2HK6A

Crystal structure of b. subtilis ferrochelatase with iron bound at the active site
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
309
structure length
309
Chain Sequence
SRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
publication title Amino Acid Residues His183 and Glu264 in Bacillus subtilis Ferrochelatase Direct and Facilitate the Insertion of Metal Ion into Protoporphyrin IX
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
total genus 119
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2006-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hk6A01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hk6A02
2QD4A 2AC4A 3M4ZA 4F4DA 2DJ5A 4KLAA 1L8XA 4MK4A 2XVZA 2QD1A 3HCRA 2JH3A 3HCOA 2Q3JA 1C1HA 2XVXA 2QD5A 2HREA 2Q2OA 1C9EA 2XVYA 4KLRA 1TJNA 2AC2A 3GOQA 3LYHA 4KMMA 1LBQA 2QD2A 2QD3A 1DOZA 2PO5A 3W1WA 2XWQA 4KLCA 2PO7A 2HRCA 2H1VA 1N0IA 2XWPA 3HCNA 2XWSA 2C8JA 1LD3A 1HRKA 2H1WA 3AQIA 2PNJA 2HK6A 1QGOA 4CCSA 2Q2NA 1AK1A 3HCPA
chains in the Genus database with same CATH superfamily
2HF7A 1N25A 1OV4A 4F2WA 1CLEA 1D4ZA 2O2SA 2FZLA 1N5IA 3Q7IA 4I4IA 2ODPA 1JJIA 1UAAA 4MRSA 1VCMA 4JYCA 1PIWA 1CR1A 2NXJA 4FQ8A 4ACAA 1DPFA 2FN9A 4GKJB 3OTQA 2VYVD 3I2HA 2FA9A 1I3MA 2SKDA 5DVZA 5TEVA 4BN4A 3L0SA 4TV8B 1ZQ9A 5IASA 4FEGA 4ZMRA 2H3HA 2LR0A 3CFYA 3K6KA 1XE3A 2CXXA 2HUNA 4G1VA 1U2DC 4CR6A 2WSSA 3EXHB 3NZEA 4FBLA 1F7UA 5MGBA 4QGFA 2N42A 2WDZA 4CQMB 5I01A 3JALB 3WBFA 3AFIA 3E9RA 4L5AA 5DISB 4A8JA 1SB8A 1K0FA 3RODA 3V7YA 3FZYA 2W0SA 4WMLA 3GLIA 3L4KA 1WNFA 4V2IA 3R8XA 4W5QA 2H48A 2OWDA 2R6CA 2JIDA 3UC9A 1Z5NA 3C5CA 1C9EA 3O4IA 4IDQA 4JHXA 5MN6A 4J9UE 1NOJA 3KFLA 3THXB 2OT3B 4O4LF 4FWTA 2CDRA 1EK1A 2JI4A 1R0BA 5AR1A 1BDBA 1AKQA 3ZU2A 2V98A 2FSPA 2QLMA 4BEVA 5JDIC 3KKLA 3CA8A 4UCWA 3TKLA 3W05A 2OO5A 1M1NA 1Y33E 2HK8A 3KHSA 4TKZA 2GDZA 1QKIA 3I23A 2BGGA 1EDEA 3HU5A 3K70C 2RGDA 1NJ2A 1QG0A 5FOWA 1KJQA 1OI7A 3QUCA 4UHBA 4D57A 2ZBEA 2G77B 4REMA 4ZN6A 4X60A 1BGXT 4TMYA 1UM9B 3CN7A 4A16A 1UMKA 1M74A 1E6CA 2BHRA 2IPXA 2P2YA 3TPZA 3BG5A 3OM1A 1CJSA 2C4UA 2B1QA 2JCYA 1TF5A 2G25A 1RCTE 3VKVA 3V80A 5JZBA 1U9JA 1YCGA 2VZ0A 3NWOA 4NRDA 4Q4CA 3V1KA 4BO6A 4Q34A 1R8JA 1XTQA 1GSAA 3CG0A 3RHZA 1JG3A 4DSUA 3NIGB 3EC1A 4GKKB 3BZUA 3SGLA 1UL1X 5KQGA 1MIOA 1VG9B 4A91A 3G0DA 2A7XA 2HA0A 3FYDA 3ORSA 3SF0A 3K0CC 3G5AA 1BDHA 1M6YA 3OSZA 3E5NA 1NWHA 2FSFA 3ABSB 3TQFA 1AMOA 3U09A 2YQ5A 5EKTA 1LRKA 3RRMA 1VIMA 3I76A 4F5WA 2Y05A 1VHQA 3ZDYB 2CVHA 2VPXA 5BSKA 3TQOA 3OQPA 2D2EA 2JKVA 1RSZA 4ZEWA 3V2UA 5F1OA 1AGYA 1G9TA 1ADFA 3DWGA 3GVCA 4R8KA 1BROA 2ZP1A 1GAQA 4J0EA 1EJ2A 2P11A 4GLOA 2JJ1D 1CJMA 3K09C 4BGUA 4P84A 2QL7A 1Y4DE 5IZCC 2B3DA 2F59A 2VHEA 2NYAA 2IKQA 2PZMA 4POAA 2C31A 1PR4A 3RGGA 4X64B 3P9IA 2FRVA 1KS9A 2XY4A 3PNQA 5F2NA 1K8YB 5L3QA 5KU1A 4WV3A 1DBSA 2GEBA 2BW0A 4CDMA 3KWFA 5JBQA 1CK4A 4IVNA 1KYWA 4PLPA 3C3MA 5BN5B 1E7WA 3NT4A 2HV9A 2NXEA 3NVAA 3E4DA 3E7PA 3KXIA 1V1JA 1QCYA 4I9HA 1L4HA 4LBZA 4EQZA 1L5MA 4FYXA 1CVRA 1TXGA 3ND8A 4IFTA 1VYHA 2F3PA 3VR4H 2OP1A 1NUQA 3BQNB 3PVCA 2IVZA 3ICCA 2NSDA 4UARA 1F3OA 2ARKA 1SCAA 4LYHA 3CUKA 3ND9A 4YRLA 4RD1A 3QK7A 5K05A 2XRYA 4H3KB 4RF5A 1C1DA 1PGOA 3SSAA 1A97A 4HRVA 1HNXB 2X0EA 4EX6A 5L6MB 4RELA 1F0PA 1LWOA 4CM1A 4CQLB 4OF4A 5LB2A 3JQPA 2NX2A 3JQGA 1VE7A 5JJCA 3R5TA 4JQCA 3ZJVA 4INPA 4EHNA 4QTXA 3EMBA 3F0TA 3USZA 2C1XA 4IVQA 5H83A 4IQ4A 3HSKA 3ZCRA 3O3NB 4XYLA 1M8JA 2WAOA 4CG2A 4YT5A 1AH2A 2IOHA 5CP8A 4MVJG 1KVQA 4NAHA 3SJCA 7ABPA 2P9QA 3I30X 1QFJA 1OMOA 4FOLA 2GD2A 4UDNA 4CF5A 3A6DA 3L7BA 3C85A 1N1EA 1YCFA 4HP8A 1ZDMA 2NTEA 4RJIA 1YO6A 1W47A 3ILVA 4US2R 3L7LA 1JFVA 2K7FA 2WWHA 4TZ0A 1YJ5A 2PZJA 1V3UA 2QRNA 3A36A 5TPZA 3ADOA 2WVHA 3M6VA 3HV0A 2ATVA 4UD6A 4PPNA 4R9UC 3ZXYA 2YNMC 4ND1A 1NAIA 1QYCA 2BJWA 2YXDA 4MUYA 3N3AC 5EEHA 2CLEB 3THSA 5HQ3A 2WIAA 1QLJA 3IOEA 3ZHOA 2ECQA 1JBEA 5EGNA 3D1LA 1H1TA 2FOIA 1N2IA 1T8WA 2PS9A 1PG0A 2ONZA 2SKCA 3CUEF 3E2MA 4C04A 5FWYA 1TA9A 1YKSA 3FNHA 5I9MA 3WJ7A 4NU0A 3DV0A 4QGGA 4GI7A 4RKFA 4JQYA 1BOOA 1SQ5A 4TLAA 3ZDAA 3DLCA 4MA5A 4CEJA 2HQRA 2VJQA 2UYHA 1EVIA 3MVEA 1BHQ1 2XA2A 4KKVA 4D3SA 4YQFA 2G67A 5B6JA 3SBOA 1AM4D 1PDOA 1XEXB 3ITKA 1WPRA 2H59A 1VA5A 5FO1A 5K0BA 3ACCA 1SUEA 2C8JA 2GKGA 2J7KA 3KZXA 1Q92A 5L7YA 1L7EA 4YMSA 4GHWA 4L85A 3EGDB 4GMXA 1E99A 3OESA 4ZODA 3ER8A 1RWXA 2NZXA 1JAYA 3VRHA 1RBYA 4RCYA 1DEXA 4LJKA 3HJRA 3I9V1 1LQTA 4WFQA 2ZRBA 4NH4A 5KYTA 4RWZA 3NFYA 2O54A 1Z17A 4QQKA 2GBCA 4WFJA 1IEVA 4XR9A 3H83A 4LZLA 1OX4A 4X7MA 2DPYA 4BO1A 2ZVJA 1T8TA 3IBCA 4W99A 1Q7EA 3S70A 1FVFA 1X80A 2QD3A 1Z6PA 4ALIA 1QU3A 4QBHA 4R16A 2W6MA 2CF5A 1I7NA 1T0JB 2EFEB 3WHLA 1D6SA 5DGDA 2BMJA 1YZHA 4HWGA 5KI6A 4CKBA 4PN3A 3BN3A 1R27A 2JBWA 2VDWA 3AQIA 1NX9A 4GX0A 3G0BA 5IG2A 2BD0A 3HR8A 2QL9A 1PLLA 3CKYA 2EU8A 1QH0A 4II3A 1I3NA 3CW8X 4PSAA 1YI0A 2WKSA 3BXPA 2WKQA 2AE1A 1E2KA 1XMXA 3KXPA 3MXOA 2G5TA 4FQ7A 5EY5B 3RK1A 3TTTA 4C5BA 2PMEA 4DR4B 5KNDH 2B4QA 5LFAA 1G3RA 4IL5A 3RTEA 2FP3A 3IVAA 2C4WA 4MRAA 5HK9A 6REQB 3EWAA 3A9SA 4HRAA 5K99A 1XQVA 3M3PA 4F8JA 5JY6A 1M66A 4KFUA 1UKAA 2VPPA 5FHRA 4H16A 5DHRA 4WCDA 2C7GA 1AKUA 4RD3A 3P19A 5LMUB 1EJ6A 2CMFA 5IYZF 1OZHA 4HAXA 4ONEA 4PZUA 3JZMA 4RE5A 4Z4EA 3O2JA 3D59A 1DU4A 5CT9A 3F9CA 1F8XA 2VDPB 2WWWA 3O8QA 4ZCQA 4HSGA 3TQHA 3RVBA 1N3IA 3DP7A 2QKYA 3IELA 4OAQA 5HRAA 4UZFA 2YDXA 2AD5A 3H5NA 3KQSA 2C88A 1D5WA 1YSCA 2AK2A 1JLLB 3NI2A 2QMHA 4H27A 5G3YA 2F1OA 2FWMX 3R3ZA 4FKZA 3QPDA 1WP4A 2HMUA 3IS3A 3IEXA 1VL6A 2E4VA 2YW2A 4P4SA 3LDAA 4N54A 4N0MA 2PUJA 3M3DA 1I7SB 4ZJUA 5KDOA 4KFSA 1JKFA 1IN5A 2XDQB 1H0KA 3C3JA 2JLVA 2PJUA 4D81A 3F6PA 2JLXA 3V3TA 5E8RA 3RASA 1AV6A 1Z5WA 2XE7A 2O4CA 3QOWA 3RKSA 5AVUA 2DE0X 3OFSA 1R4AA 4JASB 5LQRA 3QEBZ 1U1GA 1JHRA 2X0DA 3CRZA 4CM7A 1IDN1 3O4JA 5F7JA 3WYDA 4E4TA 4GYKA 3BMOA 2ZZMA 5CDGA 2W7TA 4J7XA 2IV2X 5JS8A 1C7IA 3ZCSA 4QDXA 1ACMA 5AKEA 5KJ1A 5LQCA 5ALOA 5IVHA 3DD5A 3QOFA 4R8MA 3ZK9A 3SVTA 3M70A 2C8KA 4D41A 5A6SA 4NDZA 2TSYB 3OURA 4HUQA 3TR6A 7REQA 3PEVA 2XCTB 3EMDA 1Y3DE 1N6NA 1DX6A 4MV5A 5DGHA 1CUVA 4UM9B 2W6ZA 5C8ZA 1RPNA 1LY1A 1SD1A 4M87A 3VKFA 1GTL1 4HJRA 5LDHA 1UADA 2HBRA 4QRIA 5B2FA 1FUKA 2IYNA 3MINB 4J3JA 4MULA 4FOPA 5J1TB 4JWKA 4WBXC 3TX6A 2HPZA 2MDTA 2NYUA 2GWHA 2PIDA 5JNVA 2IEBA 3L18A 3RFXA 4DA8A 4LEIA 4LDRA 3QEAZ 3R9XA 1DL5A 4Y9SA 1HDXA 2WPDA 3KV1A 3P96A 3S2YA 1P9RA 1SKYB 5DFAA 4QHTA 4TXNA 1CZRA 2CCGA 3WQHA 5BW4A 2GEUA 4DQDA 4FFBA 4Y2XA 2CLFB 5HZMA 4ETMA 4C7MA 5DE3A 2ATCA 4N0QA 3MB8A 1NYLA 1X7GA 2OCAA 3CVJA 4EIWA 1Y1TA 1CE8A 1GN8A 2AI2A 3SM3A 5JEDA 3M7IA 4RZUA 5LNK1 1ZCFA 1JMVA 2RHTA 2B9EA 3PUZA 1NBWB 1U31A 1RP1A 2IEZA 5B4UA 2O2CA 3PGJA 2OD2A 2C3OA 5EMMA 4YP1A 1R6XA 4P8RA 3OU2A 4COKA 2QK4A 1RWVA 1T25A 4LWOA 3NIFB 1XMPA 1SQSA 3OETA 1I0LA 2YUTA 4M99A 4QLOA 4CIVA 5HSGA 1VGQA 3L1HA 3TINA 1NLYA 5FYDA 1KEKA 4OJYA 5AI6A 2R68A 3R3XA 5DBEX 3NKFA 3MMSA 5EHGA 5G4KB 4CMGA 2A58A 4M8KA 3QU4A 3CYFA 2MT9A 1YJ8A 3MA0A 2WP0A 3AVPA 3JARA 2GYUA 3RK0A 4EKIA 1JU9A 1LQUA 1KPGA 2ZB3A 1O77A 3KQNA 3IDOA 3TQTA 5L9AA 3R09A 1AN9A 1UPCA 2EL7A 3CGGA 3HS3A 3VPCA 3R2JA 5KYKA 4YRGA 5JNWA 3E5HA 2Z2XA 4HH3C 5KPDA 1BSVA 1RQ7A 3PQ2A 1Z2CA 1DRWA 2ZIEA 3DKKA 1PJQA 4LHWA 1X3LA 2A9VA 4C22A 4QXQA 5LOVF 1W88B 1WMAA 1VJCA 3S2ZA 4A36A 1ZD1A 1Q0UA 1G8JA 2CF6A 3ZE8A 5FBZA 5GPBA 1JBQA 4BVEA 1F8GA 4N18A 5EA2A 1GEEA 1RYZA 1G5FA 3IAXA 4N6OA 3IKVA 1LPMA 1L5HB 1T3HA 3RS9A 4HGNA 5BSMA 4JLUA 3MG9A 1C3XA 2G83A 2H51A 4HQFA 4EG4A 1X2BA 4WKCA 4EY4A 5KYYA 3ZWKA 8LDHA 4HC4A 1FDIA 5KNCD 4M1TA 3V33A 2KI5A 4W7IA 5AIAA 3HB9A 2JIZA 1M6HA 1J97A 5H1YA 2R8BA 4HX5A 1M3SA 2Y1DA 1RQPA 4RA9A 3NR2A 4ZAFA 2NZ2A 4MV6A 4KR9A 3EZ7A 4YJFA 1XEFA 2DSTA 1IQRA 2I71A 2K7ZA 2XDAA 5SY4A 3GJ7A 2FK8A 3ENNA 2AN5A 1UM8A 4BKOA 4NAVA 4HDNB 4ZA2A 2QW1A 4FUTA 4FYPA 4NDNE 3LPDA 5ERGB 1UJ6A 5CFRA 1JHYA 3C6QA 3NPMA 3DOHA 4FP9A 4ZCSA 3JVUA 16PKA 1CD5A 4ZVLA 1RC1A 1HE4A 1T8UA 4REQA 5JDCC 4MW0A 3H84A 3W5CA 1Q2UA 2YBDA 3RV4A 2CT8A 3NGXA 4NYMR 4DYDA 1B6TA 4JI3B 5BWCA 2ZYRA 3E3OA 5GY7A 1SPXA 3EVCA 1ZQ1A 2NXWA 4LGCA 4NS1A 1FFCA 4IMRA 4DMHA 1S0UA 1E3WB 1N6IA 2PX0A 1E1DA 2AV6A 3GOQA 3R6LA 1SJ9A 1Z39A 3TAXA 3SSMA 4QU0A 1BXGA 4MQFB 2OGTA 4F9EA 2JHAA 1LPAB 3WYEA 5I7FA 1YFLA 4YPFA 1UANA 2FKNA 1R8SA 1R0ZA 3L01A 4G1UC 5ELLA 3DHNA 1VRCA 1EFPA 4OHPA 5KHLB 4S1TA 4NJMA 1FRNA 4R0NA 2QW0X 2UYOA 5DZSA 4GSLA 4JUCA 3K32A 5BUSA 1YL7A 3N8NA 1TA0A 3P2KA 3NVMB 4N3NA 3KOWA 3VHRA 1W36C 1QFXA 1P4JA 1CF2O 1SRRA 1THMA 3KPUA 4W5WA 1LCIA 5J2UB 1PW5A 3CCBA 1NBHA 3AETB 4DUGA 4EABA 4WQMA 3B8EA 4INZA 4OK5A 3WWEA 3F3MA 3Q85A 1Z13A 4RACA 1QO7A 4EMSA 1KEUA 2C2BA 2D1RA 2PKYX 3GRVA 3E48A 3K1AA 4TLLB 2QXUA 1VC2A 2JH9A 1DELA 4E88A 1M6VB 2DPLA 1UC9A 3N86A 13PKA 2HQ1A 1JBKA 3LWDA 3TLXA 2E4YA 4FFPA 5CW2A 4BIIA 4NCAA 5F64A 4NBUA 4KR6A 5LIPA 3I53A 3QHPA 1V35A 4WDRA 5JXIA 1XPJA 2NU9A 4MQEB 4F6CA 1KI6B 4JIMA 1W5SA 1C4WA 3RC3A 5HQ3B 5BQOA 3SI7A 1MFPA 1AUQA 4XQCA 5IVIA 4BZXA 5KNBA 2QSJA 1OFTA 3GJYA 3LY9A 4ER3A 4Q3BA 4FZ5A 4XUEA 2JLCA 1O96A 3B8HA 2R8PA 3TG2A 3BQMB 1QYRA 1LW6E 3ESRA 4A10A 1D9ZA 3VTKA 4RZHA 4JODA 3OQNA 1QG6A 2X7JA 4FHEA 3U7IA 2OHIA 3WA6A 4AICA 5ADHA 1RQRA 3V4FA 4R83A 1ZW6A 3P9KA 3RYCA 2BFFB 1U1DA 2J41A 2IEIA 3LHFA 3RIXA 2FEXA 5JBIA 1PJSA 3ZV7A 5CBKA 3VSAA 1W2HA 1EHIA 1E0AA 2CZGA 1MC4A 3UUGA 1ZM9A 1AZWA 3Q5GA 4GBJA 4WUVA 1IG3A 3EVNA 3FI9A 3WIOA 2JD0A 4LQDA 4LDZA 1OXKB 5DBIA 2AS0A 5AVQA 1K4YA 4GQBA 5ER6A 3K9FC 1OHHD 1RW4A 5CB6A 5DKFA 4HI0E 5C37A 3QEMB 2P69A 4G5FA 3R40A 4H7FA 1N7JA 1V5EA 1R9MA 3KFXA 5ALIA 2WWRA 3TMAA 3ZQKA 3LRXA 4DPKA 4GKAA 3KKMA 3SR3A 3FNGA 4DLNA 4BX8A 1EXWA 3CF4G 1JG6A 1T91A 4PIMA 1M2OB 3X1YA 1FRZA 1BW9A 1QLWA 1RYEA 3GFFA 4K81B 3IAHA 2LUOA 2VTVA 4RTJA 5F2KA 1VCNA 1YA4A 2PBFA 1QUFA 3IDQA 3ILYA 4X8MA 1XDGA 3CX4A 5CLHA 3SZRA 1MEEA 3W8DA 2ZB2A 3SEQA 3C43A 4B83A 2FKAA 3UKOA 4ZPXA 2G8LA 4QYSA 1JVSA 1ZJYA 1J8MF 1DQZA 4K9DA 4MWGA 1KO1A 3DMHA 3EPJA 5IXYA 2F3QA 3PITA 3HFSA 4BC0A 2RE8A 3M1AA 4WJKB 1P1JA 4JI2B 3DBHB 4HBGA 4RVFA 3S5JA 1DIBA 1G6Q1 2AHOA 4C0HA 2BC9A 1V3QE 2PTHA 4GE0A 4WBNB 1FVXA 3FY4A 3VR2A 5BR7A 1V5FA 2WZDA 3BRWA 3KLMX 3COVA 4NFYA 1RWKA 4QIHA 2G1JA 1MB3A 4E3ZA 3RUEA 1RQXA 3ZGLA 3ICEA 1DAOA 1NUHA 3WK8A 3TRJA 4QNMA 5JMTA 3PLRA 1POXA 4RFSB 3ZV4A 1USUA 2AN3A 3DVAB 4QDKA 1ONSA 4OXQA 1BJTA 5H3CA 3EIWA 1KMCA 1HT3A 1K98A 3V00A 1LSOA 3SICE 2PDAA 1IHUA 4KO3S 4BE7B 1A8UA 2W71A 1TMOA 2VPWA 3H5AA 3P2IA 2MCFA 2D7JA 3T06B 4XB1A 3RS5A 2WOOA 4BKQA 1JJAA 2E37A 3LT1A 2F00A 2NYVA 2D1FA 3VSCA 2GPTA 1NXVA 4DLZA 3FVVA 1CP2A 1YZUA 4D9MA 3AKZA 1DCTA 3TECE 1PK8A 1CYEA 3CXUA 4LDAA 4P32A 4BYMA 4KH0A 5JS1A 2ERYA 1RTKA 2IL1A 3KFVA 1F0KA 3W2HA 1P45A 5GJCA 6CHYA 5KX5F 2JFUA 3A6ZA 2IHNA 2B4KA 2OM2A 2OYCA 4PWYA 4PCVA 3WKBA 4DCOA 2PJZA 4IDNA 4PHTA 2OBXA 1E0KA 1PJZA 3ZYCA 4YAIA 3PQ3A 3O2NA 4ICIA 1LFAA 3IUBA 1SIWA 3M5WA 2V9CA 1YC5A 3GQVA 1WXIA 1Q22A 3BE8A 3GVIA 4HZUA 3SIXA 1GKYA 3JWPA 4FKMA 3T7SA 1P7YA 3G89A 4TKMA 4YMUA 4IIYA 3TFQA 4ZHQB 4BWFB 5A5VA 2RARA 1BH2A 1DRVA 1KU0A 1E20A 2MTBA 3MQ2A 3D8SA 4S1VA 3U9TA 5I7OA 3VH3A 3ORRA 5BQ3A 1QR2A 1X13A 3R24A 3RGWS 2GNPA 1BEUB 1XZ8A 4B3RB 3JARB 4AO8A 1ZVJA 5LQMA 3NORA 4MPPA 3GGPA 5DXFA 2ZCUA 4LWQA 2X3FA 2W2VA 3F5QA 4BJ3A 1DDOA 4JKOA 4ZHQF 4RD2A 2O5CA 4YCBA 3ZTYA 2ATXA 2ZCJA 2Q9UA 4F93B 4Q47A 1L7BA 3ZE0B 1UPTA 2WFLB 1DUSA 1NONA 1UOOA 3I28A 4JUDX 4YRDA 2PQ0A 3WHKA 1QKKA 3OG9A 3UPDA 2GXSA 3T1NA 1DBQA 1HDCA 2CJYA 4DT1B 3T9BA 3F6RA 1RZVA 3NVKI 1K4MA 3BCUA 3D8NA 2V6BA 5AKZA 3KAJA 1CU1A 2O8EB 1AIPA 1X86B 2CL6X 4TTTS 5WRFA 3QSYA 3HO1A 3D3KA 1QHHB 1H2RS 3KP1A 3PUXA 1SMKA 3REQA 1NNI1 4BFCA 4BNYA 3FFXA 4OP3A 3PIDA 3LCCA 4MYHA 1WXQA 2E6KA 2C4VA 2RMKA 4DL9A 3WDLA 5ICSA 1HR0B 4E22A 3VOTA 5KVQA 1XPRA 1M2NA 2B35A 2XMPA 4NL4H 1EFCA 4OJMX 1L7OA 4ZCTA 2PKEA 4BUZA 1C8VB 1BX3A 1CSEE 1F9EA 3JW8A 3QKRB 5EUQB 2F7SA 1FFBA 1EUYA 1YIAA 3NYWA 1GG5A 4HMQA 3OTIA 3LPCA 4LNUA 4RXMA 4X3PA 4XA8A 3WMWA 1YE8A 1SC9A 3HGQA 1T3TA 4FFNA 4YN3A 5FO0A 4XD7A 2VDKB 4RL4A 1JR3E 4FI3C 5GONB 3DM5A 1J8VA 4QLAA 1QIFA 2XB4A 3DL7A 1S2IA 2CWWA 3H4TA 5EE9A 3KWMA 5T6MA 3F8SA 4D8XA 2H4FA 1W29A 3LD9A 2PUBA 1KQ3A 1SA0B 4GZ6A 3PNMA 4HNGA 4L3VA 2NYRA 3OCZA 3QLUC 5F5NA 2VHCA 1CC1S 1JIVA 1SAYA 4HRXA 5B58C 2WAMA 3OE7D 1YTLA 4IZ6A 4RM2A 4C4ZA 2D0PB 3IURA 1FP4A 1YRHA 2AMLA 1NQAO 2WD7B 4UVHA 5GONF 3AVXA 3G6WA 2HBYA 3GNQA 3TIVA 1AA6A 3TGPA 5ALWA 2C0PA 3NWJA 3AR2A 3VHXA 1XPUA 2BN4A 3RW9A 1XK7A 3FXAA 4ITVA 4XX1A 3VVLA 2DHCA 3ZVNA 4U0JA 4IIJB 1DBWA 1EIZA 1MB2A 2QX8A 3M6UA 3OU7A 3MS2A 5ALDA 4JL5A 2V9PA 2X5NA 4FX5A 3HY6A 4DA7A 4XPZA 1OSNA 5IMBA 3GU3A 3HKBB 4DRXA 3RIHA 2X1LA 2BI7A 2FW6A 3QBTA 4BMPB 5JAHA 4INOA 2B83A 1ZSNA 2FUKA 1RFGE 4RE6A 2EG9A 1EEHA 5LYJA 4C4SA 2QVGA 1DRJA 2PLNA 2WJGA 4KBFA 1DKPA 3U26A 3UXHA 4DE5A 2BFAA 4D46A 3W6NA 4UEOA 3OPVA 2PFGA 2PLWA 4IFIA 3CZAA 1C3VA 2SECE 4JX9A 2GBFA 4NYJQ 4YR7A 1KGSA 2AVDA 1ZHHA 5BW8A 5LQDA 3GPIA 2A5LA 4LPSA 4UCQA 3WLIA 1RXYA 2O6HA 1QS0B 1SU7A 2FUCA 1B6SA 2AUMA 2A86A 2J5KA 2PNFA 3OFVA 1SBQA 3QTTA 1E2UA 5D00A 4AC9A 3SYLA 5EJ5A 5CX1B 1K88A 1NVDA 1EFKA 3MTJA 4WDQA 2H31A 3JASA 2DAPA 4G56A 1Q0RA 4ND2A 3BRWD 3SZGA 3IAAA 4BV2A 1E63A 5KQLA 3U7GA 4X1IA 1SKAA 1MOSA 5DTMA 2X7HA 4MWZA 2GPYA 2VN8A 4UEWA 5HOQA 1JG7A 3UK0A 1PN3A 3DDWA 3B3GA 5EVJA 3D6AA 3Q2KA 2PG3A 4W9NC 5D6OA 2QL5A 2WTAA 3ZH9B 3JWGA 1FLDA 4RGVA 3AEUA 1IK6A 4KO2S 2XZLA 2N0SA 3CU5A 3GCZA 4MUXA 4EO9A 2A1UA 1CT9A 3UKDA 1Z38A 1RYDA 2V7TA 4G81A 1G8MA 2I4TA 3KT3A 1XA3A 4U39A 5BT8A 1P62B 4UHHA 1KMMA 2OQRA 2N1BA 1WO8A 1Q44A 2NXNA 1C9KA 4P58A 4EFMA 4BEWA 2UUBB 4NQZA 3DGFC 4RWEA 4YX9A 2FX2A 5BNFA 4WNAB 5AXCA 2HA4A 2A59A 1E66A 2BDTA 2OFWA 3PEUA 3Q9NA 4JXXA 3FHJA 2YYAA 2TYSB 3GEHA 3ABZA 3LNTA 5FPPA 2EW2A 1JN0A 1G42A 1NRXA 4JWTA 1I9GA 1UDRA 2JS7A 1F12A 3P71T 5C31A 3LDUA 1HDGO 4L1KA 5KSPA 2F3SA 4KYUA 3UUFA 1ZUWA 1LFDB 1ZAYA 1KMNA 4W8HA 1GL9B 3G0IA 4FX2A 3UC5A 4EI2A 5K03A 4XASA 2AUNA 5FPQA 1RRPA 2V45A 3GLFB 2Q6LA 3JWEA 3GN1A 1JVBA 3OQOA 4QTZA 4AY5A 2CHQA 2P6OA 2W58A 2G07A 1FDSA 4M0CA 2CYCA 2HBZA 3CZ9A 3I9OA 2H5LA 1SKYE 3QWFA 1RJ9B 3R4VA 4AG6A 4ZICA 5C52B 1HO3A 4ZCPA 3C1UA 2OQVA 4E03A 1E94E 2BGWA 1SVWA 2D0OB 1SQ6A 1DAHA 2AOWA 3L7NA 5ALLA 3H3JA 2J4FA 5DWVA 4CKXA 5B3JC 5IKOA 2IODA 4G5XA 3ZIUA 3ANLA 3SBXA 2WV9A 4LHVA 2Q3MA 4QBGB 1V5IA 1GKUB 5DDIP 1XQ6A 2OUKA 1QGAA 3V1YA 4BQNA 1CUXA 4EI9A 1ITZA 2J31A 2J3JA 2W8ZA 2Q6OA 4I6EA 2V7PA 3RIMA 3QQ5A 1PU2A 1ID8A 3ZDZB 3L8DA 5KJCA 3PLAE 1AGNA 1YC2A 3UCEA 3GLKA 3IVMA 3T1QA 4C06A 2CHEA 5IN5A 2J5BA 4YEDA 2ODTX 1CRLA 1KK3A 3R6WA 5CAEA 1DAPA 3EK2A 3HWWA 3WGMA 5IT9A 2XNCA 3O03A 3P0HA 1VMDA 4LY9A 1Y63A 3V42A 4EG3A 3EBOA 4MLCA 5FP0A 1QF6A 2ZIGA 1M2OA 2YHBA 3T3PB 4RF2A 5FTNA 1U0FA 2FR8C 4KL8S 3KEMA 1Z4NA 4LI3X 1E3JA 5AJZA 4FDTA 4G5QA 3CBGA 4EM6A 2A1TR 2X23A 2ZJ0A 1QCZA 5JQGA 1ZU4A 3ETDA 1U2SA 2BKXA 3QJ5A 1CIVA 2L18A 3GG2A 1FTSA 4G24A 4KWTA 2GARA 3P0RA 4JBIA 1NF2A 5HQTA 1SUIA 2WJPA 3AK4A 4OHBA 3TZLA 5AICA 2YJZA 4DNQA 2R6R1 1OD6A 4ESOA 1TTHA 4FMBB 3NBXX 1OLSB 5TGDA 1Y8RB 4LTDA 1OXUA 4C0LA 5HBGA 4PPFA 3QMMA 1PDVA 5IT0A 2C3YA 1DARA 2V55B 1LK0A 1GRQA 1Z29A 1P1IA 2HHLA 3A6FA 1NBME 1Y6RA 1UPFA 3C5WP 4YMGA 5BQFA 5JADA 4PO1A 2R85A 3IERA 5C7IO 5IXJA 3JATB 4GC5A 1N8KA 2JAPA 2EZ4A 2QUBA 1MC1A 3GHYA 2A1IA 4HX2A 4KQ6A 1A76A 1JAXA 1NBIA 2JFBA 4HTFB 4JBXA 4LZZA 4TS3A 1D09A 1A4XA 1QFSA 3RC1A 1JKXA 1M2FA 1VE3A 3ZKAA 1NASA 3KDSE 1Q12A 1UOQA 1NW6A 1BE6A 1OKKD 5FQNA 3V4SA 1JI0A 4BP3A 4LZOA 3K09A 4ZI7B 2XTZA 1R74A 3IUSA 4MQLA 3ELYA 3DMTA 4X85A 3HWSA 4MS1B 2IOFK 1EIWA 3S2IA 4MMZB 4O0MA 1RWBA 5A3QA 2FFRA 1Z33A 4BFSA 1DJQA 2DHEA 2X4GA 1DP4A 1Z6GA 3VOAA 3OCWA 1L7DA 3RUDA 1SVLA 4Q4DA 1KMQA 3OF2A 5J4YA 2NPOA 1W87A 3K7EA 1YQWA 2WKPA 3G17A 1Q20A 2YVUA 1SGWA 2Y1GA 1MA0A 3F6BX 4R3NA 4X91A 1Q1ZA 1WOYA 5BYJA 4BX9A 4ASUA 4JFRA 3KETA 4U9IS 5B3LA 3I9FA 1DWPA 3F3KA 1YFJA 3K9NA 3BJMA 4YP6A 3UGTA 4AP5A 1PR1A 3M1IA 5J5CA 5FA8A 2PMCA 2QV7A 1W0KD 2Z43A 5DWQA 2LDBA 4DLKA 1YZKA 2GM3A 4LK3A 2B7BA 1D6NA 2I6SA 1V11A 1L5KA 4KQGA 3WWPA 1YZ3A 2JNWA 4GPTA 1SU6A 2O23A 3GA0A 1PNQA 1RYHA 3SHOA 4J90A 1BWQA 2QN9A 4NY1A 4QDZA 3BFPA 4Y0NA 3WB1A 4M0UA 2F8TA 2DFKB 1EZ1A 3NT2A 3I0MA 1C3LA 1PL8A 2DUMA 5KYXA 2N1MA 5EWLA 2N75A 1ZA1A 4CV1A 5BSFA 5H59A 1AZSC 1U0RA 3G2KA 4I81A 4RW0A 3V2HA 4R6WA 3VDQA 1PF7E 3NOXA 4JOSA 4CG0A 4K6FA 3TRDA 1U7WA 2C2MA 5HRCA 2OESA 3DZCA 1PT9A 3HCFA 1E6UA 1Y37A 3PXAA 3QKSA 3FRIA 3G59A 1IJFA 1AKTA 2RAVA 2YNMD 1R5BA 1V8BA 4G84A 1XTZA 2EF0A 4Q4JA 1U4SA 5EWMB 2HO5A 5HGJA 4W5TA 4HR7A 1V96A 4Y2PA 2I80A 3DXFA 5EIEA 5JS7A 2EBWA 3C3DA 4UDXX 3IMKA 1JPJA 4FGZA 1CUCA 1QVRA 1CCWA 4OHYA 1ND5A 1D4FA 4CNQA 4ALNA 3PNSA 2BTOA 3NAZA 1P91A 2CUNA 2XKJE 2OD7A 1EHCA 1QVAA 3E27A 1E58A 1N0HA 4LYFA 3PSAA 4OQQA 5HW0A 2W6IA 4CM4B 3BGWA 1R4MA 4MW5A 5IARA 2Z5FA 3E9MA 5AFSA 1Q0ZA 7GPBA 4UTNA 3V9AA 1UT6A 3PZBA 2P3SA 3I64A 4IEFB 5CFMA 1H69A 1PCXA 1YR7A 3HI6A 2P9GA 5GOTA 2YXNA 1YASA 3PXXA 1AF4A 1NE7A 3NC1C 5JD3A 3W2EA 4RTMA 4C30A 4J2OA 5HCUA 4XDHA 4KYVA 2RH4A 5HQJA 5G0VA 2EKPA 3NDPA 1NFQA 5K0LA 1XZIA 5KWIA 1I94B 1K7XB 4AQ7A 2RHOA 3KOMA 1AKYA 1KO8A 2HHCA 2QW8A 4Z9XA 1JJ7A 1UBSB 1IONA 5DBHX 3B9RA 1UBJS 4ZO9A 3KBOA 2A9OA 3ZCVA 3EPHA 3RRNA 1PO7A 1JFRA 4WZBB 3MWDA 3PEWA 1V6AA 4I55B 1UBOS 2J3MA 4KRGA 4LJ7A 3C3BA 4PF1A 4RHEA 4QBTA 1BCSA 2C84A 3ITNA 2FUNB 4NK4A 2YZ2A 1SELA 2QN1A 3DXXA 4KW7A 3LIIA 2B94A 4J7UA 4X63A 3SYTA 4GEGA 1CY2A 1GIAA 1LVGA 1ULZA 3NHWA 4Z6KA 2VDMB 3PA8A 4BP8A 1J0CA 1FSSA 4OXXA 3W8RA 4KR2A 3AFMA 2IBMA 2AEJA 3U61B 3FB1A 1R66A 1Q17A 1WSDA 3AF2A 3QLJA 4RJKA 1T0PA 1R2QA 1W96A 1T4MA 1NTOA 2XA1A 3CLHA 3GAAA 3HC7A 3N74A 1P1CA 2P9BA 4IXWA 2IYUA 2PU7A 3N5CA 1VL1A 5FI3A 2O06A 3NUQA 4O1HA 4EGFA 2YH2A 1E9BA 1BU8A 3JD2A 3EGCA 3P26A 2COUA 3VHQA 1EWKA 3P4XA 1BE8A 1SCKA 4YMHA 4TKVA 5CPBA 2J9XB 4BN5A 2FV8A 3C48A 5L7WA 1VHTA 4EP1A 1P2DA 4KQEA 3N7UA 2Q8QA 5KSWB 1FUYB 4DFDA 4W9RA 3HCBA 2X7XA 3E8SA 2BY4A 2D7CA 2Q46A 2ZWMA 3QXXA 1DDGA 4QJ5A 5H3LA 3WP0A 1P0IA 3KLOA 1NU8A 2H16A 1ORIA 2IU3A 3CTMA 1NC1A 4I3GA 1M1ZA 2P0EA 1RJFA 1Z6TA 1FC0A 2I8AA 3BJZA 5D51S 1GKIA 1TZJA 1VCIA 3WOVA 2YRFA 1W2WB 1B3RA 3SJZA 4EH1A 1B15A 3BAZA 1I3KA 4FW8A 4JLJA 3TE7A 4LOIA 3PUYA 4XE5A 1IRIA 1UXGA 1C3OB 1T9GS 1NI4A 1KARA 1Y8CA 3DTYA 1EFHA 1FU8A 3SNHA 4CEHB 3K0HA 3CUSA 1GGVA 3JAWB 1O08A 1Y1RA 5EIAA 1WOMA 1AUXA 1ZVQA 3PC3A 4LRSB 5A2GA 5HXAA 2BEVB 2YFKA 1AKNA 3ZTWA 3DEHA 2GT1A 3ESYA 3QGMA 2P65A 3B6KA 3L3BA 2NU7A 4N0DA 1VLJA 4ER5A 3DOEA 2YJTD 4OY3A 4G36A 4UZEA 1NW8A 1RJWA 1RLJA 1H5UA 2SBTA 2RFLA 3EG9A 2C94A 2W48A 3KU1A 4C7OA 2QENA 2ZDHA 1QPBA 3HB0A 3H17A 4LF6B 2VP5A 3VU3A 4KPEC 1UF9A 4AJJA 4LFBB 4OB8A 1O6GA 1JHDA 1YDFA 1FYDA 2GTHA 4INJA 3I5AA 4U7PB 4F3YA 4LZAA 1EGMB 4EAQA 4MEAA 2AA3A 2A5DA 4MI3A 5FBWB 4D79A 4MX8A 5DSTA 4BLVA 2YOFA 5JVDF 1U3UA 1LDEA 1SHKA 1E7RA 2P9TA 2RHBA 3OQ6A 1X7WB 4HNTA 1JYSA 3B1KA 3H75A 2MHCA 3KOOA 3RLFA 1BS2A 1KY2A 3BULA 521PA 1MXFA 4KWIA 5C3MA 4PICA 3RUHA 3HE3A 1E2BA 2PZKA 1BEZA 2WKRA 3QW2A 2QRGA 4BFYA 3E61A 2D74A 1O5TA 2W98A 4MWTA 3K0KA 4UFNA 3WIVA 2FEAA 1H8HD 1INLA 2LCIA 3IMFA 3JYLA 3OI7A 2X8JB 3WMFA 5B5SA 1Q84A 1JS1X 3C1OA 4UU1A 1EXVA 4DKJA 3U7HB 3KT8A 1JEDA 2PO7A 5GQSA 1MO4A 3T41A 4ER0A 3ERCA 1XAIA 5J58A 4DMGA 1QV6A 1R4MB 2EDAA 2PSHA 1P5JA 1NPDA 2UZAA 3IV6A 4FFSA 4QOSA 3HJCA 2QUHA 4QEKA 1H8HA 1M0SA 2RAPA 3EZYA 1ZSYA 3KVRA 3QP9A 1QU2A 1W34A 4DLXA 3P0IA 2AC4A 1WEHA 2IXAA 3HUTA 3RYIB 3DDNA 4Q9DA 1KQPA 2WSYB 3LU1A 1NVVR 3C39A 1X3SA 3T3MB 3R3YA 3MTQA 3GQBB 3PR2B 4QYWA 4CI0B 4TX1A 3FCYA 4H3VA 1Z34A 1F20A 3PFFA 2GAJA 2X42A 4Y18A 4XWWA 5C53B 1ZJ5A 3OOHA 4DCSA 2PM8A 5AW9A 5H8WA 2C59A 1ISGA 1NIJA 3OEHD 5KQMA 5EHXA 5FLEX 1J2TA 2GHQA 5HJEA 4OL9A 2YTZA 2HJVA 5KTMA 4NESA 5JJIA 1KFEB 3EUWA 2P90A 3TVYA 2CNLA 1UCFA 3NM6B 3ZDCA 1GTSA 1T43A 3H6HA 3P0FA 1EX1A 1E18A 1OAKA 1U94A 3DLAA 3SDSA 5BT9A 3PPWA 4M1YA 4Y9TA 5BO5A 5H5JA 1TEZA 1OIWA 2GEDA 3D64A 4LUCA 3OOWA 2AJBA 4ODIA 1CRWG 4FGKA 1LJUA 2RG1A 3OUTA 3ZXUB 3U4CA 4LSMA 1OI2A 3IPYA 2BKLA 5KVAA 1AURA 1YWGO 3RO7A 1E2LA 4FFDA 1CTQA 4NU8X 4BO4A 2OZLA 1WY7A 1R3DA 1XRQA 2B5WA 3KB8A 5EPOA 4E1BA 2AWNA 3VR1A 1UZUA 3GAZA 1P17A 3QKTA 1GGKA 5EE3A 5EXSA 1GGEA 3A25A 3QVKA 3SHWA 5KVSA 1R5JA 1YB2A 2ZRIA 3ADBA 3ZU6A 4I5GA 3W77A 1O8CA 3LLMA 1T2DA 1JG2A 2H2HA 3BGOS 3I6ZA 4NYIQ 2QN2A 1W4AA 1CNMA 2ZBPA 4RJ2A 4D8TA 2YZ7A 1IMOA 3IP5A 1V8ZA 3JZFA 2W00A 4R01A 3FDFA 1U02A 4DIUA 2II6A 1HX7A 4ARIA 2OXFA 4D8YA 4JU9A 3ZHUA 2QTAA 1U0LA 2V5UA 5BY2A 4L5IA 2PX5A 3K20A 4EATA 1MB9A 4C7VA 1E2GA 3RNOA 4BYGA 4HTFA 1BQ3A 4EA9A 2A94A 5J4HA 5G2OA 2NO5A 5J59A 1GU7A 3T9CA 4X6LA 1HDRA 3IUNA 3KR0A 3PGXA 3KZMA 4DY6A 4F8EA 1C8KA 1G8YA 4F2DA 4QHSA 2Y1EA 2ZROA 2Q5EA 1E98A 3DWFA 3ZHRA 3QI7A 3K2IA 3W9SA 3ABQB 4YJHB 2PVSA 2OHFA 4DMCA 3U13A 1UKZA 3PDJA 1NQWA 1HA3A 4MCJA 1CUDA 1B6RA 2BJVA 3L8MA 2PRYA 3J7AC 3LDGA 4MS4A 1TM7E 3RVOA 3SXPA 1YR9A 3VYWA 2QPLA 3LFUA 2QTRA 1K92A 3K1YA 1JTEA 4L0DA 4LKRA 3GVHA 4TSRA 1V16A 3AV0B 3JATA 5HE8A 3ZGYA 1Y5MA 1W73A 5EQJB 4B9AA 1KEWA 3VR6H 3KKZA 4O4JB 5CA0F 3OIGA 4ZJZA 3ZPXA 2W42A 2GWRA 1CP3A 3LT2A 1ODLA 2HT1A 1TPYA 2GZ1A 3CN9A 5E4YA 2R8RA 3HYSA 1Z2NX 2QYSA 4LBYA 4EBFA 2VI5A 3H1PA 1U6JA 3Q5DA 5JPDA 4K1LA 4B32A 3S1AB 3ZE7A 2VG8A 2YJNA 3DPUA 1C50A 5M5BA 1N3YA 1KETA 1EWTA 4P5PA 4CRWB 1OJLA 2IELA 2F9MA 2O8BA 1AB5A 4JUAA 3QENA 1ADCA 1R37A 2EJCA 2RI0A 2PL3A 5E38A 2P1ZA 1G9SA 1F06A 3CZPA 1HOTA 2J3DA 1IG0A 1NAHA 1E60A 2JK0A 4XGIA 6AT1A 3PC4A 1KTIA 4FHGA 3STTA 3F46A 5D5HA 4E4RA 3BE6A 2BMDA 1VKNA 4S2UA 3VR2D 1XDSA 2JLBA 2PXXA 3SZ3A 4CE6A 1IE3A 4W5HA 5FNVB 2HDWA 2ZYHA 1QPZA 3C3PA 1M1YB 5LUAA 4PZPA 5IJXA 3NETA 1XPOA 1H2ZA 2H17A 2O57A 3VNSA 3BD8A 1EX7A 2FZ5A 4CM5A 2ZUVA 1PR6A 4ON9A 4MR7B 4KNWA 3RWMB 3WMGA 3WLMA 3FPGA 4CCYA 3L1KA 4PGFA 5B1HA 3UV7A 3V4LA 4DEVA 2I4RA 1M1XB 2POCA 1FTGA 3K8OE 4IHJB 5JT1A 5TNXA 5HFNA 1E8MA 3FIUA 1OZFA 1DB3A 3BHNA 4M60A 4WN9B 3JVVA 2OZPA 3HGMA 5TQJA 2ROQA 2W6PA 4GX5A 4LY0A 5NLLA 3VC3A 3OD5A 3W4KA 4X9XA 4IGFA 1L3IA 1EP1B 1XZBA 1O6CA 4XWKA 3RAJA 5BQ5A 2YX1A 2P2GA 4Q48A 1YBFA 2BV3A 1F8UA 4O4IA 1PJCA 5HF8A 1U8XX 3A28A 4FNAA 5H70A 4B3IA 1CYDA 1Y6ZA 5FFFA 4NZYA 2Q0QA 2H00A 2Q3JA 2R86A 4P4GA 3SC6A 5LMZA 4KHZA 3I5YA 4W6ZA 2WMDA 4J75A 3NKLA 2C4KA 5IJ9B 1XU7A 1LI5A 9MHTA 2CE2X 1GPKA 3FYCA 1NYQA 3V46A 2ZYDA 4II2A 3TUIC 3HFGA 3GLGA 2A5GA 2W0MA 1V2HE 3KD3A 3H2YA 4N82A 3VU8A 5LMNB 2GJAA 2AIRA 2JK1A 2WD8A 3AKYA 3SHTA 1T0BA 4L08A 1NW9B 4BMYA 5COAA 1D9XA 1MOZA 1UXJA 3OKCA 2NUAA 3WZ2A 4E33A 1A1SA 5TMPA 1TT5B 1XB2A 3IOMA 4MVJF 4F60A 3NYRA 4HGYA 5C1PA 5AUQA 3MPUA 2CYBA 4XCXA 3M4JA 4GOLD 2WQZA 4JEHA 4CQMA 1RVDA 5CCXA 4RFLA 3VPXA 4PQEA 4XOIA 4DJ5X 1NN0A 4FOOA 2BELA 4MQEA 2X9QA 2I3AA 2FG5A 1SD5A 1CXZA 5LD2C 2BBTA 4HWSA 1XVVA 2C7RA 3VQTA 4ZOEA 5JZMA 3ZR4B 4B3MB 3LT0A 1ISPA 4NV1A 5CH8A 4Y2JA 1JQ5A 2ZE6A 1N77A 1UWCA 2WYWA 3HHPA 3V7FA 3WHPA 4UTVA 5AKKA 4DPMA 4IDCA 1IY9A 4JJ4A 3RT7A 2DFLA 2GZAA 3TEJA 3RC8A 1GTMA 1I2CA 1OX5A 2N46A 1RJDA 1R9GA 3AI1A 4RK4A 3DEYX 1IHPA 1T2AA 3L79A 1VSVA 4EY6A 1YJBA 4A2CA 2CLOB 3CX7A 4TZTA 5KX5B 3LOPA 4AZ0B 5IYZB 1VLVA 5CD1A 4H7JA 4C6RA 3S2EA 1KJJA 2QVLA 2HU8A 3QUSA 4KV9A 3IQGX 2WZBA 2ACWA 2LXNA 3VNUA 4MV3A 2D4AA 3IMGA 5FFNA 4OFZA 5A0VA 3PSHA 4IX9A 2E85A 4PZZA 3WBBA 4C43A 4CUJA 2J6HA 5C1DA 5JDCA 5LP6F 3K72B 4U7HA 2VNIA 4IGKA 2DTXA 3OSUA 3OT4A 4OOEA 4PQYA 3RRFA 5CVUA 2PKQP 3TVTA 4JMLA 3WFIA 1P2FA 4J2HA 4PYRA 3A3OA 2C82A 2JL1A 3JQ7A 4RVHA 3B3QA 4QFCA 4AN1A 1FYFA 4MOWA 3EZ6A 5M04A 3NU1A 1MN6A 3CW2A 1X42A 5DM0A 4JV5B 3DR5A 4J29A 2AKEA 4PBRA 2PXCA 3MQ4A 1ZNQO 4XRRA 3N76A 3O8LA 4TMTA 2GZDA 3DEIA 4PEVA 5G1OA 3WLTA 2VWGA 4EHKA 1NQOA 1KIFA 3PFIA 4I5FA 2ZZKA 1WW8A 2QOEA 1RFLA 3O82A 4QQ8A 5A9TA 3GJ0A 4GEKA 5CVCA 4I1YA 1Q57A 4DDHA 2Q9BA 5ECYA 1F7VA 4UUPA 1I3OA 4LY6A 4OXIA 1MJ5A 3S1SA 1YB1A 3E3NA 3UHOA 2J45A 1GWNA 3INNA 2X1VA 2ZG6A 3VO8A 4QLBA 4DBLE 1VDMA 5CHYA 5HE9A 4Y1GA 1CY8A 4MW9A 2EZ9A 3UMRA 3CUUA 2QLBA 3G9ZA 3TVDA 2OMKA 2ZS7A 3EQ9A 5DHAA 1N5LA 1SOMA 3OWOA 2X41A 3MMXA 4C4XA 2J07A 4IXNA 2NVBA 1Y5LA 3CRNA 4J16A 4L2IB 4GOND 1G98A 1YK0A 5FI5A 1A72A 4HLQB 4J0CA 5GJWC 3W06A 5BNWA 8ABPA 1X8LA 4HFMA 3V1LA 4PNPA 1WG8A 1SCNE 2WIGA 2JIQA 4BNJA 3EGOA 3IFSA 4UBIA 3PK0A 2WJVA 4I55A 3S1LA 3ENZA 3JD4A 2PIAA 5B7GA 4DIDA 2BM1A 4NATA 1P3DA 1YNSA 4R7TA 1NSYA 2JGEA 2AFVA 4O2BF 4DLAA 2RD2A 5K6TA 3HU1A 3ZIDA 2I6UA 4X3CA 5AT1A 3S7TA 3SJUA 2DHQA 3X1DA 4F1JA 1Y5IA 3EW7A 1ZHOA 5HUJA 4US0R 4Y7DA 1YT5A 5FJIA 3UWSA 2IHZA 4YA6A 2OPBA 1TU3A 1BTOA 1UM9A 1VG8A 3CNBA 3EQ8A 3DDCA 3AL0C 3QXCA 2ZI9A 3W8FA 4MP8A 3MS4A 5DNVA 4EDHA 2HNAA 1QIHA 1TJYA 2B2XA 3EQ2A 3VKHA 1IUNA 1V1RA 2DECA 1ZA2A 2H2DA 2GFIA 3EIEA 3PJGA 4DBVO 5GTDA 1P8AA 1UT5A 2W6ID 2WY2D 2PSSA 3DE3X 2IPMA 3B7WA 5DBOA 3J7TA 4B5KA 5DPMA 2XKKA 1KEEB 4WD3A 3A9VA 1V9CA 1WCIB 1MT0A 2AC7A 2QTWB 2D3TA 1I51A 4RV5A 2IYSA 4OSEA 3ZS8A 8ATCA 3A2NA 3OJOA 2P6RA 1ZD2P 1JDTA 3J81A 4IIHA 2O8NA 4GOOD 2D2FA 2YHIB 3UANA 5JRJA 4YRCA 1GQOA 2IY8A 4WSOA 1YTUA 2R66A 3FYTA 4M0MA 2BGUA 1A96A 3A9TA 4MYTA 4O25A 1PBTA 4B71A 4BO2A 4MQBA 4D99A 4K05A 1FS6A 2RIRA 1OXTA 2ACKA 3O8CA 1KAOA 2W6JD 3WGGA 5A3RA 2NP6A 3ZBQA 4L4SA 1E6LA 1IH8A 5FORA 4BUJA 4BPBA 5HA5A 2OAQ1 4RLQA 2H9IA 1F1JA 5CYFA 5FJJA 3OZBA 2AQIA 4KVZA 4UMFA 1VL8A 1XSEA 4IILA 4WH0A 2WD7A 3UMGA 3UOWA 4EY3A 2W2OA 3PYXA 5IK2A 4CDNA 1PX0A 4O33A 1YR3A 1GN9A 2NU6B 2OCLA 2ISQA 4CKWA 1NJFA 2WM9B 5IJ9A 1XJ5A 3B89A 1AV7A 3C8MA 4Y0AA 5ITZB 1E2NA 3DWIA 1RVV1 2XWSA 1XLWA 2NP7A 2XIJA 3GL9A 1FMFA 3GLHA 4Z1OA 2VQEB 2GESA 2PD4A 1A9XB 2V9ZA 4RVDA 2ZUTA 4DR7B 1QQ7A 1U3GA 1FJXA 3Q3IA 2OV8A 2PVPA 4LXQA 5JQWA 2Q28A 4JI5B 2IYOA 2QTHA 1WXFA 3H11B 1PW7A 5AQ1A 4IH1A 3DVAA 1YQTA 3LG2A 3RTBA 4YCSA 2A9KA 2QZPA 2H1HA 4G4JA 3ZWQA 3QE0A 4RETA 2G1UA 4PZ9A 1JH8A 1U0BB 1QAQA 1I8TA 1REQB 1Z6ZA 4NMWA 2AT1A 3I2GA 3WLHA 1K08A 1V25A 3CUYA 3BT7A 1AUPA 4WADA 3L07A 5L4NA 2NUPB 2PS0A 3TXAA 3FOEC 2IKSA 1FOEB 3ET5A 3HRKA 1EZ4A 2QUKA 4MNTA 3G8BA 5AVTA 4LJLA 4Z5XA 1N5KA 4KMOA 4HLUC 2IZ1A 1E92A 4DABA 4PRZA 5IM5A 5JD4A 3M4YA 3EGXB 2Q3BA 3SF8A 1NLZA 1NQXA 3ASUA 5K4AA 1I30A 2D8AA 2UYGA 1Q1GA 4QATA 3T7TA 3U6BA 3NX4A 4E5SA 2PUGA 4U6QA 3L6UA 3FLAA 2CLIB 3FMPB 4F5DA 4X66B 4P4TA 1IB0A 2P35A 1ZP6A 3NXSA 4W1QA 5AJWA 5AD1A 2P75A 2NO4A 1SXJA 1D2MA 2JFWA 2ZWVA 4JA2A 3C74A 3WDMA 2LP4Y 4WA7A 1TE2A 1KAMA 1KFJB 1U1IA 1ZD3A 1N0VC 3UH1A 3OCJA 4UBMA 4R05A 1FP6A 1LJ8A 1PFWA 3B6ZA 1YRAA 1KDZA 3GZTB 2JASA 4G5OA 1IEWA 4TPKA 4DYVA 3H9UA 2YZGA 4Q9HA 1DO0A 1U1CA 4OLBA 3ZKWA 1IL0A 5DB4A 3NOVA 1G9XA 4TLEA 2YY7A 3B6EA 2WB4A 3JQ9C 4BNNA 2H1RA 4UHJA 1ULSA 1GR1A 3JZIA 1WXGA 3AVYA 2C96A 4J76A 2WJ3A 1NF9A 1WVGA 1MC5A 1GZ3A 1XHLA 2FZCA 3WWYA 1J2RA 1TZ2A 1Z16A 3ZWCA 3DO5A 2OBYA 4XB6B 4ED9A 3VI3B 1KWKA 4CR7A 3IOBA 1RXWA 2JFZA 1OASA 3IEKA 2R2GA 2H18A 1XZLA 1XQ9A 1EB9A 2VPTA 4UQOA 1Q7TA 4ER6A 1LRLA 1SVNA 3QW4B 2BE7A 2PR7A 3TR5A 1U2RA 3UF0A 1IXZA 4CCWA 2DH5A 2FPKA 2OOKA 4CKCA 1OKKA 4GI5A 2OKGA 1B8PA 5CXQA 4RLSA 4D4LA 4V0MA 1SOWA 2QSYA 3IKTA 3SQWA 2NMVA 1ECLA 2IBSA 1QVWA 3GEDA 3KUXA 2YKGA 4V1CB 1KOGA 2IYPA 3GEBA 1FE8A 2GN9A 3HU3A 1W85A 1ZL0A 1JHXA 1NW7A 2O1SA 2P9YA 3PQEA 4NG4A 2WIBA 4NSNA 4P34A 2JLUA 3JVIA 3ETLA 4LHYA 4UMEA 3AM5A 3Q98A 2OV3A 4B6FA 2PCLA 4YB8A 1FBNA 2Z5VA 3QVOA 1SC1A 4ISBA 5LMCA 3QFHA 1JQAA 2ECFA 2I62A 4BNWA 2DH6A 1JDNA 3GPBA 3M6WA 1JXMA 2RGRA 4DLSA 2PGAA 1SFRA 4G0UA 1SKUA 4C4TA 2GUWA 5C9ZA 2XVXA 2QM8A 3FN4A 3VR5H 1FUIA 4P3OA 2X5JO 2R6DA 3WKEA 1V37A 3KZVA 4GPZA 4Z53A 5KAMA 3ZWXA 3FAZA 4JB3A 3H3XA 3MINA 3IE2A 3JQ7B 4V0KA 3VFDA 3F2IA 2A2ZA 1QPGA 4J7AA 5BVGA 2XCQA 1BS1A 3JWJA 4JENA 2ZTHA 1COWD 3UVEA 1VJRA 5D1NA 3ZY6A 1L7QA 5CITA 3MWEB 4IXTA 3WLRA 4DWWA 5BN4A 2OCIA 4HNVA 3AVVA 2K2QB 2D62A 3TJMA 1Z82A 1NULA 2PMBA 1GPJA 2XMCA 4H17A 7ADHA 5IABA 4WLFA 4DDMA 1VRWA 2NU6A 2XTJA 3BZWA 4YHBA 1PL0A 1VKOA 1QR6A 2WWGA 2YCBA 3D3EA 4DUPA 2C07A 4DA9A 3QZUA 1GP2A 3N75A 3FSGD 5EQDA 3Q12A 1WW3A 2GN1A 1DQNA 1FTQA 2I03A 2KLBA 4L51A 2AMFA 3V1TC 2AE2A 2XVYA 1PVVA 2OBLA 2QVZX 2YN2A 2HLPA 3ESCA 3PHJA 4J0GA 3DFFA 3WGNA 2QD2A 4PAGA 2VJKA 1L9KA 2QRLA 4ESEA 1Z7YA 4GXRA 3ELBA 3UMJA 4IZHA 1SVMA 4FKBA 3TZQA 4QM7A 2J6BA 2GAIA 1X1RA 5LKAA 1ZPDA 4PG8A 1CF4A 1Z4QA 3KTOA 4H4EA 3AMVA 4Z9BA 5JXWA 3FWKA 1H85A 4UBLA 1P72A 3B3AA 2JRCA 4KRXA 4RFVA 4ZYTA 1PFUA 2QZZA 2DFVA 4EX7A 2QN6A 2Z83A 3EXEB 2RONA 2G88A 3BTSA 4EI8A 5FUBA 5EHZA 1M33A 3KX2A 1JHUA 1SCQA 5BQPA 5I7AA 1EM8A 2ALJA 3GEMA 3U3XA 3RYFB 3ZXXA 3ACBA 1GZSA 1SR8A 5JLAA 1LNSA 5AUNB 1OWNA 1Z9BA 5KQSA 4R1PA 3W8EA 4I8XA 3ZWBA 3JPWA 3ORYA 2BHSA 4LYAA 2VDNB 3U1VA 3EUEA 1GL3A 4Y2HA 2QYHA 3JQGB 5KEIA 2YV4A 1X0XA 2D00A 3G68A 3B53X 2H2WA 4TLDA 1PT5A 1PYDA 3VPBA 1Z5OA 2HSGA 4AROA 5BWLA 4C0JA 4OQLA 2TMKA 1RHKA 2WSLA 3NM5A 2PHZA 3VDNB 5BR8B 5C2JB 5GJBA 1CPYA 2YQZA 2WDPA 5HNKA 4OBBA 5ITWA 3AC0A 4WFIA 4DV6B 3B1JA 1I2DA 4CUZA 2W2LA 3EOZA 2FEMA 2JHCA 1SG6A 4GYYA 3WKAA 3TXYA 2AF4C 3LPAA 3FTDA 5ESXA 3RC2A 1NWCA 1ZUNB 3R6TA 5ALNA 5SZIA 3VAYA 2PRIA 1A4RA 2I99A 3KAQA 1IM5A 1SBCA 4UNIA 3PHIA 4JYPA 3ENWA 2R8ZA 1NKVA 3T3GA 1Z7BA 5AK0A 2V7BA 3TM4A 4YIKA 3U3RA 1NLUA 4Q4AA 3V8QA 2PPLA 1FFSA 1AK2A 2Q4TA 5EMNA 4C0SA 4CWAA 3CR3C 1CZLA 4Z7QB 2CKDA 3BE5A 2H2AA 3VO1A 1YVRA 2OV2A 3O1HB 1L5NA 1K1EA 1SU8A 4LS3A 5A03A 3AFNA 4R4JA 1EFTA 3UJ8A 1F60A 2I6GA 2RGEA 2EQBA 4IF6A 4BV8A 1D5CA 3IT3A 5K20A 1XMIA 4BS9A 2XCUA 3ANSA 1TYAE 3PXCX 3HY4A 2V6MA 1M67A 1DHRA 1V43A 1XTSA 2O2ZA 4RVNA 5DMXA 3T7JA 4DHEA 3U7QB 2PE5A 2GF2A 2Q3CA 2PGXA 3DNPA 2CXHA 2CD9A 3KKQA 4IO1A 4WPGA 2O0JA 1X1CA 3HMKA 5CEFA 2BSXA 1ZO8A 1JI3A 3QYJA 2WVAA 3PJEA 4QKQA 4R5HA 4C2AA 2Z95A 1V7CA 4RNDB 3R9XB 1FU7A 2VDWB 1KI7A 3FLEA 4RIEA 3GMTA 3C3CA 2OXTA 2P9FA 3I5UA 1ZMRA 2VBIA 2ZFUA 3F1LA 4I4LA 2EHJA 4WE3A 4CKBB 2F8SA 3DCIA 3RT1A 5TPZD 3HUFA 3TRFA 1KRWA 2AOUB 1QM5A 2E4UA 3E0QA 5C8DA 5EGSA 2QYTA 2ZBDA 5A2QA 4OMUA 3QOYA 5HM6A 4FR5A 1VBMA 2PQ2A 3LTEA 2OY0A 5BV0A 2CL7X 1AS3A 2O0MA 2DVMA 3KAKA 5FEMA 2Y1XA 3RABA 5IF3A 2I91A 1SUCA 2AEMA 2R7LA 4MQMA 2ZS8A 2OORC 1B1CA 1KMIY 1YVPA 3QG5A 4HL6A 3OKFA 4I6GA 2OCDA 3O4GA 4PSDA 2I6XA 1OQAA 4P36A 1KVRA 1Y6JA 1GCUA 3I3OA 1XZFA 5FUYA 4J94A 3F5SA 4GRDA 3ZWNA 5M2QA 2FSIA 1R0WA 3EUFA 3LF2A 4F3KA 5KOJB 1U7ZA 1GNQA 3AVTA 1WCIA 5LZ5A 3GZ4A 4LRUA 5C5DA 4KACA 5CA0B 4DCGA 2PUFA 1R8YA 4ZT7A 2NWQA 2HQOA 1PX2A 4PC3A 1BE0A 1IWPB 4R8VA 3U9SA 1KOJA 3VPSA 1Q2XA 3VPGA 1E2JA 5DNWA 5EMKA 1G4AE 2HSEA 3I9KA 4B3JA 1XLTC 2X8WA 3U7RA 2FZ4A 1Q14A 2OBMA 2Z98A 3VZQA 5KMGA 2FDCA 3D0KA 3WYGA 1IBMB 1G66A 2YHSA 3DHWC 3QUQA 1S7GA 5G40A 1AKMA 3M2PA 5DM70 4FXPA 3WK5A 2QN8A 3VKUA 4FGJA 1EVLA 1KC1A 3SFTA 4KREA 1ICEA 4WVLA 1KOLA 1UKEA 2P8JA 3GUYA 4FN4A 4F1WA 2ZR0A 1T2CA 2QUZA 1ST3A 4CM8A 4OJKA 1Z47A 3LE8A 3RU2A 1E89A 2YN0A 4HQ0A 5JI3E 3L8CA 3O8QB 4FMDB 3NEJA 4KQXA 4C5CA 2J9RA 3IEIA 5LP1A 3ER9A 4UTXA 1ZMXA 2VK2A 3EDOA 4LRYA 2VRCD 4ROSA 5IUKC 4DZZA 1RMYA 3BDIA 1E6EA 4M88A 2WU0A 2WEKA 2QROA 1E5XA 4GVXA 1TC1A 3W9YA 1RE1A 1EE1A 2W2NA 4NIMA 4MV7A 4YMVA 2HL6A 5A7GA 5A7HA 2C54A 4KQFA 1X9IA 2QJOA 5IH7A 4AG3A 1TX4B 1CQIB 2C29D 4I9UA 2FQXA 5TMBA 4F1KA 5C81A 1XN1A 3FKSD 4TGLA 1YOVA 4MEJA 4MUIA 3NTQA 3ENVA 5D7NA 4MI1A 3R4CA 1HWYA 4NOKA 1M75A 2CBZA 4PAOA 4S3MA 4F5ZA 5J3JA 3R0VA 4IUBS 4TUYF 3BWCA 1IBCA 5C3UA 1DC4A 4IWNA 5BVGB 3RJ9A 1V5WA 2X2FA 3AEYA 1D0IA 1EINA 2B4RO 3CLSD 3FKSA 1G63A 1M54A 2VH2A 1TVMA 1RPAA 4NU6A 2ZI4A 1TZCA 4IWXA 2CWDA 4XWAA 5KOIA 3ZTTA 4QECA 5IBQA 4R7ZA 1YXMA 5G4LA 2P5TB 2YC4C 4UW9A 4WXPA 5DHSA 1VZ3A 3MSCA 2EP5A 3F49S 2E5WA 4NEGA 4TN5A 5ECGC 2FYTA 5ALFA 2DBZA 3SR4A 5LNK6 3A6LA 1TU4A 1OLUA 4Q93A 2QGZA 4CIXA 1KKUA 2NUPA 1BD3A 4PS1A 2C99A 5AVSA 1DC3A 2ZSAA 3B13B 1A2OA 3ZI7A 2VP2A 4FYIA 4PAQA 5LZ8A 3FLBA 4B3FX 3C7AA 2VSQA 4X71A 4ZJYA 1TMGE 2B2NA 1BDJA 1RADA 2IT1A 3BKXA 4HF7A 1Y98A 3SD7A 4PPYA 2V4UA 4B43A 1DIHA 3V8RA 2XXJA 4MV9A 3IR6A 4LQ4A 5CR9A 1L5GB 3C4VA 2E18A 1FYXA 5G3ZA 1DLJA 5LPNA 1XROA 4AB1A 1YZLA 1WB5A 4BDSA 2IOQA 2XDQA 2FPXA 4P83A 3WWCA 4QX6A 2MJLA 2PX3A 2KPOA 3OPYA 4FS3A 4A8PA 5B58T 2BFFA 2HFKA 3H2SA 3W5BA 3OJWA 5ILOA 3W4JA 1E4EB 1QFZA 2JA1A 4QGAA 4M0KA 2I2FA 3I6YA 1XZMA 4YCNA 1RI2A 4J7CA 1WPXA 3JWIA 4RO0A 5TGTA 5A5EA 1FW6A 3IL2A 1GGJA 4KMSA 1V6CA 3LGAA 3TLCA 3KKEA 1GU1A 1GZVA 1RLOA 5LQNA 4YGYA 4CGZA 1TK9A 4TYPA 3ETGA 1I5EA 3IJEB 2C97A 3MZ0A 2RGBA 3DB1A 1G3UA 1R6DA 1TUEA 1MQAA 1NVFA 1J07A 2DFDA 2ZWPA 4TL7A 3WZMA 2B8WA 1RCUA 2G5PA 1E9SA 5E1MA 3B1VA 1L4BA 4PLYA 3ZGZA 3OQIA 4IUYA 1C1YA 4CM9A 1K27A 2OQIA 3YASA 3UUEA 2FFBA 3KKNA 1PSZA 1FP1D 2RJ3A 2JZOA 2XEDA 1YCHA 2C2HA 2Q3LA 1QORA 1X8XA 4MWOA 2C9MA 3F71A 4W82A 1MX5A 2ZS9A 3EGWA 3ND7A 4U6NA 4BVLA 2QA5A 3WYNA 2JBAB 3GUVA 4NH0A 1TPZA 2RSLA 1A50B 1XKQA 4ZVMA 4FB4A 5HEKA 2YJ5A 3NYIA 3SXUA 1EB8A 4FBGA 3FZQA 4MVYA 1T1IA 1LGYA 1VLLA 1ZKMA 1BZYA 5KYUB 2FJPA 3OZUA 3VI4B 1DG1G 1UPXA 1DEOA 3DCJA 1OROA 4TMFA 5FLXA 5F5LA 4K03A 2PT7A 3C7CB 1EZZA 3JALA 1VE1A 4LOLA 2XYGA 5EOVA 1J49A 2ZT7A 3M6MD 1EGVB 3HCEA 4KV7A 1XRRA 2XX3A 1DKOA 4H18A 1ZCBA 1Z45A 1CE8B 1O94C 2JFNA 4KU4A 4AKSA 1DCFA 4X1KB 1VHLA 3UN1A 5ADWA 2HMTA 1VKZA 4OP2A 2P41A 1X7DA 1K6XA 5EE1A 2QUIA 5AK6A 2FWRA 1VIYA 3DVQX 3EZNA 3EIHA 1CR0A 1P9OA 2R4UA 4URYR 2GZMA 3FDIA 1QKJA 2WWVD 1COWA 1FFAA 3D6TB 3INTA 2ID7A 4GG1A 3GDHA 4DN6A 4YP9A 3L7JA 4X54A 3D3NA 3A3NA 5F7XA 1G8PA 2DCUA 2JCGA 3HB7A 4L7VA 1VB3A 1ZGZA 4KBYA 4TTVA 4MCAA 1F8FA 3W3AA 2B0CA 1NLMA 2FSUA 3KHUA 4Z9AA 4DANA 2PS3A 1V26A 2HA7A 1TRHA 1Y7IA 3BTUA 3K96A 4YRQA 4E2FA 1U7TA 1MX1A 4B1FA 2MYPA 2Q9AA 1I5OA 2C77A 3BMCA 3OIVA 2A0XA 3QELB 4LJ4A 5GMOA 1C0IA 1WMBA 2VXYA 4AYWA 2EYQA 4LBVA 2QMEA 3LUCA 1QBKC 5HIAA 2VRCA 1R00A 4RY8A 3IAEA 1JX6A 3WXBA 1AGPA 2YXLA 4GLBA 4QDTA 3LCVB 3VR0A 1GZ5A 3SC2B 3HKEB 3ND5A 4O08A 1JTFA 1QX3A 2ZYSA 3KUUA 2ON6A 1C1XB 2X6TA 2JGRA 4FCCA 4DXHA 4L73A 2NVOA 4WJLA 1Z0IA 1J6UA 2EW1A 4DEYA 2Q6TA 5KTRA 3BSFA 1NGSA 2QLJA 2WHRA 3EDYA 3MN1A 4PLGA 2ZM5A 1GCGA 5J2TA 4KLCA 2C0QA 3IUJA 4PLVA 1XCMA 2GAOA 5ALRA 2C5EA 4URUR 5E7IA 2NIPA 3PHHA 4IJ5A 3U0BA 1YU6A 5JSFA 1DC7A 1DMRA 3DEZA 3NTOA 2ID4A 3WB0A 4DCVA 4V0RA 4N47A 1ZRHA 2HZ7A 3RRXA 5F76A 4QUJA 1YRYE 1S2LA 2P4SA 4JLDA 3SX2A 3ZDFA 4E32A 2F3UA 1LPBB 2XOKA 3NJ8A 1U0EA 2P4UA 4M1KA 4XEHA 3WWDA 4EYSA 1CX9B 1Z5VA 2XVMA 2BSAA 5EYPA 2GPJA 4OUKX 5LU8A 2X0IA 2HCBA 3AVOA 1A9OA 4U4AA 1NUUA 1O95A 3AIMA 1E79D 4H1TA 3HL0A 5ABPA 4K6HA 3C5VA 1N7IA 1EM8B 1C9NA 4G1BA 2OV6A 1SU4A 1P0FA 4Y8VA 1SXJD 1A0OA 4JLPA 4BLTA 4BMVA 4UJ3A 3RQSA 1E2HA 5THQA 5JXJA 3PGLA 1L7VC 2R3SA 3G2IA 2Q6VA 2KW5A 3DQZA 1FJGB 1Y4ZA 2F9LA 2G28A 2RGUA 1GZ7A 2UZ1B 5EJFA 4NXNB 4IXMA 4A5OA 1ISMA 1T5TA 5DU2A 4I9GA 4PBTA 5BW5A 5K51A 1O89A 1X6VA 4JSYA 5LU9A 1GQ2A 4ZZ0A 3AFHA 1VHDA 1ZXLA 2VDLB 4Q21A 3WL5A 4F8YA 2G6TA 5HFJA 4PLCA 5T3YA 5P21A 1CUEA 1T1RA 4YMTA 2ZUEA 2DBQA 2WT9A 3LM8A 5CURA 3KBBA 2ZR9A 3EN0A 3TAUA 2VSYA 4EY7A 4QG3A 4UBKA 1NUSA 3INYA 4AY6A 2GCNA 1M5UA 1U5CA 1L4FA 4UVDA 3IQZA 4ZPJA 1GTJ1 2IP2A 4K28A 1ISIA 3DL0A 2B25A 3C3XA 4HDRB 2BR4A 3REFA 4BLQA 4I4NA 5CIYA 4P80A 3PUHA 1RYYA 2BEWA 4KO8A 1E1KA 4RQAA 3RYTC 3VYUB 3L6RA 3OO0A 1SC6A 1GCAA 3ZX4A 3KQTA 2PSDA 4IIUA 4IKEA 4QOIA 2QG9A 4RKQA 1HF3A 1Z68A 2K87A 3BWXA 3WGJA 4DWVA 4Z0HO 1HNZB 4MDFA 1E5TA 3K9HA 2WLTA 3M5DA 4A03A 2Z8YA 3A4YA 5JAPA 3V1MA 3Q4GA 1UBLS 2NZ8A 3LLUA 1X7XA 2BGTA 4KN6A 2PUHA 4QQNA 4D6PA 2G72A 5IKMA 3H1FA 1AZTA 8OHMA 2PZBA 3C6ZA 3FHCB 5C8YB 3VZDA 1N6RA 1N92A 1NXSA 2QWXA 1KXJA 4D9FA 3VO2A 5K0CA 3WRVA 3CPEA 3QKWA 1NATA 1L0BA 3NBKA 3RJZA 1TIPA 1T5LA 1NDQA 3K9GA 3EE6A 3GGJA 3ZVKA 2HDOA 1FSZA 1P39A 1EFLA 3P32A 4BZPA 1L4LA 4MH0R 4J1QA 3W34A 2OGSA 4P7GA 2VK1A 3B5JA 3GDOA 2UDPA 4B4UA 3CRVA 3ROFA 4QDUA 1G8KA 3FFAA 3PGMA 2IF2A 1I0IA 2RB4A 2XUDA 2O8DA 5FNVA 1EPUA 1J21A 4EENA 1L5LA 1IXKA 1KBZA 1S1CA 5AYVA 3PGKA 1UDCA 2AJLI 3R23A 4BNIA 4E1AA 5IZCA 1SKBA 2BPOA 4NNOA 3S1AA 4GE3A 4OBEA 3A9RA 2M1ZA 1BXRA 4AY4A 3ZQ4A 3Q88A 3TRKA 1ZUIA 1BHO1 4FWBA 4G4IA 4K88A 1DFIA 5CPFA 2NO1A 5GM2A 1W0KA 3UAGA 4D42A 2EJUA 1FTYA 1Q7RA 5CDYA 5KJFA 4CEJB 1KJWA 2OM6A 3LECA 1VL0A 4B8YA 4EW1A 4ZFNA 1JZTA 2WK1A 4KR0A 2R6JA 1POWA 1OZ0A 2QL6A 1CQZA 1V16B 2HC9A 1QS0A 2WJWA 4L9WA 4QXAA 3Q8XB 2J59A 2E82A 4NFLA 2BVNA 1VPTA 4RMIA 1MABA 4OH1A 4RSRA 1KE1A 3ZJUA 4BLUA 5AW7A 3MCUA 1TJ4A 3F6SA 3UQYS 1R8QA 1R3UA 4XUGB 1P4RA 2ZSKA 4R7GA 3A6EA 1KEEA 2ZYVX 4L8VA 4OAPA 3D5QA 2C78A 4HJXA 2OCPA 5KOJA 1W6RA 1GUAA 1HEUA 1HQKA 1LQ2A 3CEJA 5HHTA 2TRSB 3FYUC 3OD1A 2RH5A 3CWQA 5FWXA 3EFEA 4NBSA 3S2GA 3LFHA 4Q7LA 1L6IA 3PXUA 4WRRA 3RK4A 3WKDA 5A62A 3QJGA 3S6JA 2PZAA 3C6XA 4AJNA 1UKYA 3BXGA 1GQFA 4BASA 3L8ZA 1H0HA 2XWJI 3F74A 4BFZA 3QOXA 3DM9B 3OPNA 1H6BA 4XIGS 4YBZA 1OYOA 1M8KA 4P4LA 4A82A 4IV8A 2JJYA 2R1ZA 1TK2A 4L6IA 5JVDB 1C0LA 2VJLA 5M34A 3FSJX 8MHTA 2CLMB 5JMOA 1FFHA 3COYA 1PKXA 2G1KA 1RYFA 2EGHA 2QRMA 4XQEA 3OQJA 2IXFA 4JP1A 1N2OA 3BF7A 1I7QB 4RAOA 2NU8B 1SHZA 2XF8A 4U2FA 1N0WA 1NN1A 2PTGA 4QSHA 2QNRA 5DLYA 3TLEA 2FUG6 2I4MA 3RVMA 1QOZA 2B8TA 4E5DA 5TQ0B 3AUJB 3E3AA 1YF3A 1M7HA 1G55A 1Y42X 3AY3A 4KIFA 2F43A 4OGLA 3NAQA 5TMEA 1DJLA 1JW9B 1FFEA 1JLMA 1NMXA 3L04A 3QIAA 2FAXA 5B1YA 4RV4A 3C0KA 3DZHA 1PDWA 4MW6A 3NTUA 3HKDA 2B7CA 4FYYA 5FCDA 4I1PA 1JFTA 3IIIA 5AVXA 1AQLA 2WFMA 1EP9A 2JAOA 5J4KA 3HB1A 1A69A 3E8MA 2A30A 2J5RA 5REQA 1TZKA 1QOPB 3B9QA 3Q0EA 1CQIA 1LZLA 1QO0D 1W4RA 2RHDA 3U62A 1A9TA 3LQQA 1HY3A 2VSOA 1U0HC 2PQMA 4FT4A 2GETA 3G3EA 4O8ZA 3KOUA 5EIBD 1JHZA 3ELUA 3H9BA 5IEBA 5KYWB 4QOEA 3WICA 3A1EA 1FDVA 1OH6A 1OXMA 1XMJA 1H8ED 4ND6A 3T7AA 4IBOA 1J22A 1BIFA 1OFIA 1SXHA 3CE6A 3DUFA 4ETIA 3VM6A 1MO5A 2E87A 2WYHA 3UCXA 5DEIA 1JSRA 2CLKB 3G49A 2FJUA 3A3PA 4QFMA 1Z75A 4US1R 4YCMA 2XCRB 1OGJA 2GBIA 1UMBA 3TOCA 3G02A 3QE9Y 1G7CA 3C16C 3ZNNA 3AUXA 3TLMA 3R5FA 4MW1A 5B7PA 4P92A 5EJ2A 3ZVLA 5K01A 3ADCA 3T5AA 1QRSA 4J4HA 2O7VA 3FAKA 5LIRA 2UXCB 1XAHA 4AZWA 3OTHA 1LNQA 3DR3A 3TLJA 4ZALA 3QYFA 2LV8A 1QGOA 1W76A 1E3TA 3U9LA 1L4KA 1M2KA 1I1NA 1UPAA 1QUEA 4TV9F 3ZZMA 4E0BA 1QTQA 4X6UA 3KZNA 5CB0A 3DD1A 4YGXB 1WEKA 3MGCA 5KQPA 1F51E 1MQ8B 1TO1E 3CGWA 2WJIA 1U0GA 2JAXA 1LX7A 1KFBB 3AB7A 1P4GA 1XZGA 4K9SA 2Y2VA 3ZCXA 1YULA 3QIVA 1P3JA 1GRNA 3K0AB 4EG6A 2O8VA 1L7AA 2CZQA 2JD1A 2F4VB 4Q1DA 3TSWA 1UR5A 1GAEO 4GI2A 2HNBA 3T99A 2GPWA 2R47A 3PPYA 2IA5A 4R9RA 4C7KA 1CULC 3IAFA 2BZSA 3QU9A 4NX2A 1JLLA 2PUVA 3MILA 4ZQBA 3WAGA 2OG1A 1ECBA 3I42A 5AKXA 5JV5A 1RPZA 5FT9A 1CUFA 4MLDA 2BMEA 3DTNA 3ES9A 1V8DA 3ONVA 4UZSA 4ZZ2A 2G1PA 2A9QA 3WK4A 1EVYA 4UVIA 5CDFE 5DYTA 4TTPA 1WKVA 1ZJ6A 4IHKA 1XDUA 4PR3A 3DYIA 3TLGB 5I7RA 2P6NA 4YXFA 4TRMA 5EJAA 4L8WB 3I6QA 4Z9FA 4Y1FA 3WJ1A 4ZCRA 1XZDA 3FH0A 3GDWA 2AH5A 3GT4A 4O2AF 3GPLA 1DCMA 3LUFA 4ND5A 4KUHA 5FI0B 1T1GA 2JIBA 2Q21A 4P93A 1L1EA 3WHIA 5DOVA 4A92A 4CCAA 3OLQA 3AWDA 4NNJA 2WU3A 4OEHA 3TUZC 4C14A 2I29A 1FY2A 3Q72A 1UJCA 3FTQA 3F6EX 5JNLA 2GM5A 3OHSX 2FCAA 4B5LA 1AQNA 1KJNA 1N33B 1MA3A 1KKMA 4KXVA 3N8IA 5AESA 2IHUA 1KY5A 2GD1O 4O02B 3ORFA 3IEUA 4KN8A 2PL5A 4V2UA 1CS0B 2XA9A 4W5RA 4RPJA 1TAUA 3DKIA 2ID9A 4N7RA 5EP1A 3A32A 4BNMA 1OTYA 1LU9A 1XNRB 1KTVA 4AI6A 3C6KA 4PG5A 4FGSA 2Z6QA 2XMDA 1U28C 3G7UA 5H0IA 3WSWA 1O5OA 5AW6A 1R8XA 5DN6A 4MINA 4R5MA 4FMDF 1P8JA 1O87A 4PHFA 2QJRA 3WLNA 1WB9A 2UXDB 4JJEA 5DTRA 4LJ9A 4BNFA 1N1MA 1OLOA 2CL5A 4KO4S 1Q83A 1BD4A 1VKRA 1PJTA 2DPMA 4IIXA 2EHDA 3RJTA 4B3CA 2GRAA 3VOSA 3W3AD 2WHPA 5IDQA 3I72A 2CKMA 2OK7A 3EAGA 2XOXA 4LSZA 5J2TF 5LC1A 3L4JA 4WFKA 5A7FA 5SYNA 5IUNC 2Z4SA 3IVXA 3GFQA 6ADHA 4XLTA 3Q8KA 1JLKA 5CDFA 3EQ6A 1YHZA 2TS1A 1QP4A 2Y4OA 2IYQA 2PT5A 5TQ0A 3EIFA 5AKJA 4V1CA 3JU3A 3P27A 2DTEA 2EZTA 3GW8A 5TQVA 2RK6A 3HZHA 3K92A 1ONBA 2B98A 3W5SA 1J9ZA 1DMSA 4KQWA 3ZY5A 1WXXA 5AUPB 3DEKA 1IOZA 2YWDA 5BNTA 2JHPA 1TEVA 5A5DA 5IKEA 3HJHA 3W5HA 1W35A 2V7VA 5B64A 5I4KA 5JYEA 5JQGF 2B92A 3STWA 4M0EA 1Y3CE 2R8YA 4RSGA 3V4VB 2TMGA 1TECE 1XQWA 1U3TA 4MKIA 5E6UB 4HPJB 5D8DA 3KR9A 5EIBC 5ARBA 1VLZA 2ZI6A 4DLTA 4GXQA 4H35A 3JY6A 1CQWA 5CVJA 4RHXA 3WWOA 2I8CA 3N2LA 5TS2A 1W48A 1ZK4A 3NTLA 4N8EA 3EVGA 2O7SA 5EL0A 5JQGB 3RFUA 1DINA 2IE0A 2AZMA 2C9ZA 3GX1A 3K94A 2QBYA 1J1UA 4P3XA 5MHTA 1MDFA 1VSBA 3RSOA 3FVTA 4L4UA 1F2DA 5K0GA 3SQNA 2FMUA 1J2YA 1ZUHA 3EGIA 3P9ZA 1KRHA 5DK6A 4Z3OA 2O8CA 1HE2A 1CJUC 1Q3HA 2CXUA 4I1UA 1FL9A 1N4AA 3AESB 3I83A 1D2RA 4F9TA 4KE8A 1LBSA 4EF4A 3VSEA 4B4WA 2GN6A 3EF1A 4RPHA 5IWCA 1ML4A 1G8FA 4RZ2A 4MJ3A 5DM60 3CLUC 3PPXA 4MA0A 4D98A 5DHUA 2ZYWX 3B48A 3B6IA 3C1TA 3Q9SA 4JEUA 5K8TA 2E4WA 5EZ6B 1SBTA 2Y92A 1B8OA 2VQ3A 5AJTA 2OE2A 1E3SA 3HY3A 2Q4EA 2C7VA 3MLBA 3QFCA 4KGVA 4ZT6A 3KSAC 3NHAA 1PVDA 4NBTA 3RM3A 1Z4MA 1XR3A 2VDUE 4RVGA 3L0BA 4QGBA 2JEYA 4ZOLF 2G71A 2EOAA 1T5IA 1TDJA 4ZVRA 4CDGA 4PW0A 2DWOA 3U3DA 3A2MA 3C5HA 3NHZA 4RPCA 3NO4A 3ECAA 3ZXIA 2Q1SA 3TOSA 6YASA 5JCXA 1CY6A 1LA2A 3L5OA 2H63A 2O5VA 5JU6A 3T9AA 5LWHA 2ERCA 3HVRA 1JIXA 5KNBH 2HHHB 1K97A 1PFGA 1EKXA 1XFAA 4M76B 4M9ZA 3R7SA 6NULA 3HKEA 3TCXB 4UTPA 2V3VA 1K75A 5FBRB 1X7ZB 3GJ4A 1KO4A 1USIA 1B41A 4LPKA 2HGZA 3M81A 5IBPA 1KZGB 1EQAA 2VT6A 4MUHA 2AJDA 2ORYA 4GP9A 3EEYA 4BJHB 5BPHA 1UK7A 4OYYA 3TLAA 1H4SA 3BTOA 3IPRA 3MTGA 4K5QA 4MB2A 1LBEA 1NMYA 4BTVA 5BMOA 5ICFA 4KE9A 1TW3A 2CXPA 3LHDA 1TNDA 1KH1A 2OCBA 1HRKA 2YZNA 3INGA 1UC5B 1XF9A 4XI9A 3TLGA 5COQA 1J5XA 2IPAB 5TPWA 2WUWE 1DKLA 3KVOA 3WX0A 2GB4A 4BO3A 1QK4A 1B74A 4D97A 4DVJA 3L1VA 2H4ZA