA 4GL2A 2M2IA 3A32A 4HAXA 4BSZA 5G41A 1BX0A 4FGZA 3UB3A 2PT7A 4QLAA 4Q1FA 4YP6A 1W87A 2RAFA 1J5PA 4TV9F 4A8JC 5CFRA 4YLYA 1MFPA 5BN4A 1BTOA 2O19A 3EERA 3B3QA 4U7PB 5F3RA 4A8TA 1AUOA 3PS9A 3BDIA 1VYHA 3U80A 2E87A 5CT5A 2WT9A 4HNSA 3SO4A 1GKUB 2H0AA 5EXEA 2SCUA 3T5MA 3AF3A 2DPYA 2BGTA 3Q5DA 3M83A 3DDWA 4PIVA 4DLUA 1UKVY 5HMLA 3HEMA 5D5PA 4PCAA 4YJ2F 3U4QA 3PD7A 3G5LA 1RSZA 3HMQA 4K46A 3MTQA 3CVWA 1I30A 4M9RA 7GPBA 5CH3A 4A5OA 5LJIA 2IPNA 2EYUA 4UTZA 1Y7IA 2E49A 2IV2X 1P91A 1T1JA 4HQ6A 5IJAA 5CNJA 2O14A 3EC1A 2IH5A 3G6WA 1JIXA 3M6MD 2ATEA 3O4GA 5CIWA 2J5RA 3Q9SA 2BR3A 1OC2A 1SCBA 2JJYA 1IBLC 3H5VA 3K0CA 2PMDA 4GSYA 4OHUA 1J4AA 3LAWA 4YP9A 2OZLA 1YE5A 1NWHA 2AHRA 1DKLA 4HKTA 2C94A 2DLNA 3WLQA 1K08A 1EWVA 3CC8A 1XYYA 4TZ6A 1C0EA 3DKPA 3L49A 3WMRA 1BKYA 4B3HA 2PUVA 4WBSA 4CV0A 3AHEA 4HAYA 4BWVA 1CIJA 2BSAA 1BE1A 1XWIA 3BXPA 2WUWE 4OLBA 1Y1TA 4QQKA 4CM9A 4ZIRB 4C08A 3EVTA 4FYYA 3ZE8A 2HFJA 1UEIA 1X86B 2FPGA 2W37A 3A4MA 4MQ6A 2CHUA 5UKDA 5FNVF 2NVUB 4ZV7A 3SHVA 3U6KA 1G3RA 2OCYC 5GONB 4BKMA 1LF0A 2EDAA 3AM5A 3OE7D 4AF7A 1LTQA 1DUVG 3E9YA 1VL5A 2D7VA 5A62A 2O8BA 1JR3E 1KMNA 4MB2A 4K8OA 4C2AA 2Y6VA 3G8CA 3DCYA 1ZM2A 2ZRDA 3HBFA 1XOIA 2GJ9A 3GCWA 2OYCA 4E94A 2OV2A 4E4YA 3GVXA 1VXRA 5CVJA 2IUUA 1O4WA 4GRAA 1PQPA 4DLNA 4O08A 5F52A 2A9VA 2ZSDA 3LY7A 4B3XA 1GGHA 3IQIX 1DRKA 1ORVA 5D5HA 5EJGA 1OAOA 2WP0A 4KXMA 3KXIA 5AK3A 5JO9A 5L3RA 2CDBA 4AXBA 1KI9A 4RPLA 1QIGA 4B3SB 3TPCA 3DL2A 4CLOB 3BRCA 2WIAA 3N74A 5JZBA 2J30A 4A27A 1M5RA 3F3MA 1N78A 3QV1A 4XVUA 5CX4A 5EP3A 5JPCA 1LI5A 2NZVG 2WE8A 1W5FA 3I5MA 2RGGA 4N48A 1NZFA 2Q2QA 1PJTA 3EUAA 5F33A 3L04A 2AX3A 2X8JA 3AH8A 5NLLA 4J4HA 1JQLB 3P97A 3S99A 1E4EA 2IODA 4NNJA 4X24A 4FGJA 1QORA 1JHOA 1VJDA 3B7WA 4MV4A 5IXSA 1ORIA 1Z28A 1FBNA 1Q0SA 2OM6A 3NETA 4D7AA 4DW8A 3STVA 3VO2A 2Z3WA 5ITSA 1AQNA 3GDHA 2H0QA 2WLTA 4DCPA 2ATCA 2E21A 4I4LA 4MRSA 1N32B 4WESB 1Q5PA 4KN8A 4OP2A 4EATA 4R1TA 5GPBA 1QGUA 2NPIA 2ZSIA 4YMLA 1JWLA 3MD0A 5HUHA 4K0KB 1E2GA 1FYWA 2JGEA 3QEMB 1GUAA 3F5DA 4MKRA 1WX1A 3OJXA 5ALNA 1M2WA 1H0HA 4AKSA 3FVQA 3F49S 5EHNA 5FR2A 4DCGA 1JLLB 1T5DX 1IG0A 1XZ8A 3MCUA 1BD3A 3BTSA 2KYRA 1ZK4A 2JIRA 3AGQA 5EJEA 3ULKA 5I3CA 4DV7B 2JG3A 4Y6LA 3AR3A 2I9PA 3ESCA 2AW3A 1LLQA 1ZN8A 2J33A 3DVLA 3G0GA 4RFSA 3DGEC 4S2EA 1NLYA 3DDSA 3IHLA 1Z2NX 3OZRA 1Y5RA 4M1KA 3ACDA 1KVRA 4N5MA 5CK5A 4O4HF 2AL7A 3K20A 1JG3A 3TLGA 1T4DA 1TH5A 1P6QA 3TINA 4C3ZA 1CZOA 3AHGA 4JELA 4OK5A 4EHDA 2RGAA 2NYRA 4OHCA 4KHPB 2KJQA 1BYUA 1KBOA 2XODA 2HOQA 2Z58A 4RSHA 3CQ1A 3RFTA 5CDFA 5BV8A 1EVLA 2ESRA 2WQ7A 1E98A 3VYTB 1D0SA 2CCJA 3IE0A 3W7AA 1VE5A 2Q21A 2XCQA 1BKSB 3UGTA 3G8BA 1P1HA 3NBAA 4JDPA 5AVRA 1YTUA 1JF8A 1Z8HA 2AOWA 2ZS8A 4D44A 1GZ4A 3F5QA 4X6XA 2AOVA 2QX4A 1A9OA 5ED0A 4FJ1A 3VHLB 3W2GA 4C7MA 3D8TA 1UP4A 1NIPA 5LXTA 4MVWA 4OYRA 1D8AA 2Q62A 3K5WA 4GI5A 5BSWA 3T4XA 3I2JA 1LPNA 4AAYA 1L4YA 4GP7A 4UC0A 5BN3A 4PYIA 1OH5A 1OFUA 2HIMA 4UNPA 2AVNA 3VSEA 4AIRA 4MTLA 3RG8A 2Q4DA 3ZDEA 1CVLA 2J5QA 4B87A 2C2ZA 5BW6B 3JAMA 3WG9A 2FCRA 1KFEB 2QRVB 4L3OA 1GZUA 3MTBA 3NM6B 1Z5WA 3LUDA 2PSHA 4YAJA 1EQAA 4N5NA 4FYIA 3DL7A 4M0DA 5E2AA 5JQWA 5BMVB 1Z06A 2CE2X 5AXAA 3FNEA 1EUQA 1QH8A 2PL1A 2J9RA 1CJVC 1M73E 4WE3A 2NUTA 2NT4A 5EESA 3EGWA 1HF3A 3KK0A 4E2FA 3LUSA 3OFNA 3WNCA 3Q3VA 3QVLA 3QJGA 3OE1A 2XW6A 4NPHA 2G6TA 4G1MB 2UZ0A 4G1CA 1NFFA 1H8HD 3I1FA 5AKJA 1DJQA 2OE2A 4TL7A 1I4LD 1A8HA 2JGJA 1IN1A 2H57A 2PHZA 2YH2A 2Z9DA 3QM1A 5DP2A 4BKUA 3M4JA 5AW2A 1KQGA 3EWSA 4LDAA 1RI4A 1SHZA 4F96A 2J0UB 2LKCA 3T06B 5KIAA 3OQNA 2VJMA 3ABSB 4KTTA 3O1LA 5L7WA 2UVDA 4A10A 4DLRA 5JCZA 4BQSA 2FLWA 4U6NA 3FOEC 2W6ZA 1S5PA 3R44A 4JGIA 3TDNA 3D3NA 2W2LD 4G0WA 5ALTA 5KAPA 1YULA 4E12A 4FFNA 5D8DA 1I01A 1YR9A 1B16A 3GRYA 5JD6A 3QQPA 2HPAA 3WGMA 4BEJA 1S7CA 2AHOA 4RABA 1TO6A 2OAEA 1USUA 3P9IA 4LQCA 4AU1A 2BFDB 4RFVA 1QIFA 1JQDA 1VDMA 1GPWB 3E9QA 4FHDA 1F1JA 2ECPA 4O2AF 1Y9EA 1ECGA 3CX8A 4JB0A 2CY1A 4HPVA 2RHWA 3ILXA 4G0PA 4EEXA 5IAOA 4CM5A 2XA2A 5F76A 4Z7NB 2PFGA 3OEED 2FEAA 3LVQE 5F9MA 2IYXA 3I01M 3NDPA 3RJMA 1FU8A 1PHRA 2DTDA 2P75A 1SVKA 2GNPA 3UAOA 2CNBA 4FFLA 3DV0B 4GD3Q 4B8ZA 5KTRA 1U0LA 2HPHA 2VNAA 4RACA 4G4SP 4KITB 3HA5A 1NN5A 4J0JA 2UVPA 4P4UA 2XWPA 2ZAIA 2ZUDA 3H86A 1WB5A 3W6ZA 1GLVA 1GPJA 2OM2A 2B1QA 4X93A 4WY8A 1UFOA 4FOTA 2X5XA 4Q7MB 2OCDA 1TLLA 5TS3A 2OZPA 1XGKA 1DAOA 3SLGA 3DDNA 2AD5A 4MW2A 1FNDA 1A1SA 3C5CA 3QXGA 4B40A 1I2MA 2W71A 3R3WA 2WHXA 3JSXA 3KUDA 3V42A 3RABA 1FPQA 2GO7A 5CG1A 3QU9A 4XLTA 4NU5A 3IQDB 2QNIA 4NRDA 3PNOA 1VHTA 3AFHA 4UW9A 4JEIA 5TGZA 1XCOA 3FWKA 1CDDA 1U1DA 2J45A 3KVOA 4X64C 1D3AA 2JNWA 4O4JA 5HDQA 4EX7A 3KYIB 2HH9A 4AZWA 3O4VA 2WWVD 3HB7A 4HUJA 5LNK1 2HQOA 3DBVO 3I5UA 2VEDA 3A37A 4FMPA 7ABPA 1F60A 2XF2A 3IEXA 4QBIA 3NTUA 1P0IA 1M1ZA 5AM0A 1T3TA 5HF6A 2FFHA 3DFFA 3DDUA 1AMNA 1RKVA 1T0HB 3CPSA 4LNUB 3DT6A 4C04A 3PUJA 3ILHA 1CZNA 2FGJA 2PSJA 1T8SA 1A96A 2WC1A 1E89A 3ESDA 3CQ9A 1TKCA 4AS3A 3BCUA 2YYAA 4PSKA 3GJYA 2P9YA 4YLEA 4YI5A 3KP1A 1O97C 4BGDA 5DCYA 4H6PA 4ZXFA 4W5TA 4BFSA 1O4VA 3E82A 4ZYLA 4PRZA 3A58B 2FRDA 3PQDA 1AKYA 2JFYA 4P5DA 1IULA 3GMTA 1S2OA 2CL6X 3TX6A 4A3SA 5JI2E 1XRPA 2OFWA 4GOMD 3ZOKA 2FPPB 2QKYA 1NMEA 3RYIB 3K0BA 3H2SA 1ZK3A 2EG5A 2AEJA 2OTCA 3NHLA 4OYYA 2QQ5A 2VH5R 3JSAA 3VDQA 4ZO4A 4BP1A 4J0CA 2Z6UA 4O4HB 1HG0A 1CB7A 1SM4A 4QYMA 1H3NA 1VDZA 1NUTA 4R2IA 5KNCD 2A67A 4WDQA 4UQOA 4IINA 3PV0A 1NYTA 4YAEA 2I3DA 4MAFA 4DADA 1PI3A 2DBRA 2IITA 3TSCA 9ABPA 1GYPA 2NZXA 4NQZA 2ZSAA 1NBEA 3G7NA 2RG7A 2TMGA 5JAOA 1Q2UA 1XN4A 4HNAB 1HL3A 1XLWA 3PUHA 5HNKA 2WTUA 4ZI7F 1VTKA 1O95D 1VB5A 3CZ5A 4EKDA 3VRHA 3LBFA 3I3OA 1JHDA 3FBTA 4ENTA 3M6AA 2ETVA 3D9QX 1BGWA 4B4VA 4OH1A 1NBWB 2WU4A 2D2IA 4RNDB 1DBSA 3RADC 1U98A 3PUKA 4KIUA 4ZVMA 4I9UA 1E59A 1FMLA 2WRZA 5D87A 5IS2A 2HR1A 3UBTA 1Z5VA 4UAUA 4M8KA 1QTRA 3NC0C 3CF2A 3EXEB 3JATA 1XZGA 3ETNA 1P5ZB 2RGCA 4LF5C 1YQQA 3GGDA 3GLUA 3HR8A 4PBTA 4X20B 1UBOS 4OVKA 3AXTA 4EY3A 1L2TA 1KZ1A 3AILA 1RM3A 3IAS6 5E8JA 4YMGA 2WT8A 1ZIPA 1DIAA 3D7KA 2VOEA 2HSWA 3TVDA 1ZJWA 1N2JA 2I2AA 4QXQA 5H4GA 1RLIA 3DZCA 4QNRA 3JRXA 3DPSA 4ZO8A 2J5BA 2LRHA 4Z9XA 3UZ0A 2IDMA 3O4JA 1X1EA 2O4CA 2A9OA 2G1JA 3FNBA 4JI6C 4DUGD 5CB4F 1FFGA 3LMKA 1D2AA 3JQAD 1JILA 1X8JA 3LQQA 5TB5A 3REQB 2NVBA 3TLMA 2GEFA 1XN1A 3X1DA 4B43A 3GVIA 2ERXA 2EU8A 2O8BB 4FD3A 2Q9CA 1Z34A 5F4BA 2ZVQX 4L28A 3AONB 5K3EA 1GU0A 4A2WA 2Y4NA 2PLWA 5BSMA 1N0UA 5F73A 3HZOA 2JZCA 1FSZA 3CUTA 4TYPA 4B8WA 1NLZA 2YUTA 1SBIA 4R2LA 4GI7A 4Z3DA 4HEHA 4JLAA 5HZHA 3L18A 2P2ZA 5EE3A 1IMJA 4CMJA 2XXAB 4FW9A 3KYDB 2CFOA 4B4OA 3R23A 2ZJBA 5JCOC 2ZSEA 4BJ6A 1FNCA 4TL9A 4UEWA 4NVRA 3VVBA 4EGCB 4N5IX 5CDTA 3U7QB 2FZ4A 3KLMX 4ZP1A 3UJ8A 2BGIA 1Q57A 1RPZA 3QKSB 1Z6ZA 1BWQA 2P0EA 4FGKA 3OM9A 4XRGA 1EWRA 5IHPA 1R66A 1PD1A 1YQDA 1SUBA 3LT2A 3QE0A 4ZAFA 1EDOA 3I2IA 3FR8A 4ICIA 1I7DA 4NCBA 5IG2A 1QWSA 4DV4C 1YFZA 2ZR9A 4HYTA 3MWLA 1W1UA 2P2SA 2O5RA 4JQCA 4P86A 3W3AD 4CEIB 5EPEA 4H3HB 4HH3C 3SSOA 1AD2A 5JJCA 4NAHA 2A33A 3QLUA 1I2DA 4RYLA 2NU6B 2QTFA 3V1TC 1A88A 3ZPXA 1OV4A 2EJWA 4EG1A 2QLBA 3VH1A 4W5QA 4TWBA 4N0DA 4XIJA 1L5OA 4TLEA 3JQCA 2FPLA 4UHBA 4MUXA 4IHJA 3MTIA 3OTQA 4IDQA 1W6UA 4BB6A 3KR9A 3PC7A 3NPMA 1G8PA 1YFKA 1X8KA 2B4KA 3GUYA 4JA2A 4YNBA 1JSXA 2WSMA 4MRVA 2H1RA 5T4FA 1S8OA 3CBQA 1W2HA 1ESCA 3MK31 3NV9A 2RHTA 2DHCA 1N7JA 4G0OA 3UCFA 5A02A 4TV9B 2WHRA 5LWHA 1H0RA 3T94A 4ER5A 4TQGA 2XAAA 1W88A 4UMFA 1IY1A 4YV0A 3K0AA 1M6VA 2G9ZA 4G5FA 2LIVA 2XI4A 3U9SA 2FEOA 1WM1A 2NUPA 2UUCB 4DGQA 4Q9NA 3AR4A 4IOJA 1FDSA 2MM9A 5IBRA 1U6KA 5TQ0A 3RYCB 3ZI7A 2J8ZA 2ZITA 1KI1A 3HQ4O 1OHHD 4N0PA 1JU9A 1IL0A 1YBMA 2VF5X 5LBIA 2Q3MA 4V02A 4ABYA 4MWBA 3VVCA 1LVHA 3WS7A 1A9XA 1MU0A 1OX5A 4YROA 5K2OA 1YE3A 3V6MA 4H7IA 1NOKA 2Q3DA 4GQAA 3PFFA 3JQDA 2XSZD 3N58A 1FX0A 1L4HA 1NX6A 4R5MA 3QFRA 5DLYA 4QUEA 4BAGA 4KMRA 3ZI0A 1T9KA 2YTZA 2XKKA 5KQGA 4XVRA 4N6NA 1OFGA 4FN5A 1EVEA 5ER9A 1O6ZA 5DE3A 3X1YA 4ZDKA 2ZM5A 3OZVA 3VV3A 1CF2O